Metagenome Family F005944

Overview

Basic Information

• Family ID: F005944
• Family Type: Metagenome
• Number of Sequences: 385
• Average Sequence Length: 43 residues
• Representative Sequence: MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
• Number of Associated Samples: 41
• Number of Associated Scaffolds: 385

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 6.38 %
• % of genes near scaffold ends (potentially truncated): 22.34 %
• % of genes from short scaffolds (< 2000 bps): 51.95 %
• Associated GOLD sequencing projects: 27
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (59.481 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (52.987 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 29.41%
  β-sheet: 0.00%
  Coil/Unstructured: 70.59%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 385 Family Scaffolds
PF00137	ATP-synt_C	1.04
PF00078	RVT_1	0.52
PF00530	SRCR	0.52
PF07690	MFS_1	0.52
PF00617	RasGEF	0.52
PF00069	Pkinase	0.52
PF00241	Cofilin_ADF	0.52
PF00051	Kringle	0.52
PF12473	DUF3694	0.52
PF16653	Sacchrp_dh_C	0.52
PF08170	POPLD	0.52
PF00784	MyTH4	0.52
PF03166	MH2	0.26
PF01062	Bestrophin	0.26
PF05605	zf-Di19	0.26
PF14735	HAUS4	0.26
PF13855	LRR_8	0.26
PF08487	VIT	0.26
PF08969	USP8_dimer	0.26
PF01061	ABC2_membrane	0.26
PF00075	RNase_H	0.26
PF01150	GDA1_CD39	0.26
PF13927	Ig_3	0.26
PF00035	dsrm	0.26
PF00089	Trypsin	0.26
PF07679	I-set	0.26
PF00250	Forkhead	0.26
PF00058	Ldl_recept_b	0.26
PF00648	Peptidase_C2	0.26
PF00011	HSP20	0.26
PF01593	Amino_oxidase	0.26
PF14670	FXa_inhibition	0.26
PF00653	BIR	0.26
PF02709	Glyco_transf_7C	0.26
PF00307	CH	0.26
PF00876	Innexin	0.26
PF03520	KCNQ_channel	0.26
PF00651	BTB	0.26
PF00001	7tm_1	0.26
PF03028	Dynein_heavy	0.26
PF05303	GSKIP_dom	0.26

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 385 Family Scaffolds
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	2.08
COG0636	FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K	Energy production and conversion [C]	1.04
COG5371	Nucleoside diphosphatase, GDA1/CD39 family	Nucleotide transport and metabolism [F]	0.52
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.26

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.03 %
Unclassified	root	N/A	25.97 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	74.03 %
Unclassified	root	N/A	25.97 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	59.48 %
Unclassified	root	N/A	25.97 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	14.55 %

Level 4

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	59.48 %
Unclassified	root	N/A	25.97 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	13.25 %

Level 5

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	59.48 %
Unclassified	root	N/A	25.97 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.71 %

Level 6

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	59.48 %
Unclassified	root	N/A	25.97 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.38 %
Porifera	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera	0.52 %

Level 7

Name	Rank	Taxonomy	Distribution
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	59.48 %
Unclassified	root	N/A	25.97 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.12 %
Demospongiae	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae	0.52 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.26 %

Level 8

Name	Rank	Taxonomy	Distribution
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	59.48 %
Unclassified	root	N/A	25.97 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.12 %
Heteroscleromorpha	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha	0.52 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.26 %

Level 9

Name	Rank	Taxonomy	Distribution
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	59.48 %
Unclassified	root	N/A	25.97 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	2.86 %
Haplosclerida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida	0.52 %
Hexacorallia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia	0.26 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.26 %

Level 10

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	59.48 %
Unclassified	root	N/A	25.97 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	2.86 %
Niphatidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae	0.52 %
Scleractinia	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia	0.26 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.26 %

Level 11

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	59.48 %
Unclassified	root	N/A	25.97 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	2.34 %
Amphimedon	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.26 %
Astrocoeniina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina	0.26 %

Level 12

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Polychaeta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	1.30 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	1.04 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.26 %
Pocilloporidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae	0.26 %

Level 13

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	1.04 %
Sedentaria	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.26 %
Pocillopora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora	0.26 %

Level 14

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	1.04 %
Scolecida	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Crustacea	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 15

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	1.04 %
Capitellidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Multicrustacea	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 16

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	1.04 %
Capitella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Malacostraca	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 17

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Eumalacostraca	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 18

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Eucarida	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 19

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Decapoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 20

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Pleocyemata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 21

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Brachyura	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 22

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Eubrachyura	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 23

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Heterotremata	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 24

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 25

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 26

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portuninae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 27

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae → Portunus	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Level 28

Name	Rank	Taxonomy	Distribution
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	59.48 %
Unclassified	root	N/A	25.97 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.04 %
Capitella teleta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	0.78 %
Amphimedon queenslandica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	0.52 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.52 %
Portunus trituberculatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae → Portunus → Portunus trituberculatus	0.26 %
Pocillopora damicornis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	0.26 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001742|JGI24673J20094_10216881	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	554
3300003748|Ga0049102_10002223	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1966
3300003748|Ga0049102_10069196	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664
3300003769|Ga0049118_10004238	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3008
3300003769|Ga0049118_10021634	Not Available	1931
3300003769|Ga0049118_10027701	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1787
3300003769|Ga0049118_10029910	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Malacostraca → Eumalacostraca → Eucarida → Decapoda → Pleocyemata → Brachyura → Eubrachyura → Heterotremata → Portunoidea → Portunidae → Portuninae → Portunus → Portunus trituberculatus	1742
3300003769|Ga0049118_10054588	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1395
3300003769|Ga0049118_10066397	Not Available	1288
3300003769|Ga0049118_10079913	Not Available	1188
3300003769|Ga0049118_10084194	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Pocilloporidae → Pocillopora → Pocillopora damicornis	1160
3300003769|Ga0049118_10102036	Not Available	1058
3300003769|Ga0049118_10114749	Not Available	998
3300003769|Ga0049118_10131126	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	929
3300003769|Ga0049118_10132415	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	925
3300003769|Ga0049118_10141602	Not Available	892
3300003769|Ga0049118_10205344	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	706
3300003769|Ga0049118_10219734	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	674
3300003769|Ga0049118_10239596	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	633
3300003769|Ga0049118_10289764	Not Available	545
3300003776|Ga0049101_10138917	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	801
3300003776|Ga0049101_10176968	Not Available	703
3300003786|Ga0049116_10024394	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1086
3300003786|Ga0049116_10027790	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1043
3300003786|Ga0049116_10031379	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1004
3300003786|Ga0049116_10055027	Not Available	839
3300003786|Ga0049116_10079402	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	741
3300003786|Ga0049116_10124391	Not Available	628
3300003786|Ga0049116_10139124	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	602
3300003786|Ga0049116_10145745	Not Available	591
3300003786|Ga0049116_10182040	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	539
3300003843|Ga0049117_10007664	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1904
3300003843|Ga0049117_10041289	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1156
3300003843|Ga0049117_10049993	Not Available	1087
3300003843|Ga0049117_10067364	Not Available	983
3300003843|Ga0049117_10069734	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	971
3300003843|Ga0049117_10106119	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	827
3300003843|Ga0049117_10159227	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	693
3300003843|Ga0049117_10179523	Not Available	654
3300003843|Ga0049117_10184542	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	645
3300003843|Ga0049117_10207515	Not Available	608
3300003843|Ga0049117_10250722	Not Available	548
3300003843|Ga0049117_10280491	Not Available	513
3300003904|JGI26658J51805_10051931	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	730
3300003905|JGI26657J51804_10296475	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	527
3300003906|JGI26667J51740_10003525	Not Available	1983
3300003906|JGI26667J51740_10217847	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	562
3300003944|Ga0049119_1005964	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	4408
3300003944|Ga0049119_1012313	Not Available	3488
3300003944|Ga0049119_1013714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3359
3300003944|Ga0049119_1032265	Not Available	2391
3300003944|Ga0049119_1046782	Not Available	1997
3300003944|Ga0049119_1076910	Not Available	1494
3300003944|Ga0049119_1094096	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1298
3300003944|Ga0049119_1122134	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1052
3300003944|Ga0049119_1135741	Not Available	955
3300003944|Ga0049119_1148177	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	877
3300003944|Ga0049119_1176885	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	723
3300003944|Ga0049119_1199370	Not Available	624
3300003944|Ga0049119_1221542	Not Available	540
3300004085|Ga0066187_1065463	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1639
3300004094|Ga0066192_1000554	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8824
3300004094|Ga0066192_1008671	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4245
3300004094|Ga0066192_1015926	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3432
3300004094|Ga0066192_1016184	Not Available	3412
3300004094|Ga0066192_1032892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2549
3300004094|Ga0066192_1035512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2459
3300004094|Ga0066192_1098029	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1406
3300004094|Ga0066192_1109235	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1309
3300004094|Ga0066192_1112113	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1286
3300004094|Ga0066192_1112778	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1280
3300004094|Ga0066192_1115947	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1256
3300004094|Ga0066192_1124428	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1197
3300004094|Ga0066192_1154616	Not Available	1023
3300004094|Ga0066192_1175443	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	929
3300004094|Ga0066192_1197115	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	847
3300004094|Ga0066192_1202378	Not Available	829
3300004094|Ga0066192_1206115	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	817
3300004094|Ga0066192_1221602	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	770
3300004094|Ga0066192_1282050	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	626
3300004094|Ga0066192_1316055	Not Available	565
3300004094|Ga0066192_1346342	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	519
3300004626|Ga0066188_1002304	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3141
3300004626|Ga0066188_1003672	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2785
3300004626|Ga0066188_1003788	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2761
3300004626|Ga0066188_1004459	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2651
3300004626|Ga0066188_1021785	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1759
3300004626|Ga0066188_1027845	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1633
3300004626|Ga0066188_1033047	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1546
3300004626|Ga0066188_1052621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1319
3300004626|Ga0066188_1057078	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1280
3300004626|Ga0066188_1083621	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1101
3300004626|Ga0066188_1095447	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1041
3300004626|Ga0066188_1137841	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	874
3300004626|Ga0066188_1141039	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	864
3300004626|Ga0066188_1173573	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	771
3300004626|Ga0066188_1195406	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	719
3300004626|Ga0066188_1219719	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	669
3300004626|Ga0066188_1243293	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	626
3300004626|Ga0066188_1263701	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593
3300004626|Ga0066188_1302076	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	537
3300004630|Ga0049105_1057817	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2844
3300004630|Ga0049105_1077611	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2402
3300004630|Ga0049105_1160054	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1413
3300005170|Ga0071327_1017738	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4559
3300005170|Ga0071327_1124098	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1636
3300005649|Ga0056116_1021200	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3865
3300005652|Ga0056135_10109962	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1562
3300005967|Ga0056128_1000245	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	42204
3300005967|Ga0056128_1001518	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	26066
3300005967|Ga0056128_1003778	Not Available	18760
3300005967|Ga0056128_1003960	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	18438
3300005967|Ga0056128_1003992	All Organisms → cellular organisms → Eukaryota → Opisthokonta	18371
3300005967|Ga0056128_1004767	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	17006
3300005967|Ga0056128_1005021	All Organisms → cellular organisms → Eukaryota → Opisthokonta	16609
3300005967|Ga0056128_1006187	Not Available	15107
3300005967|Ga0056128_1008442	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	12979
3300005967|Ga0056128_1009021	Not Available	12552
3300005967|Ga0056128_1009464	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	12230
3300005967|Ga0056128_1010508	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	11536
3300005967|Ga0056128_1012743	Not Available	10244
3300005967|Ga0056128_1014656	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9332
3300005967|Ga0056128_1016663	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8450
3300005967|Ga0056128_1016960	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	8350
3300005967|Ga0056128_1036334	Not Available	3773
3300005967|Ga0056128_1050546	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2120
3300005967|Ga0056128_1059022	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1478
3300005967|Ga0056128_1062143	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1290
3300005968|Ga0056130_1025733	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2569
3300005968|Ga0056130_1038484	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2204
3300005968|Ga0056130_1039659	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2177
3300005968|Ga0056130_1044125	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2080
3300005968|Ga0056130_1048637	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1994
3300005968|Ga0056130_1052589	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1926
3300005968|Ga0056130_1052795	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1922
3300005968|Ga0056130_1053973	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1904
3300005968|Ga0056130_1062067	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1785
3300005968|Ga0056130_1062957	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1773
3300005968|Ga0056130_1073591	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1640
3300005968|Ga0056130_1083208	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1540
3300005968|Ga0056130_1087207	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1500
3300005968|Ga0056130_1109644	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1314
3300005968|Ga0056130_1112358	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1294
3300005968|Ga0056130_1121892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1229
3300005968|Ga0056130_1130504	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1176
3300005968|Ga0056130_1131110	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1173
3300005968|Ga0056130_1153469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1052
3300005968|Ga0056130_1171427	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	967
3300005968|Ga0056130_1180231	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	930
3300005968|Ga0056130_1200618	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	852
3300005968|Ga0056130_1213358	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	807
3300005968|Ga0056130_1286543	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	608
3300005968|Ga0056130_1337725	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	509
3300005978|Ga0056129_1007323	All Organisms → cellular organisms → Eukaryota	5311
3300005978|Ga0056129_1008297	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5107
3300005978|Ga0056129_1028782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3257
3300005978|Ga0056129_1049735	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2523
3300005978|Ga0056129_1053436	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2429
3300005978|Ga0056129_1057396	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2339
3300005978|Ga0056129_1066256	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2155
3300005978|Ga0056129_1088011	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1806
3300005978|Ga0056129_1110247	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1540
3300005978|Ga0056129_1120397	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1441
3300005978|Ga0056129_1144502	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1237
3300005978|Ga0056129_1171132	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1062
3300005978|Ga0056129_1184823	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	983
3300005978|Ga0056129_1214635	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	840
3300005978|Ga0056129_1269928	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	642
3300005978|Ga0056129_1285257	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	600
3300005978|Ga0056129_1285910	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	598
3300006912|Ga0056114_1007668	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6830
3300006912|Ga0056114_1012948	Not Available	5715
3300006912|Ga0056114_1019958	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4811
3300006912|Ga0056114_1021628	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4644
3300006912|Ga0056114_1036079	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3622
3300006912|Ga0056114_1040036	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3422
3300006912|Ga0056114_1041953	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3334
3300006912|Ga0056114_1043323	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3277
3300006912|Ga0056114_1049443	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3032
3300006912|Ga0056114_1054296	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2859
3300006912|Ga0056114_1057132	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2765
3300006912|Ga0056114_1065437	Not Available	2521
3300006912|Ga0056114_1068531	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2439
3300006912|Ga0056114_1077015	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2240
3300006912|Ga0056114_1102278	Not Available	1765
3300006912|Ga0056114_1120042	Not Available	1514
3300006912|Ga0056114_1120651	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1507
3300006912|Ga0056114_1139266	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1294
3300006912|Ga0056114_1140460	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1282
3300006912|Ga0056114_1147886	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1210
3300006912|Ga0056114_1151851	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1173
3300006912|Ga0056114_1152267	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1169
3300006912|Ga0056114_1161754	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1088
3300006912|Ga0056114_1162179	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1084
3300006912|Ga0056114_1184487	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	922
3300006912|Ga0056114_1204407	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	804
3300006912|Ga0056114_1237343	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	656
3300006912|Ga0056114_1242901	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	636
3300006912|Ga0056114_1256048	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	593
3300006912|Ga0056114_1260275	Not Available	580
3300006912|Ga0056114_1283882	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	521
3300008214|Ga0056111_1022628	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	551
3300008215|Ga0056108_1143898	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1534
3300027098|Ga0209367_1000177	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica	50966
3300027098|Ga0209367_1000272	All Organisms → cellular organisms → Eukaryota → Opisthokonta	45521
3300027098|Ga0209367_1000358	All Organisms → cellular organisms → Eukaryota	42698
3300027098|Ga0209367_1001152	Not Available	31337
3300027098|Ga0209367_1001425	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	29304
3300027098|Ga0209367_1001782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	27362
3300027098|Ga0209367_1001993	All Organisms → cellular organisms → Eukaryota	26307
3300027098|Ga0209367_1002106	All Organisms → cellular organisms → Eukaryota → Opisthokonta	25826
3300027098|Ga0209367_1003297	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	21914
3300027098|Ga0209367_1004028	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	20144
3300027098|Ga0209367_1004790	Not Available	18774
3300027098|Ga0209367_1005019	All Organisms → cellular organisms → Eukaryota → Opisthokonta	18351
3300027098|Ga0209367_1005203	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	18032
3300027098|Ga0209367_1006518	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	16132
3300027098|Ga0209367_1007057	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	15504
3300027098|Ga0209367_1007590	All Organisms → cellular organisms → Eukaryota → Opisthokonta	14918
3300027098|Ga0209367_1008519	All Organisms → cellular organisms → Eukaryota → Opisthokonta	14020
3300027098|Ga0209367_1008875	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	13709
3300027098|Ga0209367_1010631	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	12315
3300027098|Ga0209367_1012699	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10956
3300027098|Ga0209367_1013702	Not Available	10398
3300027098|Ga0209367_1015805	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	9357
3300027098|Ga0209367_1016110	All Organisms → cellular organisms → Eukaryota → Opisthokonta	9214
3300027098|Ga0209367_1017414	All Organisms → cellular organisms → Eukaryota	8624
3300027098|Ga0209367_1017811	All Organisms → cellular organisms → Eukaryota → Opisthokonta	8454
3300027098|Ga0209367_1017858	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta	8435
3300027098|Ga0209367_1019140	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	7914
3300027098|Ga0209367_1023651	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6402
3300027098|Ga0209367_1023813	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6361
3300027098|Ga0209367_1026486	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5622
3300027098|Ga0209367_1035866	Not Available	3663
3300027118|Ga0209454_1000421	Not Available	22429
3300027118|Ga0209454_1000730	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	18105
3300027118|Ga0209454_1002220	All Organisms → cellular organisms → Eukaryota → Opisthokonta	13019
3300027118|Ga0209454_1019086	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5750
3300027118|Ga0209454_1026802	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4734
3300027118|Ga0209454_1029899	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	4405
3300027118|Ga0209454_1042194	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3396
3300027118|Ga0209454_1135506	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	525
3300027175|Ga0209146_1011899	Not Available	4229
3300027175|Ga0209146_1121891	Not Available	1114
3300027175|Ga0209146_1178344	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	690
3300027175|Ga0209146_1213496	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	520
3300027208|Ga0209671_1001107	All Organisms → cellular organisms → Eukaryota → Opisthokonta	21360
3300027208|Ga0209671_1012138	Not Available	9080
3300027208|Ga0209671_1027639	Not Available	5355
3300027208|Ga0209671_1044903	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3305
3300027208|Ga0209671_1057350	Not Available	2349
3300027208|Ga0209671_1067261	Not Available	1761
3300027208|Ga0209671_1078581	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1203
3300027208|Ga0209671_1088292	Not Available	859
3300027208|Ga0209671_1099782	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	565
3300027289|Ga0209787_1002585	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4104
3300027289|Ga0209787_1021219	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	2284
3300027289|Ga0209787_1023214	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2215
3300027289|Ga0209787_1052150	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1629
3300027289|Ga0209787_1074469	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1375
3300027289|Ga0209787_1088648	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1255
3300027289|Ga0209787_1096588	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1197
3300027289|Ga0209787_1112141	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1099
3300027289|Ga0209787_1129053	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1007
3300027289|Ga0209787_1135420	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	977
3300027289|Ga0209787_1136223	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	973
3300027289|Ga0209787_1136928	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	970
3300027289|Ga0209787_1152592	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	901
3300027289|Ga0209787_1163556	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	858
3300027289|Ga0209787_1219870	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	664
3300027289|Ga0209787_1234551	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	625
3300027289|Ga0209787_1272150	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	533
3300027347|Ga0209366_1010115	Not Available	4018
3300027347|Ga0209366_1026551	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2775
3300027347|Ga0209366_1063760	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1798
3300027347|Ga0209366_1077690	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1597
3300027347|Ga0209366_1100125	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1339
3300027347|Ga0209366_1123688	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1138
3300027347|Ga0209366_1133992	Not Available	1066
3300027347|Ga0209366_1148556	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	974
3300027347|Ga0209366_1200642	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	711
3300027377|Ga0209363_1004433	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8143
3300027392|Ga0209680_1003971	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6026
3300027392|Ga0209680_1007733	All Organisms → cellular organisms → Eukaryota	4925
3300027392|Ga0209680_1008826	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4715
3300027392|Ga0209680_1008886	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4705
3300027392|Ga0209680_1023788	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3301
3300027392|Ga0209680_1027370	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3115
3300027392|Ga0209680_1030254	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2984
3300027392|Ga0209680_1059968	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2139
3300027392|Ga0209680_1077344	Not Available	1846
3300027392|Ga0209680_1131567	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1249
3300027392|Ga0209680_1142110	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1166
3300027392|Ga0209680_1145200	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1142
3300027392|Ga0209680_1179918	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	927
3300027392|Ga0209680_1186630	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	891
3300027392|Ga0209680_1199630	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	822
3300027392|Ga0209680_1209670	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	772
3300027392|Ga0209680_1237481	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	651
3300027392|Ga0209680_1277901	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	510
3300027398|Ga0209782_1006349	Not Available	7431
3300027398|Ga0209782_1008964	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6489
3300027398|Ga0209782_1010862	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	5992
3300027398|Ga0209782_1014394	Not Available	5301
3300027404|Ga0209049_1109634	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	768
3300027519|Ga0209562_1001163	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	9923
3300027519|Ga0209562_1003594	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	7088
3300027519|Ga0209562_1004424	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6647
3300027519|Ga0209562_1011983	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4787
3300027519|Ga0209562_1014524	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4471
3300027519|Ga0209562_1027426	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3445
3300027519|Ga0209562_1028729	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta	3371
3300027519|Ga0209562_1029941	Not Available	3306
3300027519|Ga0209562_1032531	Not Available	3180
3300027519|Ga0209562_1039310	Not Available	2898
3300027519|Ga0209562_1046591	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2649
3300027519|Ga0209562_1049042	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2575
3300027519|Ga0209562_1055272	Not Available	2410
3300027519|Ga0209562_1057127	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2362
3300027519|Ga0209562_1059634	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2303
3300027519|Ga0209562_1066906	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2150
3300027519|Ga0209562_1068481	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2118
3300027519|Ga0209562_1079471	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1926
3300027519|Ga0209562_1082658	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1877
3300027519|Ga0209562_1089465	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1777
3300027519|Ga0209562_1094484	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1709
3300027519|Ga0209562_1111901	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1500
3300027519|Ga0209562_1211961	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	822
3300027519|Ga0209562_1232872	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	734
3300027519|Ga0209562_1247799	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	680
3300027519|Ga0209562_1256440	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	651
3300027519|Ga0209562_1259091	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	642
3300027544|Ga0209568_1012503	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4592
3300027550|Ga0209255_1000819	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	8300
3300027550|Ga0209255_1013941	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3546
3300027550|Ga0209255_1216338	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	954
3300027557|Ga0209679_1253709	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	719
3300027569|Ga0209364_1100035	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1541
3300027569|Ga0209364_1131337	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1310
3300027569|Ga0209364_1188283	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1020
3300027602|Ga0209781_1150499	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1325
3300027602|Ga0209781_1153111	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1308
3300027602|Ga0209781_1166461	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1224
3300027602|Ga0209781_1242335	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	877
3300027658|Ga0209259_1013346	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	4090

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	52.99%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	47.01%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	52.99%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	47.01%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	52.99%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	47.01%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300003748	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2	Host-Associated
3300003769	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2	Host-Associated
3300003776	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1	Host-Associated
3300003786	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2	Host-Associated
3300003843	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1	Host-Associated
3300003904	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.2	Host-Associated
3300003905	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1	Host-Associated
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated
3300003944	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND	Host-Associated
3300004085	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.1	Host-Associated
3300004094	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.1	Host-Associated
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated
3300005170	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)	Host-Associated
3300005649	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2	Host-Associated
3300005652	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1a BELIZE.1	Host-Associated
3300005967	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300008214	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius longissimus B BELIZE.2	Host-Associated
3300008215	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1	Host-Associated
3300027098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027118	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1 (SPAdes)	Host-Associated
3300027175	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND (SPAdes)	Host-Associated
3300027208	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2 (SPAdes)	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027331	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius tantulus BAHAMAS.1 (SPAdes)	Host-Associated
3300027347	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.2 (SPAdes)	Host-Associated
3300027377	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus exumae BAHAMAS.3 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027398	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus makropetalos BAHAMAS.1 (SPAdes)	Host-Associated
3300027404	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius ullae BAHAMAS.2 (SPAdes)	Host-Associated
3300027519	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BELIZE.2 (SPAdes)	Host-Associated
3300027544	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. DAHAB.2 (SPAdes)	Host-Associated
3300027550	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)	Host-Associated
3300027557	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 2 HERON ISLAND (SPAdes)	Host-Associated
3300027569	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.2 (SPAdes)	Host-Associated
3300027602	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius albidus HERON ISLAND.1 (SPAdes)	Host-Associated
3300027658	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 2 BELIZE.1 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24673J20094_102168812	3300001742	Marine Gutless Worms Symbiont	MFNVSALLLDDARKPATPLTNGAINETLRQFAPLSDDRLLQ
Ga0049102_100022231	3300003748	Marine Gutless Worms Symbiont	MFSVSTLLLDRAFKPATPLTNGVINETLRQFAPLSDISQGSVA
Ga0049102_100068453	3300003748	Marine Gutless Worms Symbiont	MFNVSTLLLDDTFNPATPLTNGVISEALQQLATLSDISQ*
Ga0049102_100691961	3300003748	Marine Gutless Worms Symbiont	MFNVSTLLLDDAFKPLTPLTNGVINETLRQFFPLSDISR*
Ga0049102_100771642	3300003748	Marine Gutless Worms Symbiont	MFNVSALLLDDTFNRTTPLTNGVINEMLRQFAPLSDFTK*
Ga0049118_100042381	3300003769	Marine Gutless Worms Symbiont	MFYVSALLLDDASKTATPLSNGAINQTLRQFAPLSDDRLL*
Ga0049118_100216341	3300003769	Marine Gutless Worms Symbiont	MFNVSGLLLDDALKHMTPLTSGAINQTLRQFAPLSDDRLLQLADCRKCRR*
Ga0049118_100277011	3300003769	Marine Gutless Worms Symbiont	SHQMFDVSAFLPDDALKPSTPLTNGAINQTLRQFASLSDDCLLQLVNCR*
Ga0049118_100299102	3300003769	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWRFAPLSGNHLLQLVD*
Ga0049118_100514832	3300003769	Marine Gutless Worms Symbiont	MFSVSALLLDDTLKPETLLTNGAINETLLQFAPLSASAG*
Ga0049118_100545883	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRHFAPLSDNRFLQLVDCRE*
Ga0049118_100663971	3300003769	Marine Gutless Worms Symbiont	MFNASTLLLDDALKPVTPLTNGTINQMLQQFTPLDDCLLQLVDCHE
Ga0049118_100799131	3300003769	Marine Gutless Worms Symbiont	MFNVPALLLDDASKTVTPLTSGAINQTLRQLAPLSDDRLLQLVDCCESN*
Ga0049118_100841942	3300003769	Marine Gutless Worms Symbiont	MFNVFALLLDDARKPATPLTNGAISQKLRQFAPLSDNHLLQLVD*
Ga0049118_101020361	3300003769	Marine Gutless Worms Symbiont	FSHQIFNVFALLLYDASKPATPLTKGAINQTLRHFAPLSDNSFL*
Ga0049118_101147491	3300003769	Marine Gutless Worms Symbiont	MFNVSLLLLDDASKLATPLTNGAISQTLWHFAPLSDIGFL*
Ga0049118_101311262	3300003769	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLRQFAPLNDNLLL*
Ga0049118_101324152	3300003769	Marine Gutless Worms Symbiont	FNVSALLLDVASKPATPLTNXAINQTLRQFAPLSDNGFL*
Ga0049118_101416022	3300003769	Marine Gutless Worms Symbiont	MFNESALLLDHASKNGTPLTNGANQMLRQFAPLSDNRLLQLVDCRELSK*
Ga0049118_101534141	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINQTLQQFAPLSAPELS*
Ga0049118_102053442	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAINQTLRHFASLTDNGFL*
Ga0049118_102197341	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD*
Ga0049118_102197991	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNGAINQTLRQFAPLGASAG*
Ga0049118_102395961	3300003769	Marine Gutless Worms Symbiont	MVNVSALLLKDALKTATPLTNGAINQTLWQFSPLIDDRLL*
Ga0049118_102897642	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNVTPLTNSAINQTLQQFAPLSDDRLLQLV
Ga0049118_103181392	3300003769	Marine Gutless Worms Symbiont	MFNVSALLLDDTSKTATLLTNGVINQMLRQFAPLSDNRLLQWLPVVNRQH*
Ga0049101_101349961	3300003776	Marine Gutless Worms Symbiont	MFKVSTLLLDDKFKPAMPLTNCMIMINEMLRQFAPLGDIS*
Ga0049101_101389171	3300003776	Marine Gutless Worms Symbiont	MFKVYTLLLDDALKLVTPLTNGVINETLRQFAPFSDISQLTR*
Ga0049101_101451592	3300003776	Marine Gutless Worms Symbiont	MFNVLALLLDDALKPATPMTNGVINKTLRSFAPLSDTSQG
Ga0049101_101769681	3300003776	Marine Gutless Worms Symbiont	MFNAFALLLDDAFKPATPLTNGVINETLRQFASLNNISKGSVV*
Ga0049101_102144031	3300003776	Marine Gutless Worms Symbiont	MFNVSAFLLDDAFKPATPLTNGVINDTMRQFATLSDISQGSVA
Ga0049116_100243941	3300003786	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLRQFAPLSDDTLEM
Ga0049116_100277901	3300003786	Marine Gutless Worms Symbiont	MFNVSALLLDNALKPATPLANGAISETLRQFVPLSDDTLEVWWDL*
Ga0049116_100313791	3300003786	Marine Gutless Worms Symbiont	MFSVSTLLLDEALKPVTPLTNGAINETLREFAPLSDDTLEVWWNL*
Ga0049116_100550271	3300003786	Marine Gutless Worms Symbiont	MQFLHLMFNASALLRDDQLKPVTPLTNGAIDETLQQFAALSDDCLL*
Ga0049116_100794021	3300003786	Marine Gutless Worms Symbiont	MFIVSALLLDDALKPTTPLTNGAINETLRQFAPLSDDTLEVWLDL*
Ga0049116_101243911	3300003786	Marine Gutless Worms Symbiont	MLQFSHQMFNVSALLLDDALKPATLLTNGAINETLRQFAPLSDDTLEVRWDL*
Ga0049116_101391242	3300003786	Marine Gutless Worms Symbiont	FSVSALLPDDALKPATPQINGVINEMLPQFVPLSDNTLEVWWDL*
Ga0049116_101457452	3300003786	Marine Gutless Worms Symbiont	MFNLIALLQDDPLKPVTPLTNGTIDETLQQFASLSDDCLL*
Ga0049116_101820401	3300003786	Marine Gutless Worms Symbiont	SHAADLHQMFNLFALLLDDPLKPATPLTNGAINETLQQFAPLSDDCLL*
Ga0049116_102102812	3300003786	Marine Gutless Worms Symbiont	MFSLFALLRDDPLKPATPLTNGAIDETLQWFAALSDDCLLQLVD*
Ga0049117_100076643	3300003843	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLNNSAINQTLPQFAPLSAPELS*
Ga0049117_100412892	3300003843	Marine Gutless Worms Symbiont	FNVSALLLDDASKNATPLTNSAINQMLRHFAPLSDNRFLQLVDCRE*
Ga0049117_100499933	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLDNALKPATPLTSGAINQMLRQFAPLSDDRLH
Ga0049117_100673642	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRQFAPLSDNRLL*
Ga0049117_100697341	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTSGAISQTLWQFAPLSDNHLLQLVN*
Ga0049117_101061192	3300003843	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPSMPLTNGAINQTLRQFAPISDDRLLVDCH*
Ga0049117_101592271	3300003843	Marine Gutless Worms Symbiont	MFNIFALLLDDASKTATPLTNGAVNQTPRQFAPLNDDRLL*
Ga0049117_101795231	3300003843	Marine Gutless Worms Symbiont	MLNVSALLLDDASKTATPLTNGAINQTLRQFAPLSDNGFL*
Ga0049117_101845421	3300003843	Marine Gutless Worms Symbiont	MFNVSALLLNDAPKPATPLTNGAISQTLRQFAPLSDNSFL*
Ga0049117_102014431	3300003843	Marine Gutless Worms Symbiont	ACNISQFSHQMFNVSALLLEDALKPATPLTNGAINQTLRQFAPLGASAG*
Ga0049117_102075151	3300003843	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAIKQTLRQFAPLSAPKLS*
Ga0049117_102414291	3300003843	Marine Gutless Worms Symbiont	MFSVSALLLDDAFKPSTPLTNGAINQTLQQFAPLSAPELS*
Ga0049117_102507221	3300003843	Marine Gutless Worms Symbiont	MFNVFALLVDDASKTPTPLTNGAINQTLWLRQSAPLSDDRLL*
Ga0049117_102804911	3300003843	Marine Gutless Worms Symbiont	ISQFSHQMFNVSAVLLDDALKPATPLTNGAISQTLWRFAPLSGNHLLQLVD*
JGI26658J51805_100519311	3300003904	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFVPLSDNRLLQLIDCRESF*
JGI26657J51804_102964752	3300003905	Marine Gutless Worms Symbiont	MFMSALLLDDALKPTTPLTNGGINEMLRQFSPLSDVTIACFS*
JGI26667J51740_100035254	3300003906	Marine Gutless Worms Symbiont	MLQFLHQMFNVSVLHALKPATPLTIGAINVTLRQFVPLSDDTLEMWWDL*
JGI26667J51740_102178471	3300003906	Marine Gutless Worms Symbiont	MFNVSLLLLDDAVKPATPLTNGAIDETLRQFAPLSDDRLLQLVD*
Ga0049119_10059645	3300003944	Marine Gutless Worms Symbiont	MSALLLDDASKSATPLTSGAINQTLRQFAPLSDNGFFLAG*
Ga0049119_10123134	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINLILRQFAPLSAPELS*
Ga0049119_10137141	3300003944	Marine Gutless Worms Symbiont	QFLHQMFNVSALLLDDASKTATPLTNGAINQTLRHFASLTDNGFL*
Ga0049119_10322654	3300003944	Marine Gutless Worms Symbiont	MFNVCTLLLDDASKTATPLTNGANQLLRQFAPLSDNRLLQLVDCR
Ga0049119_10467821	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDVASKTATPLTSGAINQTLQQFAPLSDDRLL
Ga0049119_10529091	3300003944	Marine Gutless Worms Symbiont	MSALLLDDASKSATSLTNGAINQTLRQFAPLSDNRLLQLVDCR
Ga0049119_10769101	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDGTSKTATLLTNGGINQTLRQFAPLSDSRLLQL
Ga0049119_10940962	3300003944	Marine Gutless Worms Symbiont	QFSHQMFNVSALLLDDASKPATPLTNGAINQTLRHIAPLSDNGFLAG*
Ga0049119_11221341	3300003944	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWQFAPLSGNHLLQLVD*
Ga0049119_11357411	3300003944	Marine Gutless Worms Symbiont	MFNMSALLLDDTSKMAMPLTNGTINQTLWQFAPLSDDHLLQLTVVNHQH*
Ga0049119_11481771	3300003944	Marine Gutless Worms Symbiont	FNVSALLLDDAPKPATPLTSGAISQTLWQFAPLSDNHLLQLVN*
Ga0049119_11768852	3300003944	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLQQFAPLNDNLLL*
Ga0049119_11993702	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAKQMLRQFASLGDNRLL*
Ga0049119_12215421	3300003944	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRQFAPLSDNRLLQLVD
Ga0066187_10654631	3300004085	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPMTNGAINEMLRQFAPLSDDRLLLIVVNH*
Ga0066192_10005545	3300004094	Marine Gutless Worms Symbiont	MFNASALLQLDHALKPATPLTSGVISETLRQFAPLSDDTHEVWWDL*
Ga0066192_10086719	3300004094	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDALKPATPLTNSAINETLRQFALPLSDDTLEVWWDLL*
Ga0066192_10159261	3300004094	Marine Gutless Worms Symbiont	MFNVSTLLQGDALKPATPLTNGVMNETLRQFAPLSDDTLEMWWDL*
Ga0066192_10161841	3300004094	Marine Gutless Worms Symbiont	ILQFLHQMFNVSALLLDDALKPTTPLTNGAINETLRHTLDI*
Ga0066192_10328921	3300004094	Marine Gutless Worms Symbiont	CHILQFLHQMFNLFALLLDNALKPATPLTNGTINETLRQFAPLIDDTLKVCWDL*
Ga0066192_10355123	3300004094	Marine Gutless Worms Symbiont	MFTVSALLPDDALKSATPLTNGAINKTLRQFAPLSDDRLLQLVDC
Ga0066192_10980292	3300004094	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPATPLTNGAINETLRQFAPLSHDTPEV*
Ga0066192_11092351	3300004094	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFVPLSDDILEVW*
Ga0066192_11121132	3300004094	Marine Gutless Worms Symbiont	LHQMFNVSTLLLDDALKPATPLTNGAINETLRQFAPLSDDTLAVW*
Ga0066192_11127783	3300004094	Marine Gutless Worms Symbiont	MFNVSTLLLDDALRPATPLTNDAINEMLRQFATLSDDTLEVWWDL*
Ga0066192_11159473	3300004094	Marine Gutless Worms Symbiont	QMFNVSALLLDDALKPATPLTNVAINETLRQFSPLSDDTL*
Ga0066192_11244281	3300004094	Marine Gutless Worms Symbiont	MFYLSVSALLLDDALKPATPLTNGVFNETLRQFAPLSDDTLEVWWDL*
Ga0066192_11546164	3300004094	Marine Gutless Worms Symbiont	MFNLFALLPDDPLKLATPQTNGAIDETLQQFAPLSDDCLL
Ga0066192_11734963	3300004094	Marine Gutless Worms Symbiont	HILQFLHQMFNVSALLLDDAAGDATDNGAFNETLRQFASLSDDTLEVW*
Ga0066192_11754432	3300004094	Marine Gutless Worms Symbiont	MFNVSALLLDDARKPATPLTNGVINETLRQFAPLSDDRLLQLVDC
Ga0066192_11971152	3300004094	Marine Gutless Worms Symbiont	MCPPCLLLDDALKLATPLTNGAINETLRQFAPLSDDTLEV*
Ga0066192_12023781	3300004094	Marine Gutless Worms Symbiont	MLQFLHQMFNLFALVRDDPLKPVTTLTNGAIDEKLQQFAPLSDDCLLQLVDFLES
Ga0066192_12061151	3300004094	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPVTPLTNGAINESLRQFAPLSDDTLEARWAL*
Ga0066192_12216021	3300004094	Marine Gutless Worms Symbiont	MFNVSSLLVDDAVKPTTPLANGVISETLRQFAPLSDDTLEVW
Ga0066192_12820501	3300004094	Marine Gutless Worms Symbiont	MQFLHQVFNVSALLRDDPLKPAMPTTNGTINETLRQFAPLSDDCLLQLIDCRESS
Ga0066192_13160552	3300004094	Marine Gutless Worms Symbiont	MFNVSALLRDDPLKPATPLTNDAINETLRQFAPLSDDTLEVW
Ga0066192_13463421	3300004094	Marine Gutless Worms Symbiont	HQMFNVSALLLDDALKPATPLTNGTISETLRQFAPLSDDTLEVWWHL*
Ga0066188_10023044	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10036721	3300004626	Marine Gutless Worms Symbiont	MRFLYQMFNVSALLLDDARKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10037882	3300004626	Marine Gutless Worms Symbiont	MQFLYQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10044593	3300004626	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGYNNETLRQFAPLNDDRLL*
Ga0066188_10217853	3300004626	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDGLKPATPLTNGEMNERCQFAPLNDDRLL*
Ga0066188_10278451	3300004626	Marine Gutless Worms Symbiont	MQFLLQMFNVSTLLLDDGLKPATPLTNGAINETLRQFAPLSDDRLL*
Ga0066188_10330473	3300004626	Marine Gutless Worms Symbiont	MQFLQQMFNVSALLLDDGLKPATPLTRPNGAINETLRQFAPLNDDRLI*
Ga0066188_10526211	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDAIKPTTPLTNGAINETLRQFAALNDDRLH*
Ga0066188_10570781	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTSGVISETLRQFAPLNDDRLL*
Ga0066188_10836212	3300004626	Marine Gutless Worms Symbiont	MVNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0066188_10954471	3300004626	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDHLL*
Ga0066188_11378412	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKLATPLTNGAISEMLRQFAPLNDDRLL*
Ga0066188_11410391	3300004626	Marine Gutless Worms Symbiont	MQFVHQMFSVSALLLDNALNGVINETQRQFAPFNDDRLL*
Ga0066188_11735732	3300004626	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPAMPLTNGAINEMLRQFAPLNDDRLLL*
Ga0066188_11954061	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDGLKPATPLTDGAINETLRQFGPFNLCPT*
Ga0066188_12197191	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINGTLRQFAPLNDDRLL*
Ga0066188_12432931	3300004626	Marine Gutless Worms Symbiont	MQSLHQMFNASALLLDDALKPATPLTNGAINETLRQFAPLSDDRLL*
Ga0066188_12637012	3300004626	Marine Gutless Worms Symbiont	MFNVSALLLDDGLKPATPLTNGAINETLRQFVPFNDDRLL*
Ga0066188_13020761	3300004626	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPTPLTNGAINEALRQFAPLNDDRLL*
Ga0049105_10578174	3300004630	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLINEMLRQFAPLSDYRLLQLVD*
Ga0049105_10776113	3300004630	Marine Gutless Worms Symbiont	MFNVSALLLDDAVKPATPLTNGTIDETLRQFAPLSDDRLLQLVD*
Ga0049105_11600541	3300004630	Marine Gutless Worms Symbiont	MFNVSALLLDDTLKPATPPTNGAINKMLRQFVPLSDDRLLQLVD
Ga0071327_10177385	3300005170	Marine Gutless Worms Symbiont	MFNVSLLLLDDAVKPATPLTNGTIDETLRQFAPLSDDRLLQLVD*
Ga0071327_11240983	3300005170	Marine Gutless Worms Symbiont	SNCSHSAVFTLFNVSALLLDDTLKPAMPLNNRVINETLRQIAPLCDDTLEVWWDL*
Ga0056116_10212007	3300005649	Marine Gutless Worms Symbiont	MFNVFALLMDDALKPATPLTNGAINETLRQLAPLIDDHCVPGSV*
Ga0056135_101099623	3300005652	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLGQFSPLRDDRLLQLVDCRES*
Ga0056128_100024581	3300005967	Marine Gutless Worms Symbiont	MFNVSTLLLDDASKNATPLTNGTINQMLRQFAPLSENGFL*
Ga0056128_100114022	3300005967	Marine Gutless Worms Symbiont	MYALLLDDALKPATPLTNGAISETLQQFTPLSSQNSL*
Ga0056128_100151819	3300005967	Marine Gutless Worms Symbiont	VSALLLDDASKPAMPLTNGAINQTLQHFAPLSDNGFL*
Ga0056128_100306027	3300005967	Marine Gutless Worms Symbiont	MFNTSALLLDDALKPATPLNNGAISETLRQFAAFS*
Ga0056128_100377822	3300005967	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAINQTLQQFAPLS
Ga0056128_100396031	3300005967	Marine Gutless Worms Symbiont	MFDVSALLLDDTFKPATPLTNGAINQTLRQFVPLSDDRLLLLVDCR*
Ga0056128_10039929	3300005967	Marine Gutless Worms Symbiont	MLNVSALLLNDALKLATPLTNGAINQTLQRFAPLSASAV*
Ga0056128_10047675	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKAANGAINQTLRHFAPLSDNGFL*
Ga0056128_100502128	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPSTPLTNGAISQTLWQIAPLSDNHLLQLVD*
Ga0056128_100618726	3300005967	Marine Gutless Worms Symbiont	MFNVFALLVDDASKTPTPLTNGAINQTLWLQQSAPLSDDRLL*
Ga0056128_100750913	3300005967	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPATPLNNGAISETLRQFAAFS*
Ga0056128_10084424	3300005967	Marine Gutless Worms Symbiont	MFNVFTLLLDDALKPATPLTNGAVNQTLRQFAPLSAQELS*
Ga0056128_10090216	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDTSKTATLLTNGVIHQTLRQFAPLSDNCLLQLVD*
Ga0056128_100946413	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLINGAINQTLWQFAPLSDNHLLQLVD*
Ga0056128_101050822	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDSHLLQLVD*
Ga0056128_101274316	3300005967	Marine Gutless Worms Symbiont	MCNVSALLLDDALKPATPLTNGAINQTLWQFAPLNDNGFL*
Ga0056128_101429017	3300005967	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTYGAINQMLRQFAPLGAPELS*
Ga0056128_101465612	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDASKPATPLTNGAINQTLRHIAPLSDNGFLAG*
Ga0056128_10166633	3300005967	Marine Gutless Worms Symbiont	MFNVSVLLLHDASKLATPLTNGAINQTLRHFAALSDNGFF*
Ga0056128_10169608	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDNASKPATPLTNGAINQTLQHFAQLSDNGFL*
Ga0056128_10353266	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATLLTKGAINETLRQFAPLGAPELS*
Ga0056128_10363343	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNDAINQTLRQFASLSAPELS*
Ga0056128_10411602	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPPMINGAINETLRQLAPLS*
Ga0056128_10505461	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAINQTLRHFAPLSDNGFF*
Ga0056128_10590221	3300005967	Marine Gutless Worms Symbiont	VSALLLDVASKPATPLTNEAINQTLRQFAPLSDNGFL*
Ga0056128_10621431	3300005967	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNYLLQLVD*
Ga0056130_10257333	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL*
Ga0056130_10384843	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETPRQFAPLNDECLL*
Ga0056130_10396592	3300005968	Marine Gutless Worms Symbiont	MQFLHKMFNVSALLLDDALKPATALTNGTINETLRQFAPLNDDRLL*
Ga0056130_10441254	3300005968	Marine Gutless Worms Symbiont	MQFLHRMFNVSALLLDDALKPATPQSNGAINETLRQFAPLNDDRLL*
Ga0056130_10486372	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEHALKPATPLTNGAISETLRQFAPLNHLL*
Ga0056130_10525893	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKLATPLTNGAIIETLRQFAPLNDDRLL*
Ga0056130_10527954	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDRLKPATPLNNGAINETLRQFAPLNDDRLL*
Ga0056130_10539731	3300005968	Marine Gutless Worms Symbiont	VSALLLDDALKLATPLTNGAINETLRQFVPLNDDRLL*
Ga0056130_10620672	3300005968	Marine Gutless Worms Symbiont	MQYLHLMFNVSTLLLDDALKPATPLTNGAINKTLRLFAPLNDDRLL*
Ga0056130_10629572	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGMINETLRQFAPFNDDRLL*
Ga0056130_10735912	3300005968	Marine Gutless Worms Symbiont	MQQMFNVSTMLLDDAIKPTTPLTNGAIDETLRQFAALNDDRLN*
Ga0056130_10832082	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVFDLLLDDALKPAMPLTSGAINETL*QFDPLNDDRLL*
Ga0056130_10872072	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDGLKPATPLTKSNGAINETLRQFAPLNDDRLP*
Ga0056130_11096443	3300005968	Marine Gutless Worms Symbiont	FLHQMFNVSALLLDDALKPATPMTNGAINEMLRQFAPLNDDRLLL*
Ga0056130_11123582	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFIVSALPLDDALKPAMPQTNGAINETLRQFDPPNDDRLL*
Ga0056130_11218921	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAISETLRQFATLNDDRLL*
Ga0056130_11305041	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056130_11311102	3300005968	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLQQFSPLNDDRLL*
Ga0056130_11534691	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDTALKPATPLTNGAINETLRQFAQLGDDRLL*
Ga0056130_11714271	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPQTNGAINDTLRQFVPLNDDRLL*
Ga0056130_11802311	3300005968	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAISETLEQFAPNQ*
Ga0056130_12006182	3300005968	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPTTPLPNGAINETLRQFAPLNDDRLL*
Ga0056130_12133582	3300005968	Marine Gutless Worms Symbiont	MQFLQQMFNVSALLQDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056130_12865431	3300005968	Marine Gutless Worms Symbiont	LLDDALKPATPLTNGAINETLRQFAPLSDDRLLKAGRLS*
Ga0056130_13377252	3300005968	Marine Gutless Worms Symbiont	MQFLNLMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLLAG*
Ga0056129_10073236	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQF
Ga0056129_100829711	3300005978	Marine Gutless Worms Symbiont	MQFLNLMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056129_10287823	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLGDTLKPATTLTNGAINETLRQFAPLNDDRLL*
Ga0056129_10497354	3300005978	Marine Gutless Worms Symbiont	ALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056129_10534363	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDAFKPATPMPNGAINEMLQQFAPLNDDRLL*
Ga0056129_10573964	3300005978	Marine Gutless Worms Symbiont	QFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDCLR*
Ga0056129_10662564	3300005978	Marine Gutless Worms Symbiont	MLHQMFNVSALLLDDALKPATPLTNGAINETLRQFA
Ga0056129_10880113	3300005978	Marine Gutless Worms Symbiont	MQFSNLMFNMSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLLAG*
Ga0056129_11102473	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNDAINVKLRQFAALSDDRML*
Ga0056129_11203974	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSVLLLYDALKPATPLTNGAINETLRQFAPLND
Ga0056129_11445021	3300005978	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNVAINETLRQFAPLSDDRLL*
Ga0056129_11711321	3300005978	Marine Gutless Worms Symbiont	MQFLGLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056129_11848231	3300005978	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDVKIA*
Ga0056129_12146351	3300005978	Marine Gutless Worms Symbiont	MQFLHQVFNVSTLLLDDALKPATPLTNGAINETLRQFAPLNDDRLLY
Ga0056129_12699281	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFDFAPLNDDRLL*
Ga0056129_12852572	3300005978	Marine Gutless Worms Symbiont	LDDALKPATPLTNGAINETLRQFAPLNDDRLLYLV*
Ga0056129_12859101	3300005978	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAP
Ga0056114_10076681	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFIVSALLLDDALKLTTPLTNGAINETLRQFVPLNDDRL
Ga0056114_10129487	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDALKPAMPLTNGAINETLRQFAPLNDNRVL*
Ga0056114_10199584	3300006912	Marine Gutless Worms Symbiont	MRFLHRMFNVSALLLDDALKPATPQSNGAINETLRQFAPLNDDRLL*
Ga0056114_10216285	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDALKPATPLTNGAINETLRLFAPLNDDRLL*
Ga0056114_10360796	3300006912	Marine Gutless Worms Symbiont	MQFLHQLFNVSALLLDDALKPATNGAINETLRQFAPLNDDRLL*
Ga0056114_10400362	3300006912	Marine Gutless Worms Symbiont	MQFLHHIFNVTTLLLDDALKPATPLTNGAINETLRQFAPLNDDRLL*
Ga0056114_10419531	3300006912	Marine Gutless Worms Symbiont	MSALLLDDGLKPATPLTNGAISETLRQFAPLNDDRLL*
Ga0056114_10433236	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLLQFAPLNDDRLL*
Ga0056114_10494434	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALEPASPLTNGAINETLRQFAPLNDDRLL*
Ga0056114_10542962	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPATPMPNGAINEMLQQFAPLNDDRLL*
Ga0056114_10571327	3300006912	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDGLKPSTPLTNGAVNERCVFAPLNDDRLL*
Ga0056114_10654373	3300006912	Marine Gutless Worms Symbiont	MQFVHQMFNMSALLLDDALKPAMSLTNGAINETLRQFVPVNDDRLL*
Ga0056114_10685313	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDD*
Ga0056114_10770153	3300006912	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPATPLTNGAINETLRQFAPLNDDRLR*
Ga0056114_11022782	3300006912	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDGFKPATPLTNGAMNERCNCEFAPLNDDRLL*
Ga0056114_11200424	3300006912	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDD
Ga0056114_11206514	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPVTPLTNGAINETLRQFDPLNDDRLL*
Ga0056114_11392661	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDAHKLATPLTNGSINETLRQFAPLNDDRLL*
Ga0056114_11404603	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKLATPLTNGAIIEMLRQFAPLNDDRLL*
Ga0056114_11409362	3300006912	Marine Gutless Worms Symbiont	MMQFLHQMFNVSALLLDDALKPATPLTNGAINETL*
Ga0056114_11478862	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDASKLATPLTNGAMNETLRQFVPLNDDRLL*
Ga0056114_11518512	3300006912	Marine Gutless Worms Symbiont	MHYLHQMFNVSALLLDDALKLATPLTNGAISEMLRQFAPLNDDRLL*
Ga0056114_11522672	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDAIKPTTPLTNGAINETLRQFAALNDDRLH*
Ga0056114_11617542	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATTLANDAINEMLRQFAPFNDDRLL*
Ga0056114_11621791	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDD
Ga0056114_11844872	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLN
Ga0056114_12044072	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEDVVKLATPLTNGNETLRQFALLNDDRLL*
Ga0056114_12373431	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAVNETLRQFAPLNDDHLL*
Ga0056114_12429012	3300006912	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDD
Ga0056114_12560481	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAIIETLRQFAPLSDDRLL*
Ga0056114_12602751	3300006912	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDGLKPATPLTTGAINETLRQFVPLNDDRLL*
Ga0056114_12838821	3300006912	Marine Gutless Worms Symbiont	MHFLHQVFNVSALLLDDALKPATPLTNSAIKETLRQFAPLSDDRLL*
Ga0056111_10226281	3300008214	Marine Gutless Worms Symbiont	MFNVFALLMDDALKPATPLTNGAINEKLMRQFAPLSDDRLLQLVDFVNRRC*
Ga0056108_11438981	3300008215	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPPATPLTNGAISETLGQFSPLSGDSR*
Ga0209367_100017731	3300027098	Marine Gutless Worms Symbiont	MFNVSTLLLDDASKNATPLTNGTINQMLRQFAPLSENGFL
Ga0209367_100027227	3300027098	Marine Gutless Worms Symbiont	MFNVPALLLDDASKTVTPLTSGAINQTLRQLAPLSDDRLLQLVDCCESN
Ga0209367_100035827	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKAANGAINQTLRHFAPLSDNGFL
Ga0209367_100115227	3300027098	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWQFAPLSGNHLLQLVD
Ga0209367_10014257	3300027098	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLQQFAPLNDNLLL
Ga0209367_100178213	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTATPLTNGAINQTLRHFASLTDNGFL
Ga0209367_10019939	3300027098	Marine Gutless Worms Symbiont	MFNIFALLLDDASKTATPLTNGAVNQTPRQFAPLNDDRLL
Ga0209367_100210613	3300027098	Marine Gutless Worms Symbiont	MFNVFALLLDDARKPATPLTNGAISQKLRQFAPLSDNHLLQLVD
Ga0209367_100329714	3300027098	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPSMPLTNGAINQTLRQFAPISDDRLLVDCH
Ga0209367_10040286	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLINGAINQTLWQFAPLSDNHLLQLVD
Ga0209367_10047901	3300027098	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAINQTLQQFAPLSAP
Ga0209367_10050199	3300027098	Marine Gutless Worms Symbiont	MLNVSALLLNDALKLATPLTNGAINQTLQRFAPLSASAV
Ga0209367_10052035	3300027098	Marine Gutless Worms Symbiont	VSALLLDDASKPAMPLTNGAINQTLQHFAPLSDNGFL
Ga0209367_10055086	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATLLTKGAINETLRQFAPLGAPELS
Ga0209367_100651812	3300027098	Marine Gutless Worms Symbiont	MFNVFTLLLDDALKPATPLTNGAVNQTLRQFAPLSAQELS
Ga0209367_10067379	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNGAINQTLRQFAPLGASAG
Ga0209367_10070577	3300027098	Marine Gutless Worms Symbiont	MFNMPVLLLDDASKAATPLTNGAISQTLRHFAPLSDNGFFLAN
Ga0209367_10075906	3300027098	Marine Gutless Worms Symbiont	MSALLLDDASKSATPLTSGAINQTLRQFAPLSDNGFFLAG
Ga0209367_10082641	3300027098	Marine Gutless Worms Symbiont	MYALLLDDALKPATPLTNGAISETLQQFTPLSSQNSL
Ga0209367_100851912	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPSTPLTNGAISQTLWQIAPLSDNHLLQLVD
Ga0209367_100887512	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTSGAISQTLWQFAPLSDNHLLQLVN
Ga0209367_101063112	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKSATPLTIGAISQTLWKFAPLSENHLLQLVD
Ga0209367_10126994	3300027098	Marine Gutless Worms Symbiont	MFNMSALLLDDTSKMAMPLTNGTINQTLWQFAPLSDDHLLQLTVVNHQH
Ga0209367_10137023	3300027098	Marine Gutless Worms Symbiont	MCNVSALLLDDALKPATPLTNGAINQTLWQFAPLNDNGFL
Ga0209367_10155816	3300027098	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTYGAINQMLRQFAPLGAPELS
Ga0209367_10158056	3300027098	Marine Gutless Worms Symbiont	MFYVSALLLDDASKTATPLSNGAINQTLRQFAPLSDDRLL
Ga0209367_10161106	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDASKPATPLTNGAINQTLRHIAPLSDNGFLAG
Ga0209367_10174143	3300027098	Marine Gutless Worms Symbiont	MVNVSALLLKDALKTATPLTNGAINQTLWQFSPLIDDRLL
Ga0209367_10178116	3300027098	Marine Gutless Worms Symbiont	MFNVSVLLLHDASKLATPLTNGAINQTLRHFAALSDNGFF
Ga0209367_10178583	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDNASKPATPLTNGAINQTLQHFAQLSDNGFL
Ga0209367_10184202	3300027098	Marine Gutless Worms Symbiont	MFSVSALLLDDAFKPSTPLTNGAINQTLQQFAPLSAPELS
Ga0209367_10191402	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD
Ga0209367_10236511	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLNDAPKPATPLTNGAISQTLRQFAPLSDNSFL
Ga0209367_10238135	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDSHLLQLVD
Ga0209367_10264864	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDASKNATPLTNSAINQMLRHFAPLSDNRFLQLVDCRE
Ga0209367_10309682	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPPMINGAINETLRQLAPLS
Ga0209367_10358662	3300027098	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNDAINQTLRQFASLSAPELS
Ga0209454_10004213	3300027118	Marine Gutless Worms Symbiont	MFNVSAVLLDDALKPATPLTNGAISQTLWRFAPLSGNHLLQLVD
Ga0209454_10007306	3300027118	Marine Gutless Worms Symbiont	MFDVSALLLDDTFKPATPLTNGAINQTLRQFVPLSDDRLLLLVDCR
Ga0209454_10022201	3300027118	Marine Gutless Worms Symbiont	MFNVSALLLDGTSKTATLLTNGGINQTLRQFAPLSDSRLLQLVDCRESST
Ga0209454_10190864	3300027118	Marine Gutless Worms Symbiont	MFNVAALLLDDAPKPATPLTNGAISQPLWQFVPLSDNHLLQLVD
Ga0209454_10268022	3300027118	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPMTNGAISQTLWQFAQLSDSHLLQLVD
Ga0209454_10297846	3300027118	Marine Gutless Worms Symbiont	VSALLLDDALKPATPLTNGAINQTLQQFAPVSAPQLS
Ga0209454_10298991	3300027118	Marine Gutless Worms Symbiont	MSALLLDDASKSATPLTGGAINQTLRQFAPLSDNGFFLAG
Ga0209454_10421942	3300027118	Marine Gutless Worms Symbiont	VSALLLDDASKPATPLTNGAINQTLRHFAPLGDNGFL
Ga0209454_10795232	3300027118	Marine Gutless Worms Symbiont	MSALLLDDTLKPATPLTNGAINQTLQQFAPLSAPELS
Ga0209454_11355061	3300027118	Marine Gutless Worms Symbiont	FSHQIFNVSALLLDDASKPATPLTNGAINQTLRYVAPLIDNGFL
Ga0209146_10118994	3300027175	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPTTPLTNGAICQTLWQFAQLSDNHLLQLVD
Ga0209146_11090851	3300027175	Marine Gutless Worms Symbiont	VSALLLDDALKPATPLTNGAINQTLRQFAPLGAPE
Ga0209146_11218911	3300027175	Marine Gutless Worms Symbiont	MFNVSGLLLDDALKHMTPLTSGAINQTLRQFAPLSDDRLLQLADCRKCRR
Ga0209146_11783441	3300027175	Marine Gutless Worms Symbiont	SALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD
Ga0209146_12134961	3300027175	Marine Gutless Worms Symbiont	NHISQFPHQMFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNHLLQLVD
Ga0209671_10011076	3300027208	Marine Gutless Worms Symbiont	MFNVSALLLDDASKTAMPLTNGAINQTLRQFAPLSDDRLLQLADCRESSK
Ga0209671_10121386	3300027208	Marine Gutless Worms Symbiont	MFNVFALLLDDALKPVTPLTNGTINQTLRQFAPLNDNLLL
Ga0209671_10187491	3300027208	Marine Gutless Worms Symbiont	MSALPLDVALKPTTPLNNGAISETLRQFAAFSWSQNSL
Ga0209671_10276395	3300027208	Marine Gutless Worms Symbiont	MSALLLDDTSKMAMPLTNGTINQTLWQFAPLSDDHLLQLTVVNHQH
Ga0209671_10449034	3300027208	Marine Gutless Worms Symbiont	VSALLLDDASKAATPLTNGAINQALRHFAPLSDNGLF
Ga0209671_10573503	3300027208	Marine Gutless Worms Symbiont	MFSLSALLLDDALKLMTPLTNSAINQTLRQFAPLSAPELS
Ga0209671_10672611	3300027208	Marine Gutless Worms Symbiont	MFNAFALLLDDASKIATLLTNGAINQTLRQFAPLSDSRLLQLVDCRESSTVID
Ga0209671_10785811	3300027208	Marine Gutless Worms Symbiont	MFNVSALLLDDAPKPATPLTNGAISQTLWQFAPLSDNYLLQLVD
Ga0209671_10882921	3300027208	Marine Gutless Worms Symbiont	MFNVSGLLLDDTPKPATPLTNSAINQTLGQFVSLSDCDNRLLQLVD
Ga0209671_10997821	3300027208	Marine Gutless Worms Symbiont	FNVSALLLDDASKPATPLTNGAINQTLRHFAPLSDNGFL
Ga0209787_10025852	3300027289	Marine Gutless Worms Symbiont	MQYLHLMFNVSTLLLDDALKPATPLTNGAINKTLRLFAPLNDDRLL
Ga0209787_10212191	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFIVSALLLDDALKLATPLTNGAINETLRQFVPLNDDRLL
Ga0209787_10232141	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDRLKPATPLNNGAINETLRQFAPLNDDRLL
Ga0209787_10521501	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDTALKPATPLTNGAINETLRQFAQLGDDRLL
Ga0209787_10744691	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVFDLLLDDALKPAMPLTSGAINETLXQFDPLNDDRLL
Ga0209787_10886481	3300027289	Marine Gutless Worms Symbiont	CHIMQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL
Ga0209787_10965882	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGAISETLRQFATLNDDRLL
Ga0209787_11041981	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSTLLLDDTLKSAIPLTNGAINETLRQFAQI
Ga0209787_11121411	3300027289	Marine Gutless Worms Symbiont	MQQMFNVSTMLLDDAIKPTTPLTNGAIDETLRQFAALNDDRLN
Ga0209787_11290532	3300027289	Marine Gutless Worms Symbiont	MQFLHKMFNVSALLLDDALKPATALTNGTINETLRQFAPLNDDRLL
Ga0209787_11354202	3300027289	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLQQFSPLNDDRLL
Ga0209787_11362233	3300027289	Marine Gutless Worms Symbiont	MQILRQMFNVSALLLDDALKPATPLTNGAINETLRQFVPLNDDRLL
Ga0209787_11369281	3300027289	Marine Gutless Worms Symbiont	VQFLRQMFNVSALLLDDALKPATPLTNGVISETLRQFTPLNDDRLL
Ga0209787_11525921	3300027289	Marine Gutless Worms Symbiont	SALPLDDALKPAMPQTNGAINETLRQFDPPNDDRLL
Ga0209787_11635561	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLGDSLKPATPLINGAINETLRQFAPLNDDRLL
Ga0209787_12198701	3300027289	Marine Gutless Worms Symbiont	MQFLNLMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209787_12345511	3300027289	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATPLTNGYNNETLRQFAPLNDDRLL
Ga0209787_12721501	3300027289	Marine Gutless Worms Symbiont	MQFSHQMFNVSALLLDDALKPATPQTNGAINDTLRQFVPLNDDRLL
Ga0209569_11904101	3300027331	Marine Gutless Worms Symbiont	VFNVSAFVLNDALKPATPLTNGAINETLRQLLGHPVY
Ga0209366_10045193	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDDTFNPATPLTNGVISEALQQLATLSDISQ
Ga0209366_10101153	3300027347	Marine Gutless Worms Symbiont	MFNLSALLLDSAFKLVTPLTNGVISEILQQFAPLSD
Ga0209366_10265512	3300027347	Marine Gutless Worms Symbiont	MFNMSALLLDDALKPAMPLTNGVINETLRQFASLSDTQ
Ga0209366_10637601	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDNALEPETPLTSGVINETLRQFAPASN
Ga0209366_10776902	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDYAFKPATPLTNRGVINETLQQFTPLSDISQG
Ga0209366_11001251	3300027347	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPATPLTNGIINEMLQQFAPLSDIHKVV
Ga0209366_11236881	3300027347	Marine Gutless Worms Symbiont	VFSVLHQMFNVSALLLDDALKPATPLTNETLQQFSPLSDILQ
Ga0209366_11339921	3300027347	Marine Gutless Worms Symbiont	MSNVSTLLLDDEFKPATSLTNGVISETLRQFVPLSDSSQGS
Ga0209366_11441171	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDDAFKPATPLTNGVINETLLQFAATQ
Ga0209366_11485561	3300027347	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPAMPLSNGAINEMLRQFAQLS
Ga0209366_12006421	3300027347	Marine Gutless Worms Symbiont	MFNVSTLLLDDAFKPATPLTNGVISETLRQFASLSDILQG
Ga0209363_10044338	3300027377	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPMTNGAINEMLRQFAPLSDDRLLLIVVNR
Ga0209680_10039714	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_10077335	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPATALTNGTINETLRQFAPLNDDRLL
Ga0209680_10088264	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLNDDRLL
Ga0209680_10088862	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPQTNGAINDTLRQFVPLNDDRLL
Ga0209680_10237883	3300027392	Marine Gutless Worms Symbiont	IMQFLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_10273703	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGMINETLRQFAPFNDDRLL
Ga0209680_10302542	3300027392	Marine Gutless Worms Symbiont	MFNVSALLPDDALKPATPLTNDAINETLRQFAPFNDDRLL
Ga0209680_10599682	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPMTNGAINEMLRQFAPLNDDRLLL
Ga0209680_10773441	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAISETLEQFAPNQXRSPAL
Ga0209680_11315671	3300027392	Marine Gutless Worms Symbiont	MQFLHQMVNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_11421101	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLEDALKPATPLTNVAINETLRQFAPLSDDRLL
Ga0209680_11452001	3300027392	Marine Gutless Worms Symbiont	MQFSNLMFNMSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLLAG
Ga0209680_11799182	3300027392	Marine Gutless Worms Symbiont	MQFLGLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLNDDRLL
Ga0209680_11866302	3300027392	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDVKIA
Ga0209680_11996301	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEHALKPATPLTNGAISETLRQFAPLNHLL
Ga0209680_12096701	3300027392	Marine Gutless Worms Symbiont	MQLLHQMFNVSALLLDDALKPATPLTNGAINETLRQFAPLSDDRLLKAGRLS
Ga0209680_12374811	3300027392	Marine Gutless Worms Symbiont	MLHQMFNVSALLLDDALKPATPLTNGAINETLRQFASLND
Ga0209680_12779011	3300027392	Marine Gutless Worms Symbiont	MQFLHQMFNVSALLLEDVVKLATPLTNGNETLRQFALLNNDRLL
Ga0209782_10063491	3300027398	Marine Gutless Worms Symbiont	MFNLSALLLDSAFKLVTPLTNGVISEILQQFAPLSDIHKVWWDL
Ga0209782_10083672	3300027398	Marine Gutless Worms Symbiont	MFIVSTLLLDDAFKPATPLTNGVINVTLQQFAPLSVSK
Ga0209782_10089642	3300027398	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTNGMISETLRKFASLSDISQGNTLEVWWDH
Ga0209782_10108621	3300027398	Marine Gutless Worms Symbiont	VSTLLLDDAFKPVTPLTNGAMSETLRQFAPLSDISQGS
Ga0209782_10143943	3300027398	Marine Gutless Worms Symbiont	MFNAFALLLDDAFKPATPLTNGVINETLRQFASLNNISKGSVV
Ga0209049_11096341	3300027404	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRLFTRWY
Ga0209562_10011638	3300027519	Marine Gutless Worms Symbiont	MQFLHQMFNMSALLLDDALKPATPLTNSAINETLRQFALPLSDDTLEVWWDLL
Ga0209562_10035944	3300027519	Marine Gutless Worms Symbiont	MFNLSALLLDDALKPATPLTNGAINETLRQFAPLSDDTLEMWWDL
Ga0209562_10044242	3300027519	Marine Gutless Worms Symbiont	MQFLHLMFNASALLRDDQLKPVTPLTNGAIDETLQQFAALSDDCLL
Ga0209562_10119833	3300027519	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAISETLQQFALLSDDTQDLF
Ga0209562_10145242	3300027519	Marine Gutless Worms Symbiont	LSQLLSKVTVILQFLHQMFNVSALLLDDALKPVTPLTNGAINESLRQFAPLSDDTLEARWAL
Ga0209562_10274263	3300027519	Marine Gutless Worms Symbiont	MFNVSALLLDDALKLATPLANVAINETLQQFAPLSDDTLEVWWDL
Ga0209562_10287291	3300027519	Marine Gutless Worms Symbiont	MFSVSALLLDDALKPATPLTNGAINETLRQFAPLSDDTLEV
Ga0209562_10299415	3300027519	Marine Gutless Worms Symbiont	MFNMPALLREDPLKPATPLTNDAINETLRQFAPLSDDTLEVWWYL
Ga0209562_10325312	3300027519	Marine Gutless Worms Symbiont	MFNVSVLLLDDPLKPATPLTNGGISETLQQFAPLNDDTLEVWWDL
Ga0209562_10393101	3300027519	Marine Gutless Worms Symbiont	MLQFLHQMFDVSALLLDDALKPATPLTNGVINEMLPQFALLSENTLEV
Ga0209562_10423681	3300027519	Marine Gutless Worms Symbiont	MFNLFALLRDDPLKPATPLTNGAIDETLQQFAPLGD
Ga0209562_10465913	3300027519	Marine Gutless Worms Symbiont	MQFLHQMFSVSALLLDDALKPVTPLTNGAINETLRQFAPLSDDTLEVWWDL
Ga0209562_10490422	3300027519	Marine Gutless Worms Symbiont	MFNVPALLLDDTLKLATTLINGAINETLRQFAPLSDDTLEV
Ga0209562_10552721	3300027519	Marine Gutless Worms Symbiont	MFNMSTLLLDDALKPSTPLTNGAISEKLRQFAQLS
Ga0209562_10571272	3300027519	Marine Gutless Worms Symbiont	MFSVSTLLLDEALKPVTPLTNGAINETLREFAPLSDDTLEVWWNL
Ga0209562_10596342	3300027519	Marine Gutless Worms Symbiont	MLNVSVLLLDDTLKPATPLTNGTINETLRQFAPLSDDTLEVWWDLQ
Ga0209562_10613393	3300027519	Marine Gutless Worms Symbiont	MFYLSVSALLLDDALKPATPLTNGVFNETLRQFAPLSDDTREVWWDL
Ga0209562_10669062	3300027519	Marine Gutless Worms Symbiont	MFNASALLLDYALKPATPLTNGAINETLRQFAPLSDDTLEVWWNL
Ga0209562_10684811	3300027519	Marine Gutless Worms Symbiont	MFNLIALLQDDPLKPVTPLTNGTIDETLQQFASLSDDCLL
Ga0209562_10794712	3300027519	Marine Gutless Worms Symbiont	MFNVSTLLLDDALKPATPLTNGAINETLRQFAPLSHDTPEV
Ga0209562_10826583	3300027519	Marine Gutless Worms Symbiont	LLDDALKPATPLTNGAINETLRQFAPLSDDTLKVLRDL
Ga0209562_10894652	3300027519	Marine Gutless Worms Symbiont	MLHFLHLMFNLFALLRDDPLKPVTPLTNGTIDEMLQQFTALSDDCLLQLV
Ga0209562_10944841	3300027519	Marine Gutless Worms Symbiont	MFNLFALLRDDPFKPATPLTNGTINETLQEFAPLSDNCLFQLVDCRE
Ga0209562_11119012	3300027519	Marine Gutless Worms Symbiont	MFNVSALLQDDALKPATPLTNGAINETQRQFAPLSDDTLEVW
Ga0209562_11401401	3300027519	Marine Gutless Worms Symbiont	MFNLFLLRDDLLKPATPLTNGAIDEMLQQFVPLSDDFPASAG
Ga0209562_12119611	3300027519	Marine Gutless Worms Symbiont	MLQFLHQMFNVSALLLDDALKPVTPLTNGAINETLRQFAPLSDDTLEVWWHP
Ga0209562_12328721	3300027519	Marine Gutless Worms Symbiont	FNVSALLLDDALKPATPLTNGAISETLRQFAPLSDNTFEV
Ga0209562_12477991	3300027519	Marine Gutless Worms Symbiont	MFNVSALLLDDAFKPATPVTNGVINETLRQFAPLSDDTLEVWWDL
Ga0209562_12564402	3300027519	Marine Gutless Worms Symbiont	MFNVPALLRDDPLKPAMPMTNGMINEKLRQFASLNDDRMLRSAG
Ga0209562_12590911	3300027519	Marine Gutless Worms Symbiont	MFNLFALRRDDPLKPVTLLTNGAIDETLQQFAPLSDDCHALAG
Ga0209562_12797521	3300027519	Marine Gutless Worms Symbiont	MFNLFALLRDDALKQATPLTNGAIDETLQWFAQLSD
Ga0209568_10125033	3300027544	Marine Gutless Worms Symbiont	MFNVFALLMDDALKPATPLTNGAINETLRQLAPLIDDHCVPGSV
Ga0209255_10008195	3300027550	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLINEMLRQFAPLSDYRLLQLVD
Ga0209255_10139411	3300027550	Marine Gutless Worms Symbiont	MLQFLHQMFNVSVLHALKPATPLTIGAINVTLRQFVPLSDDTLEMWWDL
Ga0209255_12163382	3300027550	Marine Gutless Worms Symbiont	MFNVSALLLDDAVKPATPLTNGAINEMLRQFAPLSDDRLLQLVD
Ga0209679_12537092	3300027557	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLRQFAPLIDDRLLQLVDCRESS
Ga0209364_11000351	3300027569	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFAPLSDDRLLQLVDCRE
Ga0209364_11313372	3300027569	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFVPLSDNRLLQLIDCRESF
Ga0209364_11882831	3300027569	Marine Gutless Worms Symbiont	MFNVSALPLDDALKPTTPLTNGAINETLRQFAPLSDDRLLQL
Ga0209781_11504993	3300027602	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAVNETLRQFAPLSDDRLLQL
Ga0209781_11531111	3300027602	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFSPLSNFI
Ga0209781_11664612	3300027602	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPTTPLTNGAINETLRQFSPISDDRLLQLVDCRE
Ga0209781_12423351	3300027602	Marine Gutless Worms Symbiont	MFMSALLLDDALKPTTPLTNGGINEMLRQFSPLSDVTIACFS
Ga0209259_10133463	3300027658	Marine Gutless Worms Symbiont	MFNVSALLLDDALKPATPLTNGAINETLGQFSPLRDDRLLQLVDCRES