Basic Information | |
---|---|
Family ID | F006082 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 382 |
Average Sequence Length | 47 residues |
Representative Sequence | EMGPCQYERNNCRASGGRVFAADGVEITLATEAEYDKKVMRVRFRAN |
Number of Associated Samples | 286 |
Number of Associated Scaffolds | 382 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.90 % |
% of genes near scaffold ends (potentially truncated) | 78.27 % |
% of genes from short scaffolds (< 2000 bps) | 77.49 % |
Associated GOLD sequencing projects | 256 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.466 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (4.974 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.670 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.288 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.00% β-sheet: 2.67% Coil/Unstructured: 61.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 382 Family Scaffolds |
---|---|---|
PF04519 | Bactofilin | 6.02 |
PF00248 | Aldo_ket_red | 3.93 |
PF17167 | Glyco_hydro_36 | 3.14 |
PF01564 | Spermine_synth | 2.36 |
PF13591 | MerR_2 | 2.09 |
PF01011 | PQQ | 2.09 |
PF13424 | TPR_12 | 1.83 |
PF12146 | Hydrolase_4 | 1.57 |
PF05853 | BKACE | 1.57 |
PF13360 | PQQ_2 | 1.31 |
PF02826 | 2-Hacid_dh_C | 1.31 |
PF01648 | ACPS | 1.31 |
PF13442 | Cytochrome_CBB3 | 1.31 |
PF04862 | DUF642 | 1.05 |
PF05548 | Peptidase_M11 | 1.05 |
PF00027 | cNMP_binding | 1.05 |
PF13545 | HTH_Crp_2 | 1.05 |
PF01734 | Patatin | 1.05 |
PF01738 | DLH | 0.79 |
PF00270 | DEAD | 0.79 |
PF00211 | Guanylate_cyc | 0.79 |
PF01556 | DnaJ_C | 0.52 |
PF12974 | Phosphonate-bd | 0.52 |
PF08298 | AAA_PrkA | 0.52 |
PF16640 | Big_3_5 | 0.52 |
PF14497 | GST_C_3 | 0.52 |
PF02771 | Acyl-CoA_dh_N | 0.52 |
PF04378 | RsmJ | 0.52 |
PF13801 | Metal_resist | 0.52 |
PF08546 | ApbA_C | 0.52 |
PF01979 | Amidohydro_1 | 0.52 |
PF07043 | DUF1328 | 0.26 |
PF02789 | Peptidase_M17_N | 0.26 |
PF03631 | Virul_fac_BrkB | 0.26 |
PF04909 | Amidohydro_2 | 0.26 |
PF05872 | HerA_C | 0.26 |
PF00348 | polyprenyl_synt | 0.26 |
PF12681 | Glyoxalase_2 | 0.26 |
PF12840 | HTH_20 | 0.26 |
PF13844 | Glyco_transf_41 | 0.26 |
PF13502 | AsmA_2 | 0.26 |
PF07883 | Cupin_2 | 0.26 |
PF13676 | TIR_2 | 0.26 |
PF07209 | DUF1415 | 0.26 |
PF13343 | SBP_bac_6 | 0.26 |
PF01797 | Y1_Tnp | 0.26 |
PF13491 | FtsK_4TM | 0.26 |
PF01425 | Amidase | 0.26 |
PF04397 | LytTR | 0.26 |
PF13407 | Peripla_BP_4 | 0.26 |
PF00126 | HTH_1 | 0.26 |
PF03466 | LysR_substrate | 0.26 |
PF14588 | YjgF_endoribonc | 0.26 |
PF00903 | Glyoxalase | 0.26 |
PF00106 | adh_short | 0.26 |
PF07729 | FCD | 0.26 |
PF00501 | AMP-binding | 0.26 |
PF04471 | Mrr_cat | 0.26 |
PF00472 | RF-1 | 0.26 |
PF04392 | ABC_sub_bind | 0.26 |
PF04536 | TPM_phosphatase | 0.26 |
PF14833 | NAD_binding_11 | 0.26 |
PF00583 | Acetyltransf_1 | 0.26 |
PF08544 | GHMP_kinases_C | 0.26 |
PF05977 | MFS_3 | 0.26 |
PF05227 | CHASE3 | 0.26 |
PF02560 | Cyanate_lyase | 0.26 |
PF00135 | COesterase | 0.26 |
PF07045 | DUF1330 | 0.26 |
PF01494 | FAD_binding_3 | 0.26 |
PF07978 | NIPSNAP | 0.26 |
PF01694 | Rhomboid | 0.26 |
PF01048 | PNP_UDP_1 | 0.26 |
PF00872 | Transposase_mut | 0.26 |
PF00005 | ABC_tran | 0.26 |
PF10947 | DUF2628 | 0.26 |
COG ID | Name | Functional Category | % Frequency in 382 Family Scaffolds |
---|---|---|---|
COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 6.02 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 1.57 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.05 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.05 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.05 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.79 |
COG2961 | 23S rRNA A2030 N6-methylase RlmJ | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.52 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.52 |
COG2766 | Predicted Ser/Thr protein kinase | Signal transduction mechanisms [T] | 0.52 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.52 |
COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.26 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.26 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.26 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.26 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.26 |
COG3310 | Uncharacterized conserved protein, DUF1415 family | Function unknown [S] | 0.26 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.26 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.26 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.26 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.26 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.26 |
COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.26 |
COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.26 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.26 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.26 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.26 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.26 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.26 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.26 |
COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.26 |
COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 0.26 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.73 % |
Unclassified | root | N/A | 28.27 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459024|GZRSKLJ01BV7MM | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
2228664021|ICCgaii200_c0628497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
3300000893|AP72_2010_repI_A001DRAFT_1039852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 737 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100909268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
3300001213|JGIcombinedJ13530_106766496 | Not Available | 582 | Open in IMG/M |
3300001213|JGIcombinedJ13530_108842157 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100860824 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300003858|Ga0031656_10074640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
3300003858|Ga0031656_10227754 | Not Available | 636 | Open in IMG/M |
3300004000|Ga0055458_10100750 | Not Available | 796 | Open in IMG/M |
3300004014|Ga0055456_10070058 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300004079|Ga0055514_10218541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 550 | Open in IMG/M |
3300004266|Ga0055457_10092901 | Not Available | 802 | Open in IMG/M |
3300004282|Ga0066599_100161271 | Not Available | 1168 | Open in IMG/M |
3300004479|Ga0062595_100379509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1001 | Open in IMG/M |
3300004779|Ga0062380_10138758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 940 | Open in IMG/M |
3300004779|Ga0062380_10401553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 596 | Open in IMG/M |
3300005093|Ga0062594_102622449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
3300005175|Ga0066673_10245104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
3300005327|Ga0070658_10758824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
3300005329|Ga0070683_100638604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1019 | Open in IMG/M |
3300005334|Ga0068869_101870978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 537 | Open in IMG/M |
3300005337|Ga0070682_101018226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 688 | Open in IMG/M |
3300005339|Ga0070660_100761469 | Not Available | 813 | Open in IMG/M |
3300005340|Ga0070689_100998916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 744 | Open in IMG/M |
3300005354|Ga0070675_101340801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 659 | Open in IMG/M |
3300005355|Ga0070671_101737100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
3300005356|Ga0070674_100144328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1790 | Open in IMG/M |
3300005356|Ga0070674_100442065 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300005366|Ga0070659_101628272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
3300005434|Ga0070709_11598114 | Not Available | 531 | Open in IMG/M |
3300005435|Ga0070714_101292679 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300005447|Ga0066689_10237370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
3300005454|Ga0066687_10029294 | All Organisms → cellular organisms → Bacteria | 2410 | Open in IMG/M |
3300005456|Ga0070678_101086532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
3300005458|Ga0070681_10446057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1206 | Open in IMG/M |
3300005458|Ga0070681_12036436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
3300005459|Ga0068867_101409579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 646 | Open in IMG/M |
3300005466|Ga0070685_11179727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 581 | Open in IMG/M |
3300005467|Ga0070706_100057924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3575 | Open in IMG/M |
3300005471|Ga0070698_100749527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300005526|Ga0073909_10640801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 528 | Open in IMG/M |
3300005529|Ga0070741_11141042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 660 | Open in IMG/M |
3300005535|Ga0070684_101741766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 588 | Open in IMG/M |
3300005536|Ga0070697_100822261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300005536|Ga0070697_101390656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 626 | Open in IMG/M |
3300005547|Ga0070693_100076717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1981 | Open in IMG/M |
3300005548|Ga0070665_100581452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1133 | Open in IMG/M |
3300005563|Ga0068855_101395901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 722 | Open in IMG/M |
3300005564|Ga0070664_101330755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 679 | Open in IMG/M |
3300005577|Ga0068857_100677177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 979 | Open in IMG/M |
3300005577|Ga0068857_100704431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 959 | Open in IMG/M |
3300005577|Ga0068857_102087276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
3300005577|Ga0068857_102568006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
3300005614|Ga0068856_100032661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuricella → Sulfuricella denitrificans | 5096 | Open in IMG/M |
3300005615|Ga0070702_100830811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 717 | Open in IMG/M |
3300005616|Ga0068852_101331145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 740 | Open in IMG/M |
3300005618|Ga0068864_100456554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
3300005718|Ga0068866_10734955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 680 | Open in IMG/M |
3300005718|Ga0068866_10778298 | Not Available | 663 | Open in IMG/M |
3300005719|Ga0068861_102148226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300005834|Ga0068851_10397964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 810 | Open in IMG/M |
3300005836|Ga0074470_10014413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1527 | Open in IMG/M |
3300005842|Ga0068858_102283964 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005843|Ga0068860_101067124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 827 | Open in IMG/M |
3300005843|Ga0068860_101311033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 745 | Open in IMG/M |
3300005844|Ga0068862_102071287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 580 | Open in IMG/M |
3300005938|Ga0066795_10105975 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300005993|Ga0080027_10010130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3388 | Open in IMG/M |
3300005993|Ga0080027_10459196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
3300006032|Ga0066696_10186942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1314 | Open in IMG/M |
3300006034|Ga0066656_10314622 | All Organisms → cellular organisms → Eukaryota | 1011 | Open in IMG/M |
3300006046|Ga0066652_101006936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 791 | Open in IMG/M |
3300006058|Ga0075432_10264959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 702 | Open in IMG/M |
3300006173|Ga0070716_100850557 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300006358|Ga0068871_100338111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1329 | Open in IMG/M |
3300006755|Ga0079222_10300122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1048 | Open in IMG/M |
3300006800|Ga0066660_10640119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 884 | Open in IMG/M |
3300006804|Ga0079221_11099963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 608 | Open in IMG/M |
3300006903|Ga0075426_10135834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1771 | Open in IMG/M |
3300006918|Ga0079216_10914136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
3300006953|Ga0074063_13846574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1844 | Open in IMG/M |
3300007076|Ga0075435_101371277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
3300009012|Ga0066710_104316038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 531 | Open in IMG/M |
3300009075|Ga0105090_10459553 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300009075|Ga0105090_10880132 | Not Available | 545 | Open in IMG/M |
3300009091|Ga0102851_10709032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1065 | Open in IMG/M |
3300009100|Ga0075418_10997886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 906 | Open in IMG/M |
3300009100|Ga0075418_12770723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
3300009111|Ga0115026_10183679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1381 | Open in IMG/M |
3300009120|Ga0117941_1003631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4756 | Open in IMG/M |
3300009131|Ga0115027_10334069 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
3300009131|Ga0115027_10929454 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300009137|Ga0066709_100432876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1834 | Open in IMG/M |
3300009148|Ga0105243_10320972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1411 | Open in IMG/M |
3300009165|Ga0105102_10365300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
3300009167|Ga0113563_12057701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 683 | Open in IMG/M |
3300009179|Ga0115028_11524034 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300009551|Ga0105238_10786363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 967 | Open in IMG/M |
3300009551|Ga0105238_11863918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 634 | Open in IMG/M |
3300009551|Ga0105238_12187661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 588 | Open in IMG/M |
3300009553|Ga0105249_13283338 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300009667|Ga0116147_1162617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
3300010046|Ga0126384_11762038 | Not Available | 587 | Open in IMG/M |
3300010046|Ga0126384_11934047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
3300010046|Ga0126384_12386782 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300010154|Ga0127503_10726789 | Not Available | 537 | Open in IMG/M |
3300010303|Ga0134082_10535322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300010335|Ga0134063_10401675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300010335|Ga0134063_10425464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 655 | Open in IMG/M |
3300010347|Ga0116238_10099644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2229 | Open in IMG/M |
3300010361|Ga0126378_11982637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 663 | Open in IMG/M |
3300010371|Ga0134125_10613828 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300010373|Ga0134128_10309612 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
3300010373|Ga0134128_10561977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1271 | Open in IMG/M |
3300010375|Ga0105239_13114916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 540 | Open in IMG/M |
3300010401|Ga0134121_11416536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 706 | Open in IMG/M |
3300011429|Ga0137455_1252045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
3300011445|Ga0137427_10119110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1074 | Open in IMG/M |
3300012189|Ga0137388_11797544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
3300012206|Ga0137380_10926262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
3300012208|Ga0137376_10985391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 722 | Open in IMG/M |
3300012363|Ga0137390_11820389 | Not Available | 540 | Open in IMG/M |
3300012527|Ga0136633_1243842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 661 | Open in IMG/M |
3300012923|Ga0137359_10859020 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300012948|Ga0126375_10547311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 873 | Open in IMG/M |
3300012951|Ga0164300_10559957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 666 | Open in IMG/M |
3300012955|Ga0164298_11170003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 581 | Open in IMG/M |
3300012960|Ga0164301_11191680 | Not Available | 611 | Open in IMG/M |
3300012984|Ga0164309_10303355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1152 | Open in IMG/M |
3300012987|Ga0164307_11339912 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300012988|Ga0164306_10734314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 788 | Open in IMG/M |
3300013102|Ga0157371_10132006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1777 | Open in IMG/M |
3300013102|Ga0157371_10528807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 873 | Open in IMG/M |
3300013296|Ga0157374_12596773 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300013307|Ga0157372_13289961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
3300013308|Ga0157375_10592081 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
3300013308|Ga0157375_12918982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 571 | Open in IMG/M |
3300014166|Ga0134079_10380713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
3300014298|Ga0075341_1112574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 544 | Open in IMG/M |
3300014306|Ga0075346_1079960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 687 | Open in IMG/M |
3300014316|Ga0075339_1113689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 725 | Open in IMG/M |
3300014325|Ga0163163_10221785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1939 | Open in IMG/M |
3300014326|Ga0157380_10592413 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300014326|Ga0157380_10605173 | Not Available | 1085 | Open in IMG/M |
3300014326|Ga0157380_11611827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300014326|Ga0157380_13106777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
3300014745|Ga0157377_10870908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 671 | Open in IMG/M |
3300014745|Ga0157377_11170419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
3300014968|Ga0157379_12415251 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300015075|Ga0167636_1005523 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300015201|Ga0173478_10515065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300015371|Ga0132258_11298626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1839 | Open in IMG/M |
3300015371|Ga0132258_12536028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
3300015371|Ga0132258_13728052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1039 | Open in IMG/M |
3300015373|Ga0132257_100397454 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1675 | Open in IMG/M |
3300015373|Ga0132257_101049804 | Not Available | 1027 | Open in IMG/M |
3300015373|Ga0132257_103924567 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300015373|Ga0132257_104297982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
3300015374|Ga0132255_101157531 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300015374|Ga0132255_101493552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1022 | Open in IMG/M |
3300015374|Ga0132255_104123408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
3300017792|Ga0163161_11587806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
3300017792|Ga0163161_11730140 | Not Available | 554 | Open in IMG/M |
3300017961|Ga0187778_11115580 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300018029|Ga0187787_10173916 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300018075|Ga0184632_10202557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 873 | Open in IMG/M |
3300018433|Ga0066667_10479033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
3300018433|Ga0066667_11297857 | Not Available | 636 | Open in IMG/M |
3300018468|Ga0066662_11166984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
3300019879|Ga0193723_1145847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 638 | Open in IMG/M |
3300019888|Ga0193751_1158057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 805 | Open in IMG/M |
3300020006|Ga0193735_1059227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
3300020062|Ga0193724_1024971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
3300020082|Ga0206353_10688341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
3300020581|Ga0210399_10616541 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300021080|Ga0210382_10400581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
3300021418|Ga0193695_1132196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
3300021478|Ga0210402_10113136 | All Organisms → cellular organisms → Bacteria | 2448 | Open in IMG/M |
3300022892|Ga0247753_1023467 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300023102|Ga0247754_1048024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 986 | Open in IMG/M |
3300025893|Ga0207682_10562304 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300025898|Ga0207692_10035252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2430 | Open in IMG/M |
3300025900|Ga0207710_10782098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 502 | Open in IMG/M |
3300025901|Ga0207688_10089677 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
3300025906|Ga0207699_10403851 | Not Available | 973 | Open in IMG/M |
3300025916|Ga0207663_10576000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 882 | Open in IMG/M |
3300025917|Ga0207660_10839532 | Not Available | 750 | Open in IMG/M |
3300025917|Ga0207660_10853149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 743 | Open in IMG/M |
3300025920|Ga0207649_11402426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
3300025923|Ga0207681_10906058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 738 | Open in IMG/M |
3300025924|Ga0207694_11363849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
3300025925|Ga0207650_11374013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
3300025926|Ga0207659_10830579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 794 | Open in IMG/M |
3300025930|Ga0207701_10259882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1514 | Open in IMG/M |
3300025931|Ga0207644_11526464 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025933|Ga0207706_11014202 | Not Available | 697 | Open in IMG/M |
3300025936|Ga0207670_10063903 | Not Available | 2521 | Open in IMG/M |
3300025937|Ga0207669_10604526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 892 | Open in IMG/M |
3300025937|Ga0207669_11354490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 605 | Open in IMG/M |
3300025940|Ga0207691_10763634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 813 | Open in IMG/M |
3300025940|Ga0207691_11349803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
3300025940|Ga0207691_11470088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 558 | Open in IMG/M |
3300025940|Ga0207691_11695466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
3300025941|Ga0207711_11003066 | Not Available | 774 | Open in IMG/M |
3300025942|Ga0207689_11744008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
3300025945|Ga0207679_10223860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1584 | Open in IMG/M |
3300025948|Ga0210088_1072841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
3300025972|Ga0207668_10873694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 799 | Open in IMG/M |
3300025986|Ga0207658_10086826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2414 | Open in IMG/M |
3300025986|Ga0207658_10606007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 984 | Open in IMG/M |
3300026041|Ga0207639_10727198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 922 | Open in IMG/M |
3300026041|Ga0207639_11868937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
3300026059|Ga0208540_1016560 | Not Available | 811 | Open in IMG/M |
3300026067|Ga0207678_10031050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4663 | Open in IMG/M |
3300026067|Ga0207678_10539867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
3300026078|Ga0207702_10308833 | Not Available | 1503 | Open in IMG/M |
3300026088|Ga0207641_10422419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1284 | Open in IMG/M |
3300026089|Ga0207648_12010671 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300026095|Ga0207676_10039648 | Not Available | 3604 | Open in IMG/M |
3300026118|Ga0207675_100229514 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
3300026121|Ga0207683_11208970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 700 | Open in IMG/M |
3300026142|Ga0207698_11133127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 795 | Open in IMG/M |
3300026142|Ga0207698_11149553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 790 | Open in IMG/M |
3300026281|Ga0209863_10151040 | Not Available | 678 | Open in IMG/M |
3300026291|Ga0209890_10132600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 840 | Open in IMG/M |
3300026476|Ga0256808_1018499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
3300026542|Ga0209805_1231275 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300026547|Ga0209156_10385329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
3300026548|Ga0209161_10391379 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300026550|Ga0209474_10212910 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300027682|Ga0209971_1048250 | Not Available | 1028 | Open in IMG/M |
3300027725|Ga0209178_1056159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1269 | Open in IMG/M |
3300027765|Ga0209073_10030205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1672 | Open in IMG/M |
3300027871|Ga0209397_10409731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 664 | Open in IMG/M |
3300027871|Ga0209397_10612073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
3300027897|Ga0209254_10067695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3063 | Open in IMG/M |
3300027897|Ga0209254_10191001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1644 | Open in IMG/M |
3300027902|Ga0209048_10000179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 67618 | Open in IMG/M |
3300027975|Ga0209391_10282801 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300028597|Ga0247820_10443611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
3300028736|Ga0302214_1111777 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300028828|Ga0307312_10296455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
3300029984|Ga0311332_11066759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
3300029987|Ga0311334_10295277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1265 | Open in IMG/M |
3300029989|Ga0311365_10748370 | Not Available | 846 | Open in IMG/M |
3300029990|Ga0311336_11514414 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300030002|Ga0311350_11315039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 643 | Open in IMG/M |
3300030019|Ga0311348_10201334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1483 | Open in IMG/M |
3300030838|Ga0311335_10990717 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300030943|Ga0311366_11338452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
3300031170|Ga0307498_10375119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 553 | Open in IMG/M |
3300031232|Ga0302323_101016853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 921 | Open in IMG/M |
3300031232|Ga0302323_102368541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 605 | Open in IMG/M |
3300031232|Ga0302323_102648471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 573 | Open in IMG/M |
3300031455|Ga0307505_10083044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1429 | Open in IMG/M |
3300031572|Ga0318515_10145505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1261 | Open in IMG/M |
3300031720|Ga0307469_10620039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 970 | Open in IMG/M |
3300031726|Ga0302321_103590172 | Not Available | 504 | Open in IMG/M |
3300031731|Ga0307405_10401412 | Not Available | 1073 | Open in IMG/M |
3300031740|Ga0307468_100996472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300031740|Ga0307468_102271331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
3300031768|Ga0318509_10157024 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300031797|Ga0318550_10204627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 955 | Open in IMG/M |
3300031821|Ga0318567_10802956 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031847|Ga0310907_10375192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
3300031873|Ga0315297_11195082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
3300031944|Ga0310884_10397326 | Not Available | 791 | Open in IMG/M |
3300031996|Ga0308176_10376678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1409 | Open in IMG/M |
3300031997|Ga0315278_10700422 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300031997|Ga0315278_11732057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 593 | Open in IMG/M |
3300032008|Ga0318562_10765153 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300032035|Ga0310911_10049482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2183 | Open in IMG/M |
3300032059|Ga0318533_10069936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2375 | Open in IMG/M |
3300032074|Ga0308173_11921851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
3300032075|Ga0310890_10067163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2122 | Open in IMG/M |
3300032075|Ga0310890_11141326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 632 | Open in IMG/M |
3300032092|Ga0315905_11428891 | Not Available | 548 | Open in IMG/M |
3300032143|Ga0315292_10826480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 775 | Open in IMG/M |
3300032143|Ga0315292_11407127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 567 | Open in IMG/M |
3300032164|Ga0315283_11626849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 656 | Open in IMG/M |
3300032177|Ga0315276_10449985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1382 | Open in IMG/M |
3300032177|Ga0315276_12445138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
3300032180|Ga0307471_102138960 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300032205|Ga0307472_102311732 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300032256|Ga0315271_10716183 | Not Available | 860 | Open in IMG/M |
3300032256|Ga0315271_11018400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 715 | Open in IMG/M |
3300032256|Ga0315271_11778132 | Not Available | 529 | Open in IMG/M |
3300032275|Ga0315270_10418007 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300032397|Ga0315287_12802900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 516 | Open in IMG/M |
3300032516|Ga0315273_11560555 | Not Available | 808 | Open in IMG/M |
3300032516|Ga0315273_11714657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rubrivivax → unclassified Rubrivivax → Rubrivivax sp. | 760 | Open in IMG/M |
3300032782|Ga0335082_10269669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1580 | Open in IMG/M |
3300032783|Ga0335079_10713000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1047 | Open in IMG/M |
3300033408|Ga0316605_11869889 | Not Available | 584 | Open in IMG/M |
3300033412|Ga0310810_10083410 | All Organisms → cellular organisms → Bacteria | 3844 | Open in IMG/M |
3300033413|Ga0316603_10293700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1432 | Open in IMG/M |
3300033413|Ga0316603_12272345 | Not Available | 511 | Open in IMG/M |
3300033416|Ga0316622_101902330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
3300033418|Ga0316625_100729251 | Not Available | 837 | Open in IMG/M |
3300033418|Ga0316625_101070642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300033418|Ga0316625_101713832 | Not Available | 606 | Open in IMG/M |
3300033419|Ga0316601_101008799 | Not Available | 831 | Open in IMG/M |
3300033419|Ga0316601_101858015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 607 | Open in IMG/M |
3300033433|Ga0326726_10074325 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3003 | Open in IMG/M |
3300033482|Ga0316627_100317949 | Not Available | 1289 | Open in IMG/M |
3300033483|Ga0316629_11744942 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300033488|Ga0316621_10673619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 744 | Open in IMG/M |
3300033550|Ga0247829_11683221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 523 | Open in IMG/M |
3300033557|Ga0316617_100929876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 844 | Open in IMG/M |
3300033557|Ga0316617_101462769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300033557|Ga0316617_102831628 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300034281|Ga0370481_0254566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
3300034354|Ga0364943_0438359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 508 | Open in IMG/M |
3300034817|Ga0373948_0150598 | Not Available | 581 | Open in IMG/M |
3300034965|Ga0370497_0141798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 597 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.71% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.93% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.62% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.36% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.09% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.09% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.83% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.05% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.05% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.05% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.79% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.79% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.52% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.52% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.52% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.52% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.26% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.26% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.26% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.26% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.26% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.26% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.26% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.26% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.26% |
Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.26% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.26% |
Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.26% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.26% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.26% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.26% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.26% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.26% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.26% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004014 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 | Environmental | Open in IMG/M |
3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
3300004266 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021322 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.298 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
3300026476 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6 | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028736 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_3 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD1_09307330 | 2170459024 | Grass Soil | DLCRKHPEMGPCKYERDVCRRSGGRVYAANGVEITKQTEAEYDKRVLRVVFKSN |
ICCgaii200_06284972 | 2228664021 | Soil | MGPCQYERDLCRKSGGRVFTADGHEITRAVEDAYDRKVMRVRFRAN |
AP72_2010_repI_A001DRAFT_10398523 | 3300000893 | Forest Soil | EREGCRRNGGRVYAADGKEITRVTEAEYDRKVMRLRFRAD* |
JGIcombinedJ13530_1009092681 | 3300001213 | Wetland | EMGPCQYERNACRRGGGRVFAANGTEITMATEAEYDRKVMRVRFKGG* |
JGIcombinedJ13530_1067664962 | 3300001213 | Wetland | PEMGPCQYERNLCRASGGRVYAAGGVEITLATEAEYDRKVMRVRFKAD* |
JGIcombinedJ13530_1088421572 | 3300001213 | Wetland | RNACRRSGGRVYAAGGAEITLQMEAEYDRKVMRILIK* |
JGIcombinedJ26739_1008608241 | 3300002245 | Forest Soil | CQYERNACRKSGGRVFAAEGKEITMATEAEYDRKVIRIRLKSN* |
Ga0031656_100746401 | 3300003858 | Freshwater Lake Sediment | CQYERNACRRGGGRVYAADGTEITLATESEYDRRVRRVQFKAN* |
Ga0031656_102277542 | 3300003858 | Freshwater Lake Sediment | PKVGALCAKHPEMGPCQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRLK* |
Ga0055458_101007502 | 3300004000 | Natural And Restored Wetlands | KVGELCRRHPEMGPCQYERDVCRGSGGRVFAAGGFEITRAVEAEYDRKVMRVRFKAN* |
Ga0055456_100700582 | 3300004014 | Natural And Restored Wetlands | MGPCQYERDVCRSSGGRVFAAGGFEITRAVEAEYDRKVMRVRFKAN* |
Ga0055514_102185412 | 3300004079 | Natural And Restored Wetlands | HPEMGPCQYERNLCRRSGGRIYAAGGEEITMATEAEYDKHVLRVRFKSN* |
Ga0055457_100929011 | 3300004266 | Natural And Restored Wetlands | PEMGPCQYERDVCRSSGGRVFAAGGFEITRAVEAEYDRKVMRVRFKAN* |
Ga0066599_1001612712 | 3300004282 | Freshwater | VGPLCAKHPEMSPCQYERNVCRRSGGRVYAAGGVEITLQTEADYDRKVMRVIIN* |
Ga0062595_1003795091 | 3300004479 | Soil | PCQYERDACRRSGGRVFAADGSEITRSTEDEYDKRVMRIRLRSN* |
Ga0062380_101387582 | 3300004779 | Wetland Sediment | MGPCQYERNACRRGGGRVYAADGTEITLAIEAEYDRRVRRVQFKSN* |
Ga0062380_104015532 | 3300004779 | Wetland Sediment | KVKQLCSKHPEMGVCQYEREACRASGGRVHTTKGIEITRQTEAEYDKKVLRVRFRAG* |
Ga0062594_1026224491 | 3300005093 | Soil | HPEMGPCQYERDVCRRSGGRVFAANGQEITAATEAEYDRKVTRVRFRAN* |
Ga0066673_102451042 | 3300005175 | Soil | LCRKHPEMGPCQYERNNCRASGGRVFAADGVEITMATEAEYDKKVMRVRFRAN* |
Ga0066678_110577182 | 3300005181 | Soil | RSICRRSGGRVFAANGLEITQLTELEYDKRVMRVVFRAD* |
Ga0070658_107588241 | 3300005327 | Corn Rhizosphere | RHPEMGPCQYERDLCRSSGGRVFAASGQEITRQIEDEYDRKVLRVRFRAN* |
Ga0070683_1006386042 | 3300005329 | Corn Rhizosphere | HPEMGPCQYERDLCRNSGGRVFTASGQEITRQIEDEYDRKVLRVRFRAN* |
Ga0066388_1009853803 | 3300005332 | Tropical Forest Soil | EMGPCQYARNACRQNGGRVYAADGGEITQADEAEYDKKVMRLRVGP* |
Ga0068869_1018709781 | 3300005334 | Miscanthus Rhizosphere | ERDICRRSGGRVYTPDGVEITLQTEAEYDKKVMRVRFKTN* |
Ga0070666_111611432 | 3300005335 | Switchgrass Rhizosphere | TEMGPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0070682_1010182262 | 3300005337 | Corn Rhizosphere | LCQRHPEMGPCQYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN* |
Ga0070660_1007614692 | 3300005339 | Corn Rhizosphere | ERNVCRQSGGRVFDTAGREITLATEAEYDRKVMRVRFRAN* |
Ga0070689_1009989161 | 3300005340 | Switchgrass Rhizosphere | EKVAALCRRHTEIGPCQSARNACRSSGGRVYAADGREITQAHEAEYDKKIMRVRVRP* |
Ga0070675_1013408011 | 3300005354 | Miscanthus Rhizosphere | LCRNHPEMGPCQYERNVCRGKGGRVFAADGTEITMATEAEYDKKVRRVTFKAN* |
Ga0070671_1014053571 | 3300005355 | Switchgrass Rhizosphere | CQNARNACRRSGGRVYAHDGSEITQADETEYDKKVMRVRVGP* |
Ga0070671_1017371002 | 3300005355 | Switchgrass Rhizosphere | MGPCQYERDLCRSSGGRVYAAGGQEITRQIEDEYDRKVLRVRF |
Ga0070674_1001443281 | 3300005356 | Miscanthus Rhizosphere | MCSKHPEMGPCQYERNACRSQGGRVFAANGSEITMATEAEYDKKVR |
Ga0070674_1004420652 | 3300005356 | Miscanthus Rhizosphere | AALCRRHTEMGPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0070659_1016282722 | 3300005366 | Corn Rhizosphere | MGPCQYERDMCRRIGGRVYTPDGVEITLQTEAEYDKKVMRVRFKAN* |
Ga0070667_1002679502 | 3300005367 | Switchgrass Rhizosphere | PCQSARNACRSSGGRVYAADGSEITKADEAEYDKKVMRLRVGP* |
Ga0070667_1004224061 | 3300005367 | Switchgrass Rhizosphere | MGPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRLRVGP* |
Ga0070709_115981141 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NPEMGPCQYEREVCRRNAGRVFAADGKEITKATEAEYDRKVMRVRLRGD* |
Ga0070714_1012926791 | 3300005435 | Agricultural Soil | EMGPCQYEREVCRRSGGRVYAVGGVEITAKTEAEYDKKVLRVRLKAN* |
Ga0066689_102373701 | 3300005447 | Soil | APKVAALCRKHPEMGPCQYERNNCRASGGRVFAADGVEITLATEAEYDKKVMRVRFRAN* |
Ga0066687_100292944 | 3300005454 | Soil | RNACRKSGGRVFAAEGKEITMATEAEYDRKVIRIRLKSN* |
Ga0070678_1010865321 | 3300005456 | Miscanthus Rhizosphere | PCQYERDICRRSGGRVFAANNVEITKDTEAEYDKKVYRVRFKAN* |
Ga0070678_1020127561 | 3300005456 | Miscanthus Rhizosphere | CQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0070681_104460571 | 3300005458 | Corn Rhizosphere | QYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN* |
Ga0070681_120364362 | 3300005458 | Corn Rhizosphere | CAKHPEMGPCQYERDICRRSGGRVYASGGVEITLQTEAEYDKKVMRVRFRAN* |
Ga0068867_1014095791 | 3300005459 | Miscanthus Rhizosphere | HPEMGPCQYERDLCRKSGGRVSTADGREITRAVEDEYDRKVMRVRFRAN* |
Ga0070685_111797272 | 3300005466 | Switchgrass Rhizosphere | KVGAMCAKHPEMGPCQYERDICRRSGGRVYAAGGAEITAQTEAEYDKKVMRVRFKAN* |
Ga0070706_1000579245 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLCAQNPEMGPCQYEREVCRRSGGRVFTADGKEITKATEAEYDRRVLRARIRAD* |
Ga0070698_1007495271 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPCQYERNVCRRSGGRVFEANGTEITMQTEAEYDKKVMRVRFKSN* |
Ga0073909_106408011 | 3300005526 | Surface Soil | NACRRSGGRVYAANGAEITVATEAEYDKKVLRVRLKGD* |
Ga0070741_111410421 | 3300005529 | Surface Soil | ALCKRHPEMGPCQYERNVCRRSGGRVFAASGEEITLATEAEYDKKVLRVRLRAN* |
Ga0070684_1017417661 | 3300005535 | Corn Rhizosphere | PEMGPCQYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN* |
Ga0070697_1008222612 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | CAQNPEMGPCQYEREVCRHGGGRVFAADGREITKATEAEYDRRVLRARIRAD* |
Ga0070697_1013906561 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RVAALCAQNPEMGPCQYEREVCRHGGGRVFAADGKEITKATEAEYDRRVLRARIRAD* |
Ga0070672_1002656371 | 3300005543 | Miscanthus Rhizosphere | GPCQSARNACRSSGGRVFAADGREITQADEAEYDKKVVRVRVGP* |
Ga0070693_1000767171 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | PGVGDLCRKHPEMGPCQYERDACRRSGGRVFAADGSEITRSIEDEYDKRVMRIRLRSN* |
Ga0070665_1005814523 | 3300005548 | Switchgrass Rhizosphere | ACRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKAN* |
Ga0070665_1017428031 | 3300005548 | Switchgrass Rhizosphere | AELCRRHTEMGPCQNARNACRRSGGRVYGADGSEVTLADEAEYDKKVMRVRVGP* |
Ga0068855_1013959011 | 3300005563 | Corn Rhizosphere | HPEMGPCQYERDACRRSGGRVFAADGSEITRSVEDEYDKRVMRIRLRSN* |
Ga0070664_1013307552 | 3300005564 | Corn Rhizosphere | QYERNACRSKGGRVFAADGKEITMATEAEYYKKVRRVTFKAN* |
Ga0068857_1006771771 | 3300005577 | Corn Rhizosphere | NVLSLCQRHPEMGPCQYERDLCRKSGGRVFTADGHEITRAVEDAYDRKVMRVRFRAN* |
Ga0068857_1007044312 | 3300005577 | Corn Rhizosphere | ERDVCRRSGGRVYAAGGVEITPETEAQYDKKVLRVRFKAN* |
Ga0068857_1020872762 | 3300005577 | Corn Rhizosphere | RRHSEMGPCQSARNACRRSGGRVYAADGSEITEADEAEYDKKVMRMRVGS* |
Ga0068857_1025680061 | 3300005577 | Corn Rhizosphere | GVGELCRKHPEMGPCQYERDACRRSGGRVFAADGSEITRSVEDEYDKRVMRIRLRSN* |
Ga0066706_114466361 | 3300005598 | Soil | GVLCRKHPEMSACKYERSICRSHGGRVFAANGIEITQLTEIEYDKRVLRVVFRAD* |
Ga0068856_1000326611 | 3300005614 | Corn Rhizosphere | MGPCQYERDVCRRSGGRVYAAGGVEITQATEAEYDKKVLRVRFKAN* |
Ga0070702_1008308112 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | DTLCRNHPEMGPCQYERNVCRGKGGRVFAADGTEITMATEAEYDKKVRRVTFKAN* |
Ga0068852_1013311453 | 3300005616 | Corn Rhizosphere | CRKHPEMGPCQYERDACRRSGGRVFAADGSEITRSVEDEYDKRVMRIRLRSN* |
Ga0068859_1011139081 | 3300005617 | Switchgrass Rhizosphere | RRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0068864_1004565541 | 3300005618 | Switchgrass Rhizosphere | CRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKAN* |
Ga0068866_107349551 | 3300005718 | Miscanthus Rhizosphere | MCSKHPEMGPCQYERNACRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKSN* |
Ga0068866_107782981 | 3300005718 | Miscanthus Rhizosphere | PEMGPCQYERNQCRASGGRVFAANGAEITMQTEAEYDKKVMRTRFKSN* |
Ga0068861_1012787101 | 3300005719 | Switchgrass Rhizosphere | CQSARNACRSSGGRVYAADGGEITQAHEAEYDKKIMRVRVGP* |
Ga0068861_1021482261 | 3300005719 | Switchgrass Rhizosphere | LCRKHPEMGPCQYEREVCRRSGGRVYAAGGVEITMATEAEYDKKVMRVRFRAN* |
Ga0068861_1025741121 | 3300005719 | Switchgrass Rhizosphere | NACRKNGGRVYGADGREITQADEIEYDKKVMRMRVGP* |
Ga0066903_1022024822 | 3300005764 | Tropical Forest Soil | MGPCQNARNTCRRSGGRVYAADGSEITQADEAEYDKKVMRVRVGP* |
Ga0068851_103979642 | 3300005834 | Corn Rhizosphere | CQYERNACRSKAGRVFAADGKEITMATEAEYDKKVRRVTFKAN* |
Ga0074470_100144131 | 3300005836 | Sediment (Intertidal) | AMCAKHPEMGPCQYEREICRKSGGRVYAAGGIEITQATEAEYDRKVMRVRLKAN* |
Ga0068858_1022839641 | 3300005842 | Switchgrass Rhizosphere | MGPCQYERNACRSKGGRVFAADGKEITMATEAEYDRKVRRVTFKAN* |
Ga0068860_1010671241 | 3300005843 | Switchgrass Rhizosphere | FVDKVGDLCRRHPEMGPCQYERNACRARGGRVFAAGGVEITNATEAEYDKKVMRTRFRAN |
Ga0068860_1013110332 | 3300005843 | Switchgrass Rhizosphere | CQYERDVCRRSGGRVYAANGVEITMATEAEYDKKVMRVRFKAN* |
Ga0068860_1027766622 | 3300005843 | Switchgrass Rhizosphere | RHTEMGPCQNARNACRRSGGRVYGADGSEVTLADEAEYDKKVMRVRVGP* |
Ga0068862_1020712871 | 3300005844 | Switchgrass Rhizosphere | MGPCQYERDICRRSGGRVYAAGGAEITAQTEAEYDKKVMRVRFKAN* |
Ga0066795_101059751 | 3300005938 | Soil | LCVKHPEMGPCQYERNACRRSGGRVFAAGGKEITMATEAEYDKKVMRIRLKSN* |
Ga0080027_100101301 | 3300005993 | Prmafrost Soil | PEMSPCQYERNTCRRSGGRIYAANGMEITMATEAEYDKKVMRVRFKGG* |
Ga0080027_104591961 | 3300005993 | Prmafrost Soil | MGPCQYERNACRASGGRVFAAEGKEITMATEAEYDKK |
Ga0066696_101869421 | 3300006032 | Soil | RRNGGRVFAANGKEITKATEAEYDRKVMRVRLRAD* |
Ga0066656_103146223 | 3300006034 | Soil | GPCQYEREVCRRGGGRVFAADGKEITKATEGEYDRRVLRARIRAD* |
Ga0066652_1010069362 | 3300006046 | Soil | QYERDLCRSSGGRVYAAGGQEITRQTEDEYDRKVLRVRFRAN* |
Ga0075432_102649592 | 3300006058 | Populus Rhizosphere | FAPRVAALCAQNPEMGPCQYEREICRRGGGRVFAADGKEITKATEAEYDRRVLRARIRAD |
Ga0070716_1008505572 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HPEMGPCQYERDVCRRSGGRVYAAGGIEITLQTEAEYDRKVMRVRFKAN* |
Ga0097621_1001136121 | 3300006237 | Miscanthus Rhizosphere | ARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0097621_1022335542 | 3300006237 | Miscanthus Rhizosphere | CRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0068871_1003381113 | 3300006358 | Miscanthus Rhizosphere | AKNPEMGPCQYERNVCRARGGRVYAANGVEITMQTEAEYDKKVMRVRFKAN* |
Ga0079222_103001221 | 3300006755 | Agricultural Soil | KHPEMGPCQYEREACRRSGGRVFAADGSEITRSVEDEYDKRVLRIRLRSN* |
Ga0066660_106401191 | 3300006800 | Soil | MGPCQYERNACRKSGGRVFAAEGKEITMATEAGYDRKVIRIRLKSN* |
Ga0079221_110999631 | 3300006804 | Agricultural Soil | SPKVHALCARHPEMGPCQYERDVCRRSGGRVFAANGQEITAATEAEYDRKVTRVRFRAN* |
Ga0075425_1000242239 | 3300006854 | Populus Rhizosphere | ERELCRRGGGRVFAANGVEITALTELEYDKRVLRVVFRAD* |
Ga0068865_1020755851 | 3300006881 | Miscanthus Rhizosphere | QNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0075426_101358341 | 3300006903 | Populus Rhizosphere | LCAKHPEMGPCQYERDVCRRSGGRVYAAGGIEITLQTEAEYDRKVMRVRFKAN* |
Ga0075436_1010303633 | 3300006914 | Populus Rhizosphere | MSACKYERELCRRGGGRVFAANGVEITALTELEYDKRVLRVVFRAD* |
Ga0079216_109141361 | 3300006918 | Agricultural Soil | VHQLCRRHPEMGPCQYERNVCRNAGGRVFAAGGQEITMATEAEYDRKVMRVRFRAN* |
Ga0074063_138465743 | 3300006953 | Soil | CRRSGGRVYAAGGEEITMATEAEYDKHVLRVRFKSN* |
Ga0075435_1012728381 | 3300007076 | Populus Rhizosphere | PCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0075435_1013712771 | 3300007076 | Populus Rhizosphere | HPEMGPCQYERNNCRASGGRVFAADGVEITMATEAEYDKKVMRVRFRAN* |
Ga0066710_1043160382 | 3300009012 | Grasslands Soil | ELCRKHPEMGPCQYEREVCRRVGGRVFAANGSEITRLTEADYDKRVLRVRFRAD |
Ga0099829_108817433 | 3300009038 | Vadose Zone Soil | SPKVGTLCRKHPEMSACKYERSICRTHGGRVFAANGIEITQLTEMEYDKRVRRVVFRAD* |
Ga0105090_104595532 | 3300009075 | Freshwater Sediment | PCQYERNACRQRGGRVYAAGGVEVTLQMEAEYDRKVMRVRIN* |
Ga0105090_108801322 | 3300009075 | Freshwater Sediment | FSPSVGALCARHPEMGPCQYERNVCRSNGGRVYAAGGDEVTLQMEADYDRKVMRVRIK* |
Ga0102851_107090321 | 3300009091 | Freshwater Wetlands | GPCQYERNQCRAAGGRVYARGGEEITLAHEAEYDKKVMRVRFRAN* |
Ga0075418_109978862 | 3300009100 | Populus Rhizosphere | APKVGELCRRHPEMGPCQYERNNCRARGGRVFAAGSVEITMQTEAEYDKKVMRTRFRTN* |
Ga0075418_127707231 | 3300009100 | Populus Rhizosphere | KVKEMCAKHPEMGVCQYEREACRASGGRVYDAKGTEITKQIEAEYDRKVMRVRFRAG* |
Ga0115026_101836792 | 3300009111 | Wetland | EMGPCQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRIR* |
Ga0117941_10036311 | 3300009120 | Lake Sediment | HPEMGPCQYERNVCRSNGGRVYAAGGVEVTLQMEAEYDRKVMRVRIR* |
Ga0115027_103340691 | 3300009131 | Wetland | VGALCARHPEMGPCQYERNVCRSNGGRVYAAGGVEVTLQMEADYDRKVMRVRIK* |
Ga0115027_109294542 | 3300009131 | Wetland | CQYERDACRRSGGRVYAADGVEITMATEAEYDRKVRRVQFKAN* |
Ga0066709_1004328762 | 3300009137 | Grasslands Soil | MGPCQYEREVCRHGGGRVFAADGKEITKATEAEYDRRVLRARIRAD* |
Ga0066709_1013846013 | 3300009137 | Grasslands Soil | EVCRRVGGRVFAANGSEITRLTEADYDKRVLRVRFRAD* |
Ga0066709_1045462022 | 3300009137 | Grasslands Soil | YERSICRSHGGRVFAANGIEITQLTEIEYDKRVLRVVFRAD* |
Ga0105243_103209722 | 3300009148 | Miscanthus Rhizosphere | DACRRSGGRVFAADGSEVTRSIEDEYDKRVMRIRLRSN* |
Ga0075423_114832412 | 3300009162 | Populus Rhizosphere | ARNACRRNGGRVYSADGSEVTEADEAAYDKKVMRMRVGQ* |
Ga0105102_103653002 | 3300009165 | Freshwater Sediment | CQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRIK* |
Ga0113563_120577011 | 3300009167 | Freshwater Wetlands | NQCRAAGGRVYAKGGREITLADEAEYDKKVMRVRFRAN* |
Ga0115028_115240341 | 3300009179 | Wetland | FSPSVGALCARHPEMGPCQYERNVCRSNGGRVYAAGGVEVTMQMEADYDRKVMRVRIR* |
Ga0105238_107863632 | 3300009551 | Corn Rhizosphere | GALCTRHPEMGPCQYERDLCRNSGGRVFAASGQEITRQIEDEYDRKVMRVRFRAN* |
Ga0105238_118639181 | 3300009551 | Corn Rhizosphere | CRRSGGRVFAADGSEVTRSIEDEYDKRVMRIRLRSN* |
Ga0105238_121876612 | 3300009551 | Corn Rhizosphere | EMGPCQYERDLCRSSGGRVYAAGGQEITRQIEDEYDRKVLRVRFRAN* |
Ga0105249_132833382 | 3300009553 | Switchgrass Rhizosphere | GPCQYERNACRGKGGRVFAADGSEITMATEAEYDKKVRRVTFKAN* |
Ga0116147_11626172 | 3300009667 | Anaerobic Digestor Sludge | GKLCRRHPEMGPCQYERNLCRRSGGRVYAADGTEITMATEAEYDRKVMRVRFQAK* |
Ga0126384_117620381 | 3300010046 | Tropical Forest Soil | KYERDACRRSGGRVYASGGIEITAQTEIEYDKKVLRVRLKSN* |
Ga0126384_119340471 | 3300010046 | Tropical Forest Soil | KLAELCRKNPEMGPCQYERETCRRSGGRVFTADGTEITRATEAEYDKHVMRVRFRAD* |
Ga0126384_123867821 | 3300010046 | Tropical Forest Soil | KHPEMGPCQYERELCRASGGRVYAAGGVEITAKTEAEYDKKVMRVRFKAN* |
Ga0127503_107267892 | 3300010154 | Soil | PEMGPCKYERDICRRSNGRVYAANGVEITKQTEAEYDKKVMRVVFKSN* |
Ga0134082_105353222 | 3300010303 | Grasslands Soil | AALCRKHPEMGPCQYERNNCRASGGRVFAADGVEITLATEAEYDKKVMRVRFRAN* |
Ga0134063_104016752 | 3300010335 | Grasslands Soil | CRASGGRVFAADGVEITMATEAEYDKKVMRVRFRAN* |
Ga0134063_104254642 | 3300010335 | Grasslands Soil | HPGMGPCQYEREVCRRSGGRVIAADGKEIAKATEAEYDRKVMRVRFRGD* |
Ga0116238_100996443 | 3300010347 | Anaerobic Digestor Sludge | AFDEKAGKLCRRHPEMGPCQYERNLCRRSGGRVYAADGTEITMATEAEYDRKVMRVRFQAK* |
Ga0126378_100280919 | 3300010361 | Tropical Forest Soil | RSHGGRVFAANGTEISKLTEAEYDKRVMRVRFRAD* |
Ga0126378_119826371 | 3300010361 | Tropical Forest Soil | MGPCKYERDACRRGGGRVYASGGIEITAQTEIEYDKKVLRVRLKSN* |
Ga0134125_106138281 | 3300010371 | Terrestrial Soil | CRRAGGRVYAANGDEITMATEAEYDKKVMRVRFKAN* |
Ga0134128_103096123 | 3300010373 | Terrestrial Soil | MGPCQYERDACRRSGGRVFAADGSEITRSTEDEYDKRVMRIRLRSN* |
Ga0134128_105619771 | 3300010373 | Terrestrial Soil | DLCRKHPEMGPCQYERDACRRSGGRVFAADGSEITRSIEDEYDKRVMRIRLRSN* |
Ga0134128_108338413 | 3300010373 | Terrestrial Soil | CQNARNACRGSGGHVYAADGNEITQADEAEYDKKVMRLRLGP* |
Ga0105239_131149162 | 3300010375 | Corn Rhizosphere | CQYERDLCRNSGGRVFAASGQEITRQIEDEYDRKVMRVRFRAN* |
Ga0134124_131792882 | 3300010397 | Terrestrial Soil | QNARNACRRSGGRVYAADGSEITQADEAEYDKKVLRVRVGS* |
Ga0134121_114165361 | 3300010401 | Terrestrial Soil | QYERNACRRKGGRVFAADGTEITLATEAEYDKKVRRATVKAN* |
Ga0134123_102661842 | 3300010403 | Terrestrial Soil | PCQNARNACRRSGGRVYAADGTEVTQADEAEYDKKVMRVRVGP* |
Ga0137455_12520452 | 3300011429 | Soil | PCQYERNICRKSGGRVYAANGAEITMATEAEYDKKVMRVRFRAN* |
Ga0137427_101191102 | 3300011445 | Soil | MSVCQYEREACRASGGRVFTAAGEEITKKTEAEYDKKVTRTRFRAN* |
Ga0137388_117975441 | 3300012189 | Vadose Zone Soil | MGPCQYEREVCRRSGGRVFTADGKKITKATEAEYDRRVLRAR |
Ga0137380_109262622 | 3300012206 | Vadose Zone Soil | LCRKHPEMGPCQYEREVCRRGGGRVFAANGSEITRLTETDYDKRVLRVRFRAD* |
Ga0137376_109853911 | 3300012208 | Vadose Zone Soil | KELCRKHPEMGPCQYERELCRNSGGRVYAAGGTEITLATEAEYDKRVMRVRFRAN* |
Ga0137372_100160761 | 3300012350 | Vadose Zone Soil | ICRRSGGRVFAANGLEITQLTELEYDKRVMRMVFRAD* |
Ga0137384_109095073 | 3300012357 | Vadose Zone Soil | CRKHPEMSACKYERSICRRNGGRVFAANGIEITQLTELEYDKRVLRVVFRAD* |
Ga0137390_118203891 | 3300012363 | Vadose Zone Soil | KVADLCRKHPEMGPCKYERDICRRANGRVYAANDREITMQTEAEYDKKVLRMVFKSN* |
Ga0136633_12438421 | 3300012527 | Polar Desert Sand | FTPKVHALCRRHPEMGPCQYERNACRGAGGRVFAAAGQEITMQTEGDYDRKVLRVRFRAN |
Ga0157302_100634803 | 3300012915 | Soil | CRRRGGRVYAADGSEVTQADEAEYDKKVMRVRVGP* |
Ga0137359_108590201 | 3300012923 | Vadose Zone Soil | MGPCQYERNACRKSGGRVFAAQGKEITMATEAEYDRKVIRIRLKSN* |
Ga0126375_105473111 | 3300012948 | Tropical Forest Soil | FSIKVAALCRKHPEMGPCKYERDACRRSNGRVYAANGVEITKQTEAEYDKRVMRVVFKSN |
Ga0126375_120657651 | 3300012948 | Tropical Forest Soil | PEMEVCQYEREICRSHGGRVFAANGTEITKLTEAEYDKRVMRIRFRAD* |
Ga0164300_105599571 | 3300012951 | Soil | NVCRSGGGRIFAANGMEITMAIEAEYDKKVMRVRFKGG* |
Ga0164298_111700031 | 3300012955 | Soil | KRHPEMGPCQCERDLCRSSGGRVFAASGQEITRQIEDEYDRKVLRVRFRAN* |
Ga0164301_111916802 | 3300012960 | Soil | DLCARNPEMGPCQYERNICRKGGGRVYAANGAEITMATEAEYDKKVMRVRFKSN* |
Ga0164309_103033551 | 3300012984 | Soil | MGPCQYERNLCRSSGGRVFAAGGQEITRQTEDEYDRKVLRVRFRTN* |
Ga0164307_113399122 | 3300012987 | Soil | VCRRSGGRVYAVGGVEITLQTEAEYDKKVMRVRFKAN* |
Ga0164306_107343141 | 3300012988 | Soil | LCARHPEMGPCQYERDHCRKGGGRVFDADGREITAATEAEYDRKVMRFRLRSN* |
Ga0157371_101320062 | 3300013102 | Corn Rhizosphere | LCKRHPEMGPCQYERQACRRSGGRVFAASGEEITLATEAEYDKKVLRARFRAN* |
Ga0157371_105288071 | 3300013102 | Corn Rhizosphere | LCRKHPEMGPCQYERDACRRSGGRVFAADGSEVTRSIEDEYDKRVMRIRLRSN* |
Ga0157371_111453151 | 3300013102 | Corn Rhizosphere | NACRRSGGRVYAADGTEVTQADEAEYDKKVMRVRVGP* |
Ga0157374_117271322 | 3300013296 | Miscanthus Rhizosphere | CRRSGGRVYAADGKEITQADEAEYDKKGMRLRLGP* |
Ga0157374_125967732 | 3300013296 | Miscanthus Rhizosphere | CQYERNACRSKGGRVFAADGKEITMATEAEYDKKVRRVTFKAN* |
Ga0157378_109375882 | 3300013297 | Miscanthus Rhizosphere | TEMGPCQNARNACRRSGGRVYGADGSEVTLADEAEYDKKVMRVRVGP* |
Ga0157378_117133151 | 3300013297 | Miscanthus Rhizosphere | EMGPCQNARNACRRSGGRVYGADGSEVTQADEAEYDKKVMRLRVGP* |
Ga0163162_107751501 | 3300013306 | Switchgrass Rhizosphere | CRRRGGRVYAADGSEVTQADEAEYDRKVMRVSVGP* |
Ga0157372_132899611 | 3300013307 | Corn Rhizosphere | DACRRSGGRVFAADGSEITRSTEDEYDKRVMRIRLRSN* |
Ga0157375_105920811 | 3300013308 | Miscanthus Rhizosphere | PKVGKLCEKHPEMGPCQYEREMCRRSGGHVYAAGGLEITPQTEAEYDKKVLRVRFKAN* |
Ga0157375_129189821 | 3300013308 | Miscanthus Rhizosphere | QYERDLCRSSGGRVYAAGGVEITRQTEDEYDRKVLRVRFRAN* |
Ga0134079_103807132 | 3300014166 | Grasslands Soil | QYERNNCRASGGRVFAADGVEITMATETEYDKKVMRVRFRAN* |
Ga0075341_11125741 | 3300014298 | Natural And Restored Wetlands | RKHPEMGPCQYERNACRHGGGRVYAADGTEITWATEAEYDRKVRRAQFRSN* |
Ga0075346_10799601 | 3300014306 | Natural And Restored Wetlands | TDALCRKHPEMGPCQYERNACRHGGGRVYAADGTEITWATEAEYDRKVRRVQFRSN* |
Ga0075339_11136892 | 3300014316 | Natural And Restored Wetlands | GPCQYERNQCRAAGGRIYARGGQEITLAHEAEYDKKVMRVRFSAN* |
Ga0163163_102217851 | 3300014325 | Switchgrass Rhizosphere | RKHPEMGPCQYERNACRSKGGRVFAADGKEITMATEAEYDRKVRRVTFKAN* |
Ga0157380_105924131 | 3300014326 | Switchgrass Rhizosphere | KLCRTHPEMGPCQYERTICRGSGGRVYAADGTEITLATEAEYDRKVMRVRFKSN* |
Ga0157380_106051731 | 3300014326 | Switchgrass Rhizosphere | LCARNPEMGPCQYERNICRKSGGRVYAANGAEITMATEAEYDKKVMRVRFKSN* |
Ga0157380_116118272 | 3300014326 | Switchgrass Rhizosphere | GKLCRTHPEMGPCQYERNICRGSGGRVYHPDGTEITMATEAEYDKKVMRVRFKAN* |
Ga0157380_131067772 | 3300014326 | Switchgrass Rhizosphere | QYERNACRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKSN* |
Ga0157377_108709081 | 3300014745 | Miscanthus Rhizosphere | MGPCQYERDLCRNSGGRVFAASGQEITRQIEDEYDRKVMRVRFRAN* |
Ga0157377_111704191 | 3300014745 | Miscanthus Rhizosphere | PNVRALCQRHPEMGPCQYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN* |
Ga0157379_124152512 | 3300014968 | Switchgrass Rhizosphere | LCRKHPEMGPCQYERNACRSKGGRVFAADGKEITMATEAEYDKKVRRVTFKAN* |
Ga0167636_10055233 | 3300015075 | Glacier Forefield Soils | QYERNACRRSGGRVFAAGGKEITMATEAEYDKKVMRIRLKSN* |
Ga0173478_105150651 | 3300015201 | Soil | EKVGKLCHTHPEMGPCQYERNICRGSGGRVYAADGAEITMAHEAEYDKKVMRVRFKAN* |
Ga0132258_104470041 | 3300015371 | Arabidopsis Rhizosphere | ACRRSGGRVYAADGSEITQADEAEYDKKVMRVRVGP* |
Ga0132258_112986262 | 3300015371 | Arabidopsis Rhizosphere | MCSKHPEMGPCQYERNACRRQGGRVFAANGSEITMATEAEYDKKVRRVTFKAN* |
Ga0132258_120317333 | 3300015371 | Arabidopsis Rhizosphere | CRRHTEMGPCQNARNACRRSGGRVYAADGSEVTQDDEAEYDKKVTRVRVGP* |
Ga0132258_125360283 | 3300015371 | Arabidopsis Rhizosphere | DELCRKHPEMGPCQYERNACRSKGGRVFAADGKEITMATEAEYDKKVRRVTFKAN* |
Ga0132258_137280521 | 3300015371 | Arabidopsis Rhizosphere | PKVAALCKRHPEMGPCQYERDLCRSSGGRVYAAGGQEITRLTEDEYDRKVLRVRFRAN* |
Ga0132256_1017155512 | 3300015372 | Arabidopsis Rhizosphere | CRRSGGRVYAPDGSEITQADETEYDKKVMRVRIGP* |
Ga0132257_1003974543 | 3300015373 | Arabidopsis Rhizosphere | PEMGPCQYERNVCRSHGGRVYAANGVEITMQTEAEYDKKVMRVRFKSN* |
Ga0132257_1010498041 | 3300015373 | Arabidopsis Rhizosphere | EMGPCQYERDVCRRAGGRVYASGGVEITRAMEDEYDKKVMRVRFRAN* |
Ga0132257_1039245672 | 3300015373 | Arabidopsis Rhizosphere | RTHPEMGPCQYERNQCRASGGRVFAADGVEITMATEAEYDKKVMRVRFRAN* |
Ga0132257_1042979821 | 3300015373 | Arabidopsis Rhizosphere | KVGALCKRHPEMGPCQYERDLCRSSGGSVFAASGQEITRQIEDEYDRKVLRVRFRAN* |
Ga0132255_1011575311 | 3300015374 | Arabidopsis Rhizosphere | LCRRHTEMGPCQSARNACRSNGGRVYAADGSEITRADEAEYDKKVTRVRVGP* |
Ga0132255_1014935521 | 3300015374 | Arabidopsis Rhizosphere | YERDICRRSGGRVYAAGGFEITNQVEAEYDKKVMRVRFKAN* |
Ga0132255_1041234082 | 3300015374 | Arabidopsis Rhizosphere | EPKVASLCARHPEMGPCQYEREACRKAGGRVFAQGGQEITRRTEDEYDRKVMRVRFRAN* |
Ga0163161_115878062 | 3300017792 | Switchgrass Rhizosphere | CRGKGGRVFAADGTEITMATEAEYDKRVRRVTFKAN |
Ga0163161_117301401 | 3300017792 | Switchgrass Rhizosphere | MGPCQYERNQCRASGGRVFAANGAEITMQTEAEYDKKVMRTRFKSN |
Ga0187778_111155802 | 3300017961 | Tropical Peatland | AALCRKHPEMGPCKYERDACRRSNGRVYAANGVEITMKTEAEYDKRVMRVVFKSN |
Ga0187787_101739161 | 3300018029 | Tropical Peatland | KHPEMGPCQYERDVCRRSGGRVYAAGGVEITAQTEAEYDKKVMRVRFKAN |
Ga0184632_102025571 | 3300018075 | Groundwater Sediment | AKVVQLCQRHPEMGPCQYERNLCRRSGGRVYAAGGVEITMETEAEYDRKVMRVRFKAN |
Ga0066667_104756401 | 3300018433 | Grasslands Soil | MSACKYERSICRRSGGRVFAANGLEITQLTELEYDKRVMRVVFRAD |
Ga0066667_104790332 | 3300018433 | Grasslands Soil | AALCRKHPEMGPCQYERNNCRASGGRVFAADGVEITMATETEYDKKVMRVRFRAN |
Ga0066667_112978572 | 3300018433 | Grasslands Soil | VRELCTKHPEMAPCQYERNVCRRSGGRVFEANGTEITMQTEAEYDKKVMRVRFKSN |
Ga0066662_111669841 | 3300018468 | Grasslands Soil | EMGPCQYERNNCRASGGRVFAADGVEITLATEAEYDKKVMRVRFRAN |
Ga0173481_106244451 | 3300019356 | Soil | PCQNARNACRRSGGRVHAADGTEVTQADEAEYDKKVMRVRVGP |
Ga0193723_11458472 | 3300019879 | Soil | PKVAAMCVKHPEMGPCQYERNACRRSGGRVFAAGGKEITMATEAEYDQKVMRIRLKSN |
Ga0193751_11580572 | 3300019888 | Soil | PEMGPCQYERDACRRSGGRVFAADGSEITRSVEDEYDKRVMRIRLRSN |
Ga0193735_10592271 | 3300020006 | Soil | NCRASGGRVFAADGVEITMATEAEYDKKVMRVRFRAN |
Ga0193724_10249712 | 3300020062 | Soil | GPCQYERNNCRASGGRVFAADGIEITMATEAEYDKKVMRVRFRAN |
Ga0206353_106883411 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPCQYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN |
Ga0210399_106165412 | 3300020581 | Soil | FVPKVAALCAKNPEMGPCQYEREVCRRSNGRVFAADGKEITKATEAEYDRKVMRIRLRGD |
Ga0210382_104005811 | 3300021080 | Groundwater Sediment | CVKHPEMGPCQYERNACRRSGGRVFAAGGKEITMATEAEYDKKVMRIRLKSN |
Ga0210330_11785411 | 3300021322 | Estuarine | NACRHGGGRVYAADGTEITWAIEAEYDRKVRRVQFRSK |
Ga0193695_11321961 | 3300021418 | Soil | AKHPEMGPCQYERNNCRASGGRVFAANGVEITMATEAEYDKKVMRVRFRSN |
Ga0210402_101131364 | 3300021478 | Soil | KHPEMGPCQYERNACRKSGGRVFAAEGKEITMATEAEYDKKVMRIRLKSN |
Ga0247753_10234672 | 3300022892 | Soil | VDTLCRNHPEMGPCQYERNVCRGKGGRVFAADGTEITMATEAEYDKKVRRVTFKAN |
Ga0247754_10480242 | 3300023102 | Soil | ERNICRGSGGRVYAPDGSEITMAHEAEYDKKVMRVRFKAN |
Ga0207656_100426071 | 3300025321 | Corn Rhizosphere | HTEMGPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVIRVRVGP |
Ga0207682_105623041 | 3300025893 | Miscanthus Rhizosphere | PEMGPCQYERNICRKSGGRVYAANGAEITMATEAEYDKKVMRVRFKSN |
Ga0207692_100352522 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PEMGPCQYERDACRRSGGRVFAADGTEITRSTEDEYDKRVLRIRLRSN |
Ga0207642_105737872 | 3300025899 | Miscanthus Rhizosphere | NARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207710_107820982 | 3300025900 | Switchgrass Rhizosphere | ERDACRRSGGRVFAADGSEITRSVEDEYDKRVMRIRLRSN |
Ga0207688_100896772 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPCQYERNACRSKGGRVFAADGKEITMATEAEYDRKVRRVTFKAN |
Ga0207680_102760612 | 3300025903 | Switchgrass Rhizosphere | NACRSSGGRVYAADGSEITKADEAEYDKKVMRLRVGP |
Ga0207699_104038512 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | NPEMGPCQYEREVCRRNAGRVFAADGKEITKATEAEYDRKVMRVRLRGD |
Ga0207663_105760002 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPCQYERDACRRSGGRVFAADGTEITRSTEDEYDKRVLRIRLRSN |
Ga0207660_108395322 | 3300025917 | Corn Rhizosphere | LCRSSGGRVFAASGQEITRQIEDEYDRKVLRVRFRAN |
Ga0207660_108531491 | 3300025917 | Corn Rhizosphere | PEMGPCQYERDACRRSGGRVFAADGSEITRSTEDEYDKRVMRIRLRSN |
Ga0207649_114024262 | 3300025920 | Corn Rhizosphere | LCKRHPEMGPCQYERQACRRSGGRVFAASGEEITLATEAEYDKKVLRARFRAN |
Ga0207652_114266221 | 3300025921 | Corn Rhizosphere | MGPCQNARNACRRSGGRVYAADGKEITQADEAEYDKKVMRLRLGP |
Ga0207681_109060581 | 3300025923 | Switchgrass Rhizosphere | VAALCRRHTEMGPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207694_113638491 | 3300025924 | Corn Rhizosphere | RHPEMGPCQYERDLCRSSGGRVYAAGGQEITRQIEDEYDRKVLRVRFRAN |
Ga0207650_113740132 | 3300025925 | Switchgrass Rhizosphere | RNACRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKSN |
Ga0207659_108305791 | 3300025926 | Miscanthus Rhizosphere | AALCRRHTEMGPCQNARNACRRRGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207701_101620041 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MGPCQSARNACRSNGGRVYAADGSEITRADEAEYDKKVTRVRVGP |
Ga0207701_102598822 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | EREVCRKSGGRVFAQGGQEITRRTEDEYDRKVMRVRFRAN |
Ga0207644_108998971 | 3300025931 | Switchgrass Rhizosphere | TEMGPCQSARNACRSSGGRVYAADGSEITKADEAEYDKKVMRLRVGP |
Ga0207644_115264642 | 3300025931 | Switchgrass Rhizosphere | QYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN |
Ga0207706_110142022 | 3300025933 | Corn Rhizosphere | ERNVCRQSGGRVFDTAGREITLATEAEYDRKVMRVRFRAN |
Ga0207670_100639032 | 3300025936 | Switchgrass Rhizosphere | RDLCRSSGGRVFAASGQEITRQIEDEYDRKVLRVRFRAN |
Ga0207669_101744411 | 3300025937 | Miscanthus Rhizosphere | RNVCRRSGGRVYAADGSEVTQADEAEYDKKVMRLRVGP |
Ga0207669_106045261 | 3300025937 | Miscanthus Rhizosphere | DEKVGKLCRTHPEMGPCQYERNICRGSGGRVYAADGTEITMATEAEYDKKVMRVRFKAN |
Ga0207669_113544901 | 3300025937 | Miscanthus Rhizosphere | ALCRRHTEMGPCQSARNACRKSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207691_101822911 | 3300025940 | Miscanthus Rhizosphere | GPCQSARNACRSSGGRVFAADGREITQADEAEYDKKVVRVRVGP |
Ga0207691_107636342 | 3300025940 | Miscanthus Rhizosphere | RDICRRSGGRVFTANQVEITLQTEAEYDKKVMRVRFKAN |
Ga0207691_113498031 | 3300025940 | Miscanthus Rhizosphere | KVGDLCRRHPEMGPCQYERNACRTRGGRVFAAGGVEITGATEAEYDKKVMRTRFRAN |
Ga0207691_114700882 | 3300025940 | Miscanthus Rhizosphere | MCQKHPEMGPCQYERNLCRRSGGRVYAANGVEITMATEAEYDKKVMRVRFKAN |
Ga0207691_116954661 | 3300025940 | Miscanthus Rhizosphere | EMGPCQYERNACRSKAGRVFAADGKEITMATEAEYDKKVRRVTFKAN |
Ga0207711_110030661 | 3300025941 | Switchgrass Rhizosphere | TSAKSGGRVYAANGAEITMATEAEYDKKVMRVRFKSN |
Ga0207689_117440081 | 3300025942 | Miscanthus Rhizosphere | PCQYERNNCRARGGRVFAAGGAEITMATEAEYDKKVMRTRFRAN |
Ga0207679_102238601 | 3300025945 | Corn Rhizosphere | YERDACRRSGGRVFAADGSEITRSTEDEYDKRVMRIRLRSN |
Ga0207679_110684662 | 3300025945 | Corn Rhizosphere | CRWSGGRVYAADGGEVTQADEAEYDKKVRRVRVGP |
Ga0210088_10728411 | 3300025948 | Natural And Restored Wetlands | PCQYERNQCRAAGGRVYAGGGEEITLAREAEYDKKVLRVRFRAN |
Ga0207668_108736941 | 3300025972 | Switchgrass Rhizosphere | PEMGPCQYERDVCRRSGGRVYAAGGTEITAQTEAEYDRKVMRVRFKSN |
Ga0207658_100868261 | 3300025986 | Switchgrass Rhizosphere | EACRRDGGRVFDTRGVEITKQIEAEYDRKVMRTRFRAG |
Ga0207658_106060072 | 3300025986 | Switchgrass Rhizosphere | CRKHPEMGPCQYERNACRGKGGRVFAADGSEITMATEAEYDKKVRRVTFKAN |
Ga0207639_107271982 | 3300026041 | Corn Rhizosphere | VLSLCQRHPEMGPCQYERDLCRKSGGRVFTADGHEITRAVEDAYDRKVMRVRFRAN |
Ga0207639_118689372 | 3300026041 | Corn Rhizosphere | PGVGDLCRKHPEMGPCQYERDACRRSGGRVFAADGSEVTRSIEDEYDKRVMRIRLRSN |
Ga0208540_10165602 | 3300026059 | Natural And Restored Wetlands | RAAGGRVYGSGGEEITLAREAEYDRKVMRVRFRAN |
Ga0207678_100056861 | 3300026067 | Corn Rhizosphere | RRHTEMGPCQNARNACRRRGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207678_100310505 | 3300026067 | Corn Rhizosphere | MGPCQYERDLCRNSGGRVFAASGQEITRQIEDEYDRKVMRVRFRAN |
Ga0207678_100460271 | 3300026067 | Corn Rhizosphere | CQNARNACRRSGGHVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207678_105398672 | 3300026067 | Corn Rhizosphere | AFDEKVGKLCRTHPEMGPCQYERNICRGSGGRVYAADGTEITMATEAEYDKKVMRVRFKA |
Ga0207702_103088331 | 3300026078 | Corn Rhizosphere | MGPCQYERDVCRRSGGRVYAAGGVEITQATEAEYDKKVLRVRFKAN |
Ga0207641_103111973 | 3300026088 | Switchgrass Rhizosphere | TERGPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0207641_104224193 | 3300026088 | Switchgrass Rhizosphere | YAPKVDTLCRNHPEMGPCQYERNVCRGKGGRVFAADGTEITMATEAEYDKKVRRVTFKAN |
Ga0207648_102169061 | 3300026089 | Miscanthus Rhizosphere | ACRRSGGRVYAADGSQVTQADEAEYDKKVMRVRVGP |
Ga0207648_120106712 | 3300026089 | Miscanthus Rhizosphere | EMGPCQYERNACRGKGGRVFAADGSEITMATEAEYDKKVRRVTFKAN |
Ga0207676_100396483 | 3300026095 | Switchgrass Rhizosphere | MCSKHPEMGPCQYERNACRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKSN |
Ga0207675_1002295141 | 3300026118 | Switchgrass Rhizosphere | QYERNACRSKGGRVFAADGKEITMATEAEYDRKVRRVTFKAN |
Ga0207683_112089701 | 3300026121 | Miscanthus Rhizosphere | SSTKTAELCRKHPEMGPCQYERDICRRSGGRVFAANNVEITKDTEAEYDKKVYRVRFKAN |
Ga0207698_111331271 | 3300026142 | Corn Rhizosphere | QYERDACRRSGGRVFAADGSEITRSVEDEYDKRVMRIRLRSN |
Ga0207698_111495532 | 3300026142 | Corn Rhizosphere | PCQYERNVCRGKGGRVFAADGTEITMATEAEYDKKVMRVRFKAN |
Ga0209863_101510402 | 3300026281 | Prmafrost Soil | HPEMSPCQYERNTCRRSGGRIYAANGMEITMATEAEYDKKVMRVRFKGG |
Ga0209890_101326002 | 3300026291 | Soil | KVGELCRKHPEMGPCQYERDTCRRSGGRVFAKDGKEVTLATEAEYDKKVMRVRFKAN |
Ga0256808_10184992 | 3300026476 | Sediment | VHSLCKRHPEMGPCQYGRNQCRSGGGRVFASNGQEITLAHEAEYDKKVMRVRLRAN |
Ga0209805_12312751 | 3300026542 | Soil | KVAGLCLKHPEMGPCQYERNACRKSGGRVFAAEGKEITMATEAEYDRKVIRIRLKSN |
Ga0209156_103853292 | 3300026547 | Soil | RNNCRASGGRVFAADGVEITLATEAEYDKKVMRVRFRAN |
Ga0209161_103913791 | 3300026548 | Soil | NACRKSGGRVFAAEGKEITMATEAEYDRKVIRIRLKSN |
Ga0209474_102129101 | 3300026550 | Soil | GPCQYERNNCRASNGRVFAADGVEITMATEAEYDKKVMRVRFKAN |
Ga0209971_10482502 | 3300027682 | Arabidopsis Thaliana Rhizosphere | THPEMGPCQYERNICRGSGGRVYAADGTEITRATEAEYDRKVMRVRFKSN |
Ga0209178_10561593 | 3300027725 | Agricultural Soil | AKHPEMGPCQYERDVCRRSGGRVYAAGGIEITLQTEAEYDRKVMRVRFKAN |
Ga0209073_100302053 | 3300027765 | Agricultural Soil | LCARHPEMGPCQYEREGCRRHGGRVFAAGGKEITAATEAEYDKRVMRIRMRAD |
Ga0209397_104097312 | 3300027871 | Wetland | HGLCKRHPEMGPCQYERNQCRAAGGRVYARGGEEITLAHEAEYDKKVMRVRFRAN |
Ga0209397_106120731 | 3300027871 | Wetland | FAPKVHGLCKRHPEMGPCQYERNQCRAAGGRVYARGGEEITLAHEAEYDKKVMRVRFRAN |
Ga0209254_100676951 | 3300027897 | Freshwater Lake Sediment | RHPEMGPCQYERNQCRAAGGRVYARGGQEITLAHEVEYDKKVMRVRFRAN |
Ga0209254_101910012 | 3300027897 | Freshwater Lake Sediment | LCARHPEMGPCQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRIR |
Ga0209048_1000017915 | 3300027902 | Freshwater Lake Sediment | MGPCQYERDLCRRGGGRVYAAEGKEITLQTEAEYDKKVMRVRLRAN |
Ga0209391_102828011 | 3300027975 | Freshwater Sediment | MGPCQYERNACRQRGGRVYAAGGVEVTMQMEAEYDRKVMRVRIN |
Ga0268266_122754131 | 3300028379 | Switchgrass Rhizosphere | CRSNGGRVYAADGSEITRADEAEYDKKVTRVRVGP |
Ga0247820_104436112 | 3300028597 | Soil | KVGKLCRTHPEMGPCQYERNICRGSGGRVYAADGTEITLATEAEYDRKVMRVRFKSN |
Ga0302214_11117771 | 3300028736 | Fen | CAKFPEMGPCQYERNVCRRDGGRVYAANGAEVTLATEAEYDRKVMRVRLKSN |
Ga0307312_102964552 | 3300028828 | Soil | APKVAALCRKHPEMGPCQYERNNCRASGGRVFAADGVEITMATEAEYDKKVMRVRFRAN |
Ga0311332_110667591 | 3300029984 | Fen | CRKAPEMGPCKYERDACRRQGGKVQTADGTEITPQTETEYDRRVLRIRMKSN |
Ga0311334_102952773 | 3300029987 | Fen | YSPRVGELCAKHPEMGPCQYERNTCRRGGGRVFAANGTEITMATEAEYDRKVMRVRFKGG |
Ga0311365_107483701 | 3300029989 | Fen | PCQYERNVCRRDGGRVYAANGAEVTLATEAEYDRKVMRVRLKSN |
Ga0311336_115144142 | 3300029990 | Fen | CRRSGGRVYAAGGVEITMQTEADYDRKVMRVRFKAN |
Ga0311350_113150391 | 3300030002 | Fen | PPHVADVCRKAPEMGPCQYEREVCRRKGGRVFAADGAEITRATETEYDKRVMRIRMKSN |
Ga0311348_102013341 | 3300030019 | Fen | RNACRSGGGRIFAADGMEITMAIEAEYDKKVMRVRFKGG |
Ga0311335_109907171 | 3300030838 | Fen | EMSPCQYERNVCRKSGGRVYAANGAEITTATEAEYDRKVMRIILKSN |
Ga0311366_113384522 | 3300030943 | Fen | CRRAGGKVLTAGDVEITPQTEAEYDRRVMRIRMKYN |
Ga0307498_103751192 | 3300031170 | Soil | EKVDALCRKHPEMGPCQYERNACRKKGGRVFAAGGTEITMATEAEYDKKVRRVTFKAN |
Ga0302323_1002819931 | 3300031232 | Fen | PCQNARNECRRSGGRVYAADGNEITLADEAAYDKKVTRVTVGQ |
Ga0302323_1010168531 | 3300031232 | Fen | ALCRKAPEMGPCKYERDACRRAGGKVLTAAGVEITPQTEAEYDRRVMRIRMKSN |
Ga0302323_1023685412 | 3300031232 | Fen | CQYERDACRRSGGRVFAVDGTEISLGTEAEYNKRVMRIRMKSN |
Ga0302323_1026484711 | 3300031232 | Fen | KHPEMGPCQYERNACRRGGGRVFAANGTEITMATEAEYDRKVMRVRFKGG |
Ga0307505_100830441 | 3300031455 | Soil | KRHPEMGPCQYERDICRRAGGRVYAAGGQEVTLATEAEYDKKVMRVRFRSN |
Ga0318515_101455051 | 3300031572 | Soil | KVRELCLKHPEMGPCQYEREACRRSGGRVFEANGKEITRSTENEYDKRVLRVTFKSN |
Ga0307469_106200392 | 3300031720 | Hardwood Forest Soil | RHPEMGPCQYERNNCRARGGRVFAAGSVEITMQTEAEYDKKVMRTRFRAN |
Ga0307469_108642383 | 3300031720 | Hardwood Forest Soil | PEMSACKYERSICRRNGGRVFAANGLEITQLTELEYDKRVMRVVFRAD |
Ga0302321_1035901721 | 3300031726 | Fen | MGPCQYERNVCRRSGGRVYAANGIEITMATEAEYDKKVMRVRLKSN |
Ga0307405_104014123 | 3300031731 | Rhizosphere | YERNVCRNAGGRVFAAGGQEITMATEAEYDRKVMRVRFRAN |
Ga0307468_1009964722 | 3300031740 | Hardwood Forest Soil | NPEMGPCQYERNACRSRGGRVYAANGVEITMQTEAEYDKKVMRVRFKSN |
Ga0307468_1022713311 | 3300031740 | Hardwood Forest Soil | VAVMCVKHPEMGPCQYERNACRRSGGRVFAAGGKEITMATEAEYDKKVMRIRLKSN |
Ga0318509_101570241 | 3300031768 | Soil | EMGPCQYERDVCRRSGGRVYAAGGVEITAQTEAEYDKKVLRVRFKATN |
Ga0318521_105353421 | 3300031770 | Soil | RRSNGRVYVGNGVEITRQTEAEYDKRVMRVVFKSN |
Ga0318546_106280671 | 3300031771 | Soil | YEREACRRSGGRVFEANGKEITRSTENEYDKRVLRVTFKSN |
Ga0318550_102046272 | 3300031797 | Soil | CLKHPEMGPCQYEREACRRSGGRVFEANGKEITRSTENEYDKRVLRVTFKSN |
Ga0318567_108029562 | 3300031821 | Soil | PEMGPCQYERDVCRRSGGRVYAAGGVEITAQTEAEYDKKVLRVRFKATN |
Ga0310907_103751922 | 3300031847 | Soil | PEMGPCQYERNISRGSGGRVYAADGTEITLATEAEYDRKVMRVRFKSN |
Ga0315297_111950821 | 3300031873 | Sediment | GALCRQHPEMGPCQYERNLCRRSGGRVYAADGTEITLATEAEYDKKVRRVQFKSN |
Ga0310885_104891441 | 3300031943 | Soil | GPCQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVMRVRVGP |
Ga0310884_103973261 | 3300031944 | Soil | LCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN |
Ga0308176_103766782 | 3300031996 | Soil | ERNVCRSSGGRVYAAGGVEITAETEAQYDRKVLRVRFKAN |
Ga0315278_107004222 | 3300031997 | Sediment | RRSGGRVYAANNVEITKETEAEYDRKVMRVRLKAN |
Ga0315278_117320572 | 3300031997 | Sediment | LCRKHPEMGPCQYERNACRRGGGRVYTADGTEITLATEAEYDKRVRRVQFKAN |
Ga0318562_107651531 | 3300032008 | Soil | VKHPEVGPCQYERDVCRRSGGRVYAAGGIEITAQTEAEYDKKVLRVRFKATN |
Ga0310911_100494823 | 3300032035 | Soil | LKHPEMGPCQYEREACRRSGGRVFEANGKEITRSTENEYDKRVLRVTFKSN |
Ga0318533_100699361 | 3300032059 | Soil | ELCLKHPEMGPCQYEREACRRSGGRVFEANGKEITRSTENEYDKRVLRVTFKSN |
Ga0308173_119218511 | 3300032074 | Soil | QYERNVCRSSGGRVYAASGVEITAETEAEYDKKVLRVRFKAN |
Ga0310890_100671634 | 3300032075 | Soil | PEMGPCQYERNICRGSGGRVYAADGTEITLATEAEYDRKVMRVRFKSN |
Ga0310890_111413261 | 3300032075 | Soil | QRHPEMGPCQYERDLCRKSGGRVFTADGREITRAVEDEYDRKVMRVRFRAN |
Ga0315905_114288911 | 3300032092 | Freshwater | QYERNLCRASGGRVYAAGGVEITLATEAEYDRKVMRVRFKAD |
Ga0315292_108264801 | 3300032143 | Sediment | RELCRRSGGRVYAAGGVEITRETEADYDKKVLRVRFKAN |
Ga0315292_114071271 | 3300032143 | Sediment | EKTDALCRKHPEMGPCQYERNACRRGGGRVYAADGTEITMATEAEYDRKVRRVQFKAN |
Ga0315283_116268491 | 3300032164 | Sediment | PEMGPCQYEREVCRRSGGRVYAADGKEITRQTEAEYDKKVMRVRLKAN |
Ga0315276_104499853 | 3300032177 | Sediment | YAEKTDALCRKHPEMGPCQYERNACRRSGGRVYAADGIEITMATEAEYDKKVRRVQFKSN |
Ga0315276_124451381 | 3300032177 | Sediment | CRRSGGRVYAAGGIEITKQVEAEYDKKVMRVRFKAN |
Ga0307471_1021389601 | 3300032180 | Hardwood Forest Soil | RDICRRSGGRVYAAGGVEITMLTEAEYDKKVMRVRFKAN |
Ga0307472_1023117321 | 3300032205 | Hardwood Forest Soil | RDICRRSGGRVYAAGGVEITAQTEAEYDKKVMRVRFKAN |
Ga0315271_107161831 | 3300032256 | Sediment | FSPKVFDLCRRHPEMGPCQYERDICRRSGGRVYAAGGVEITRQTEAEYDRKVMRVRFRSN |
Ga0315271_110184001 | 3300032256 | Sediment | EMSVCQYEREGCRASGGRVYTADGVEITKQTEAEYDKKVLRARFRAG |
Ga0315271_117781322 | 3300032256 | Sediment | PCQYERNLCRHSGGRVFAANGVEITMQTEAEYDKKVMRVRFRAN |
Ga0315270_104180072 | 3300032275 | Sediment | MGPCQYERNVCRRSGGRVYAANGAEITMATEAEYDRKVMRVRLKSN |
Ga0315287_128029001 | 3300032397 | Sediment | LCAKHPEMSPCQYERNVCRRSGGRVYAAGGVEITLQTEADYDRKVMRVIIN |
Ga0315273_115605551 | 3300032516 | Sediment | LCRKHPEMGPCRYERDVCRRGGGRVFAAGDKEITAQTEAEYDQKVMRVRLKAN |
Ga0315273_117146571 | 3300032516 | Sediment | CRRGGGRVYAADGTEITMATEAEYDRKVRRVQFKAN |
Ga0335085_104056833 | 3300032770 | Soil | QYERELCRSHGGRVFASNSTEITRLTEAEYDKRVVRVRFRAD |
Ga0335082_102696691 | 3300032782 | Soil | KVAQLCASHPEMGPCQYERNACRRGGGRVYTGGGKEITMATEAEYDKKVLRVQLKQ |
Ga0335082_104714401 | 3300032782 | Soil | CQYARNECRRRGGRVYAPDGREITMQTEAEYDKKVMRVRVQ |
Ga0335079_107130001 | 3300032783 | Soil | VAALCRRHPEMGPCQYARNACRSDGGRVYAADGSEITQADESEYDKKVMRVRVGP |
Ga0316605_118698891 | 3300033408 | Soil | RRSGGRVYAAGGFEVTRQVEAEYDRKVMRVRFKAN |
Ga0310810_100834101 | 3300033412 | Soil | ERDVCRRSGGRVYAAGGVEITPETEAQYDKKVLRVRFKAN |
Ga0316603_102937002 | 3300033413 | Soil | RHPEMGPCQYERNVCRSNGGRVYAAGGVEVTLQMEADYDRKVMRVRIK |
Ga0316603_122723452 | 3300033413 | Soil | KHPEMGPCQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRIK |
Ga0316622_1019023302 | 3300033416 | Soil | HPEMGPCQYERNACRRSGGRVYAAGGVEITLQMEAEYDRRVTRVLIK |
Ga0316625_1007292512 | 3300033418 | Soil | ERDICRRSGGRVYAAGGFEITSQVEAEYDRKVMRVRFKAN |
Ga0316625_1010706422 | 3300033418 | Soil | CQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRIR |
Ga0316625_1017138321 | 3300033418 | Soil | RNVCRNSGGRVYTAGGVEVTLQMEAEYDRKVLRVRIK |
Ga0316601_1010087992 | 3300033419 | Soil | ELCRKHPEMGPCQYERDVCRRSGGRVFAAGGIEITAQTEAEYDKKVMRVRLKSN |
Ga0316601_1018580152 | 3300033419 | Soil | PCQYERKVCRGSGGRVYAAGGVEITLQMEADYDRKVMRVLIK |
Ga0326726_100743251 | 3300033433 | Peat Soil | ACRKKGGRVFAADGSEITLATEAEYDKKVRRVTFKAN |
Ga0316627_1003179491 | 3300033482 | Soil | CQYERDICRRSGGRVYAAGGFEITSQVEAEYDRKVMRVRFKAN |
Ga0316629_117449422 | 3300033483 | Soil | YERNVCRSNGGRVYATGGVEVTLQMEAEYDRKVMRVRIR |
Ga0316621_106736191 | 3300033488 | Soil | EMGPCQYERNVCRNSGGRVYAAGGVEVTLQMEAEYDRKVMRVRIR |
Ga0247829_116832212 | 3300033550 | Soil | LHTARGGRVFAAGSVEITMQTEAEYDKKVMRTRFRAN |
Ga0247830_104921561 | 3300033551 | Soil | CQNARNACRRSGGRVYAADGSEVTQADEAEYDKKVIRVRVGP |
Ga0316617_1009298762 | 3300033557 | Soil | PKVHGLCKRHPEMGPCQYERNQCRAAGGRVYARGGQEITLAHEAEYDKKVMRVRFRAN |
Ga0316617_1014627692 | 3300033557 | Soil | PNVGALCARHPEMGPCQYERNVCRSNGGRVYAAGGVEVTLQMEADYDRKVMRVRIR |
Ga0316617_1028316282 | 3300033557 | Soil | KYERNACRRSGGRVFAAGGVEITLQMEAEYDRKVMRVLIK |
Ga0370481_0254566_462_602 | 3300034281 | Untreated Peat Soil | MGPCQYERDVCRRGGGRVYAANNVEITLQTEAEYDKKVMRVRFKAN |
Ga0364943_0438359_56_196 | 3300034354 | Sediment | MGPCQYEREVCRHSGGRVFAADGNEITKLTEAEYDRRVLRVKLKSN |
Ga0373948_0150598_10_123 | 3300034817 | Rhizosphere Soil | LCRSSGGRVFAAGGQEITRQTEDEYDRKVLRVRFRTN |
Ga0370497_0141798_416_586 | 3300034965 | Untreated Peat Soil | VEALCRKAPEMGPCQYERDACRRQGGKVLTAAGTEITLQTEAEYDRRVLRIRMKSN |
⦗Top⦘ |