NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F005931

Metagenome Family F005931

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F005931
Family Type Metagenome
Number of Sequences 386
Average Sequence Length 43 residues
Representative Sequence MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT
Number of Associated Samples 217
Number of Associated Scaffolds 386

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.71 %
% of genes near scaffold ends (potentially truncated) 22.54 %
% of genes from short scaffolds (< 2000 bps) 80.57 %
Associated GOLD sequencing projects 185
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.788 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(11.140 % of family members)
Environment Ontology (ENVO) Unclassified
(40.674 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(65.026 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.34%    β-sheet: 0.00%    Coil/Unstructured: 43.66%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 386 Family Scaffolds
PF00486Trans_reg_C 39.64
PF07690MFS_1 16.32
PF00557Peptidase_M24 2.85
PF13432TPR_16 2.33
PF13414TPR_11 1.55
PF01321Creatinase_N 1.30
PF00005ABC_tran 0.78
PF13181TPR_8 0.78
PF12833HTH_18 0.78
PF13620CarboxypepD_reg 0.52
PF00857Isochorismatase 0.52
PF07719TPR_2 0.52
PF00497SBP_bac_3 0.52
PF01464SLT 0.26
PF13347MFS_2 0.26
PF02687FtsX 0.26
PF01256Carb_kinase 0.26
PF13424TPR_12 0.26
PF136402OG-FeII_Oxy_3 0.26
PF12849PBP_like_2 0.26
PF10099RskA 0.26
PF02653BPD_transp_2 0.26
PF00528BPD_transp_1 0.26
PF00113Enolase_C 0.26
PF02954HTH_8 0.26
PF02371Transposase_20 0.26
PF07498Rho_N 0.26
PF01734Patatin 0.26
PF04365BrnT_toxin 0.26

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 386 Family Scaffolds
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 1.30
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.52
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.52
COG0063NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domainNucleotide transport and metabolism [F] 0.26
COG0148EnolaseCarbohydrate transport and metabolism [G] 0.26
COG0351Hydroxymethylpyrimidine/phosphomethylpyrimidine kinaseCoenzyme transport and metabolism [H] 0.26
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.26
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 0.26
COG3547TransposaseMobilome: prophages, transposons [X] 0.26
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.26
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.26


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.79 %
UnclassifiedrootN/A13.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01AZHS7All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c2366484All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium664Open in IMG/M
3300000531|CNBas_1000057All Organisms → cellular organisms → Bacteria2966Open in IMG/M
3300000532|CNAas_1000227All Organisms → cellular organisms → Bacteria5269Open in IMG/M
3300000787|JGI11643J11755_11465783All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium530Open in IMG/M
3300000891|JGI10214J12806_12556033All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium569Open in IMG/M
3300000956|JGI10216J12902_101491138All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M
3300000956|JGI10216J12902_101668591All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300000956|JGI10216J12902_108564958All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2051Open in IMG/M
3300000956|JGI10216J12902_114924550Not Available734Open in IMG/M
3300001116|JGI12627J13344_102669All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1179Open in IMG/M
3300001464|JGI12363J15224_100189All Organisms → cellular organisms → Bacteria13600Open in IMG/M
3300003203|JGI25406J46586_10023741All Organisms → cellular organisms → Bacteria2419Open in IMG/M
3300003203|JGI25406J46586_10217641All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium558Open in IMG/M
3300003267|soilL1_10008190All Organisms → cellular organisms → Bacteria14079Open in IMG/M
3300003267|soilL1_10038977All Organisms → cellular organisms → Bacteria2626Open in IMG/M
3300003319|soilL2_10097603All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300003320|rootH2_10314449All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300003321|soilH1_10005660All Organisms → cellular organisms → Bacteria4018Open in IMG/M
3300003999|Ga0055469_10003187All Organisms → cellular organisms → Bacteria2690Open in IMG/M
3300004016|Ga0058689_10125323All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium569Open in IMG/M
3300004081|Ga0063454_101133775Not Available641Open in IMG/M
3300004114|Ga0062593_100249621All Organisms → cellular organisms → Bacteria → Acidobacteria1465Open in IMG/M
3300004114|Ga0062593_100317086All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300004114|Ga0062593_101152333All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300004114|Ga0062593_101712802All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium687Open in IMG/M
3300004114|Ga0062593_101975639All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium647Open in IMG/M
3300004156|Ga0062589_100127038All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300004156|Ga0062589_100927770All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300004156|Ga0062589_101897129All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium601Open in IMG/M
3300004157|Ga0062590_101806034Not Available627Open in IMG/M
3300004479|Ga0062595_100328452All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300004479|Ga0062595_101307294All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300004479|Ga0062595_101741117All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium589Open in IMG/M
3300004479|Ga0062595_102092205Not Available550Open in IMG/M
3300004480|Ga0062592_101527986All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium642Open in IMG/M
3300004643|Ga0062591_100354069All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300004643|Ga0062591_100728719All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300004643|Ga0062591_101138782All Organisms → cellular organisms → Bacteria → Proteobacteria755Open in IMG/M
3300005093|Ga0062594_102017235Not Available617Open in IMG/M
3300005093|Ga0062594_102368599Not Available579Open in IMG/M
3300005184|Ga0066671_10020937All Organisms → cellular organisms → Bacteria → Acidobacteria2890Open in IMG/M
3300005238|Ga0073692_1040934Not Available758Open in IMG/M
3300005288|Ga0065714_10002276All Organisms → cellular organisms → Bacteria28876Open in IMG/M
3300005289|Ga0065704_10075325All Organisms → cellular organisms → Bacteria5644Open in IMG/M
3300005290|Ga0065712_10492327All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium655Open in IMG/M
3300005293|Ga0065715_10126145All Organisms → cellular organisms → Bacteria → Proteobacteria2115Open in IMG/M
3300005293|Ga0065715_10198114All Organisms → cellular organisms → Bacteria → Proteobacteria1376Open in IMG/M
3300005293|Ga0065715_10459588All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium817Open in IMG/M
3300005293|Ga0065715_10463669All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium813Open in IMG/M
3300005293|Ga0065715_10694444All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300005294|Ga0065705_10009779All Organisms → cellular organisms → Bacteria2747Open in IMG/M
3300005294|Ga0065705_11015623All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium543Open in IMG/M
3300005295|Ga0065707_10961925Not Available549Open in IMG/M
3300005331|Ga0070670_100000358All Organisms → cellular organisms → Bacteria38172Open in IMG/M
3300005331|Ga0070670_100016693All Organisms → cellular organisms → Bacteria6301Open in IMG/M
3300005331|Ga0070670_100308270All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300005331|Ga0070670_100896825All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300005331|Ga0070670_101845664All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium557Open in IMG/M
3300005332|Ga0066388_102459296All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300005332|Ga0066388_102834594All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300005334|Ga0068869_100403548All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300005334|Ga0068869_100824576All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300005336|Ga0070680_101586359Not Available567Open in IMG/M
3300005337|Ga0070682_100003227All Organisms → cellular organisms → Bacteria → Proteobacteria9042Open in IMG/M
3300005337|Ga0070682_100261900All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300005338|Ga0068868_101134026All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300005338|Ga0068868_101384408All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium656Open in IMG/M
3300005341|Ga0070691_10272636All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300005345|Ga0070692_10020046All Organisms → cellular organisms → Bacteria3236Open in IMG/M
3300005345|Ga0070692_10248879All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300005354|Ga0070675_100439174All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300005364|Ga0070673_100121973All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300005364|Ga0070673_100708610All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium925Open in IMG/M
3300005364|Ga0070673_100963780All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium793Open in IMG/M
3300005364|Ga0070673_101636774All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium609Open in IMG/M
3300005365|Ga0070688_101076332Not Available642Open in IMG/M
3300005406|Ga0070703_10531163Not Available534Open in IMG/M
3300005438|Ga0070701_10055428All Organisms → cellular organisms → Bacteria2071Open in IMG/M
3300005438|Ga0070701_10714102All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005440|Ga0070705_100092141All Organisms → cellular organisms → Bacteria1891Open in IMG/M
3300005440|Ga0070705_100363430All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300005440|Ga0070705_100385295All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300005440|Ga0070705_101642676Not Available542Open in IMG/M
3300005441|Ga0070700_100093546All Organisms → cellular organisms → Bacteria1966Open in IMG/M
3300005441|Ga0070700_100344998All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300005441|Ga0070700_101966593Not Available507Open in IMG/M
3300005441|Ga0070700_101971606Not Available506Open in IMG/M
3300005444|Ga0070694_100328751All Organisms → cellular organisms → Bacteria → Proteobacteria1178Open in IMG/M
3300005444|Ga0070694_100644537All Organisms → cellular organisms → Bacteria → Proteobacteria857Open in IMG/M
3300005444|Ga0070694_101560680Not Available560Open in IMG/M
3300005458|Ga0070681_10052420All Organisms → cellular organisms → Bacteria4068Open in IMG/M
3300005458|Ga0070681_10338122All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300005458|Ga0070681_10710970All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300005458|Ga0070681_10795495All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium863Open in IMG/M
3300005459|Ga0068867_100034816All Organisms → cellular organisms → Bacteria3651Open in IMG/M
3300005466|Ga0070685_10907340All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium656Open in IMG/M
3300005467|Ga0070706_100000044All Organisms → cellular organisms → Bacteria146303Open in IMG/M
3300005468|Ga0070707_100020631All Organisms → cellular organisms → Bacteria6218Open in IMG/M
3300005468|Ga0070707_100888201All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300005471|Ga0070698_100074685All Organisms → cellular organisms → Bacteria3395Open in IMG/M
3300005530|Ga0070679_101156972All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300005536|Ga0070697_101089601All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005539|Ga0068853_100521294All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300005545|Ga0070695_100478614All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300005545|Ga0070695_101007267All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005545|Ga0070695_101235012All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005545|Ga0070695_101475257All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005545|Ga0070695_101518603Not Available558Open in IMG/M
3300005545|Ga0070695_101720519All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium525Open in IMG/M
3300005546|Ga0070696_100464663All Organisms → cellular organisms → Bacteria → Proteobacteria1001Open in IMG/M
3300005546|Ga0070696_101922741Not Available513Open in IMG/M
3300005546|Ga0070696_101963208Not Available508Open in IMG/M
3300005547|Ga0070693_100075373All Organisms → cellular organisms → Bacteria → Proteobacteria1997Open in IMG/M
3300005547|Ga0070693_100704469Not Available740Open in IMG/M
3300005549|Ga0070704_100108500All Organisms → cellular organisms → Bacteria2108Open in IMG/M
3300005549|Ga0070704_101748666Not Available575Open in IMG/M
3300005563|Ga0068855_100113506All Organisms → cellular organisms → Bacteria3108Open in IMG/M
3300005564|Ga0070664_101533425All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium631Open in IMG/M
3300005566|Ga0066693_10374331Not Available576Open in IMG/M
3300005577|Ga0068857_100196609All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300005577|Ga0068857_100472321All Organisms → cellular organisms → Bacteria → Acidobacteria1175Open in IMG/M
3300005577|Ga0068857_100629560All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300005577|Ga0068857_101495224All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium658Open in IMG/M
3300005577|Ga0068857_101567471All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005578|Ga0068854_100137339All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300005615|Ga0070702_101286733Not Available593Open in IMG/M
3300005615|Ga0070702_101880625All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium501Open in IMG/M
3300005617|Ga0068859_100261270All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300005617|Ga0068859_102219810All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium606Open in IMG/M
3300005618|Ga0068864_100147188All Organisms → cellular organisms → Bacteria2130Open in IMG/M
3300005618|Ga0068864_101355055All Organisms → cellular organisms → Bacteria → Proteobacteria713Open in IMG/M
3300005618|Ga0068864_101659860All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium643Open in IMG/M
3300005618|Ga0068864_101711927All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005618|Ga0068864_102639883Not Available508Open in IMG/M
3300005719|Ga0068861_100527217All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300005841|Ga0068863_100468494All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300005841|Ga0068863_101683913All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300005842|Ga0068858_100429802All Organisms → cellular organisms → Bacteria → Acidobacteria1271Open in IMG/M
3300005843|Ga0068860_101325730Not Available741Open in IMG/M
3300005844|Ga0068862_101512819All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005873|Ga0075287_1025304Not Available755Open in IMG/M
3300005878|Ga0075297_1010101All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium906Open in IMG/M
3300005884|Ga0075291_1009298All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300005985|Ga0081539_10122522All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300006049|Ga0075417_10164484All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300006169|Ga0082029_1183833All Organisms → cellular organisms → Bacteria1334Open in IMG/M
3300006169|Ga0082029_1418406All Organisms → cellular organisms → Bacteria2463Open in IMG/M
3300006169|Ga0082029_1466184All Organisms → cellular organisms → Bacteria50214Open in IMG/M
3300006169|Ga0082029_1620731All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300006173|Ga0070716_100817121Not Available723Open in IMG/M
3300006237|Ga0097621_100009220All Organisms → cellular organisms → Bacteria7157Open in IMG/M
3300006237|Ga0097621_101137250All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300006358|Ga0068871_101318590All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300006755|Ga0079222_10007832All Organisms → cellular organisms → Bacteria3708Open in IMG/M
3300006755|Ga0079222_10445553All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300006755|Ga0079222_10483748All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium899Open in IMG/M
3300006755|Ga0079222_11136271All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300006755|Ga0079222_11640844All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium612Open in IMG/M
3300006806|Ga0079220_10518331Not Available821Open in IMG/M
3300006806|Ga0079220_10594446All Organisms → cellular organisms → Bacteria → Proteobacteria785Open in IMG/M
3300006806|Ga0079220_11475091All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300006845|Ga0075421_100088846All Organisms → cellular organisms → Bacteria3894Open in IMG/M
3300006845|Ga0075421_102069229All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300006846|Ga0075430_100675483All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300006846|Ga0075430_100676617All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300006847|Ga0075431_100276286All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300006847|Ga0075431_101782266All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium572Open in IMG/M
3300006847|Ga0075431_102101401Not Available519Open in IMG/M
3300006852|Ga0075433_10017457All Organisms → cellular organisms → Bacteria5944Open in IMG/M
3300006852|Ga0075433_10093988All Organisms → cellular organisms → Bacteria2653Open in IMG/M
3300006852|Ga0075433_10136749All Organisms → cellular organisms → Bacteria2178Open in IMG/M
3300006852|Ga0075433_11636741Not Available555Open in IMG/M
3300006854|Ga0075425_100102105All Organisms → cellular organisms → Bacteria3261Open in IMG/M
3300006854|Ga0075425_101648486All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300006876|Ga0079217_10011204All Organisms → cellular organisms → Bacteria2892Open in IMG/M
3300006876|Ga0079217_11160581All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300006894|Ga0079215_10073383All Organisms → cellular organisms → Bacteria1417Open in IMG/M
3300006903|Ga0075426_10054160All Organisms → cellular organisms → Bacteria2866Open in IMG/M
3300006904|Ga0075424_100297677Not Available1717Open in IMG/M
3300006904|Ga0075424_101295982All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300006918|Ga0079216_10222506All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300006954|Ga0079219_10030298All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2130Open in IMG/M
3300006954|Ga0079219_10064948All Organisms → cellular organisms → Bacteria → Proteobacteria1642Open in IMG/M
3300006954|Ga0079219_10407768All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300007004|Ga0079218_10666160All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300007004|Ga0079218_11730272All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300009101|Ga0105247_10961735All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium664Open in IMG/M
3300009101|Ga0105247_11445518Not Available558Open in IMG/M
3300009147|Ga0114129_12547554All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium611Open in IMG/M
3300009148|Ga0105243_12153761All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium594Open in IMG/M
3300009162|Ga0075423_10015140All Organisms → cellular organisms → Bacteria7543Open in IMG/M
3300009174|Ga0105241_10708508All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300009174|Ga0105241_11376208All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium675Open in IMG/M
3300009176|Ga0105242_11181367All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium783Open in IMG/M
3300009545|Ga0105237_10104512All Organisms → cellular organisms → Bacteria2824Open in IMG/M
3300009545|Ga0105237_11623759All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium653Open in IMG/M
3300009551|Ga0105238_12775800All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium526Open in IMG/M
3300009553|Ga0105249_10125838All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2440Open in IMG/M
3300009789|Ga0126307_10706288All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium813Open in IMG/M
3300009789|Ga0126307_11130331All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300009792|Ga0126374_10368569All Organisms → cellular organisms → Bacteria → Acidobacteria992Open in IMG/M
3300010036|Ga0126305_10553491All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium770Open in IMG/M
3300010036|Ga0126305_10883100All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium610Open in IMG/M
3300010036|Ga0126305_10905674All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium602Open in IMG/M
3300010040|Ga0126308_10897880All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium617Open in IMG/M
3300010044|Ga0126310_10839057All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium710Open in IMG/M
3300010046|Ga0126384_10136543Not Available1869Open in IMG/M
3300010166|Ga0126306_11752575All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium519Open in IMG/M
3300010358|Ga0126370_10772472All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium853Open in IMG/M
3300010359|Ga0126376_11035008All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium824Open in IMG/M
3300010360|Ga0126372_11521082All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium706Open in IMG/M
3300010375|Ga0105239_10960030All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300010375|Ga0105239_12578626All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium593Open in IMG/M
3300010396|Ga0134126_10896791All Organisms → cellular organisms → Bacteria → Acidobacteria997Open in IMG/M
3300010399|Ga0134127_10265911All Organisms → cellular organisms → Bacteria → Acidobacteria1633Open in IMG/M
3300010399|Ga0134127_11621687All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium721Open in IMG/M
3300010401|Ga0134121_10864459All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300011993|Ga0120182_1009701All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium700Open in IMG/M
3300012899|Ga0157299_10087666All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium781Open in IMG/M
3300012955|Ga0164298_10598127All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300012957|Ga0164303_10674387All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300012960|Ga0164301_10937841All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012986|Ga0164304_11634314All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium538Open in IMG/M
3300013100|Ga0157373_11061346All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium606Open in IMG/M
3300013100|Ga0157373_11242000All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium563Open in IMG/M
3300013306|Ga0163162_10489576All Organisms → cellular organisms → Bacteria → Acidobacteria1361Open in IMG/M
3300013307|Ga0157372_10142747All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2760Open in IMG/M
3300013308|Ga0157375_10184842All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2237Open in IMG/M
3300014745|Ga0157377_11521922Not Available533Open in IMG/M
3300014965|Ga0120193_10044825All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium619Open in IMG/M
3300015261|Ga0182006_1323640All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium507Open in IMG/M
3300017792|Ga0163161_10942132All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300018422|Ga0190265_10020228All Organisms → cellular organisms → Bacteria5301Open in IMG/M
3300018422|Ga0190265_10185002All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300018422|Ga0190265_11509085All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium785Open in IMG/M
3300018422|Ga0190265_13593184Not Available517Open in IMG/M
3300018429|Ga0190272_11004534All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium797Open in IMG/M
3300018432|Ga0190275_10317957All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300018466|Ga0190268_10187971All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300018466|Ga0190268_10359183All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300018466|Ga0190268_10622954All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium771Open in IMG/M
3300018466|Ga0190268_10978842All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium670Open in IMG/M
3300018466|Ga0190268_11605003All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300018469|Ga0190270_13343661All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium509Open in IMG/M
3300018476|Ga0190274_10903369All Organisms → cellular organisms → Bacteria950Open in IMG/M
3300018476|Ga0190274_11739267All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium718Open in IMG/M
3300019360|Ga0187894_10001309All Organisms → cellular organisms → Bacteria32175Open in IMG/M
3300019361|Ga0173482_10735873All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium515Open in IMG/M
3300019377|Ga0190264_10216093All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300020146|Ga0196977_1000225All Organisms → cellular organisms → Bacteria34201Open in IMG/M
3300021412|Ga0193736_1012159All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300021445|Ga0182009_10002494All Organisms → cellular organisms → Bacteria5227Open in IMG/M
3300021445|Ga0182009_10025484All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2303Open in IMG/M
3300021445|Ga0182009_10085801All Organisms → cellular organisms → Bacteria → Acidobacteria1410Open in IMG/M
3300021445|Ga0182009_10122619All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300021445|Ga0182009_10375030All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300021445|Ga0182009_10475663All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300021445|Ga0182009_10775592All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium523Open in IMG/M
3300021445|Ga0182009_10823522Not Available509Open in IMG/M
3300024179|Ga0247695_1007941All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300025315|Ga0207697_10504714Not Available534Open in IMG/M
3300025321|Ga0207656_10017194All Organisms → cellular organisms → Bacteria2829Open in IMG/M
3300025885|Ga0207653_10142202All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300025899|Ga0207642_10058338All Organisms → cellular organisms → Bacteria1780Open in IMG/M
3300025900|Ga0207710_10001732All Organisms → cellular organisms → Bacteria10548Open in IMG/M
3300025900|Ga0207710_10045804All Organisms → cellular organisms → Bacteria1951Open in IMG/M
3300025900|Ga0207710_10255608All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300025901|Ga0207688_10165398All Organisms → cellular organisms → Bacteria → Acidobacteria1313Open in IMG/M
3300025904|Ga0207647_10006661All Organisms → cellular organisms → Bacteria8395Open in IMG/M
3300025908|Ga0207643_10021579All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium3539Open in IMG/M
3300025908|Ga0207643_10165757All Organisms → cellular organisms → Bacteria → Acidobacteria1331Open in IMG/M
3300025908|Ga0207643_10987934Not Available545Open in IMG/M
3300025910|Ga0207684_10000117All Organisms → cellular organisms → Bacteria → Acidobacteria148207Open in IMG/M
3300025911|Ga0207654_10114005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_2351686Open in IMG/M
3300025911|Ga0207654_10118578All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300025911|Ga0207654_10127599All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300025911|Ga0207654_10298105All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300025911|Ga0207654_10348312All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1019Open in IMG/M
3300025911|Ga0207654_10708451All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300025911|Ga0207654_11058447All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium591Open in IMG/M
3300025911|Ga0207654_11222386Not Available548Open in IMG/M
3300025912|Ga0207707_10747908All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium818Open in IMG/M
3300025912|Ga0207707_10900955All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300025918|Ga0207662_10028283All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300025918|Ga0207662_10493142All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300025920|Ga0207649_10519346All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium908Open in IMG/M
3300025921|Ga0207652_11637585All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300025923|Ga0207681_10074101All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300025924|Ga0207694_10017552All Organisms → cellular organisms → Bacteria5410Open in IMG/M
3300025924|Ga0207694_11161153All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium653Open in IMG/M
3300025925|Ga0207650_10000028All Organisms → cellular organisms → Bacteria → Acidobacteria236867Open in IMG/M
3300025925|Ga0207650_10769410All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium815Open in IMG/M
3300025925|Ga0207650_11461500Not Available581Open in IMG/M
3300025930|Ga0207701_10785899All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300025932|Ga0207690_10761068All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300025933|Ga0207706_10449780All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1114Open in IMG/M
3300025933|Ga0207706_10496739All Organisms → cellular organisms → Bacteria → Proteobacteria1053Open in IMG/M
3300025933|Ga0207706_11561066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi536Open in IMG/M
3300025935|Ga0207709_10030798All Organisms → cellular organisms → Bacteria3125Open in IMG/M
3300025935|Ga0207709_10599370All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium872Open in IMG/M
3300025935|Ga0207709_11252090Not Available612Open in IMG/M
3300025936|Ga0207670_10372160All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300025938|Ga0207704_11043286All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300025939|Ga0207665_10031787All Organisms → cellular organisms → Bacteria3493Open in IMG/M
3300025939|Ga0207665_11436396Not Available549Open in IMG/M
3300025940|Ga0207691_10499765All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300025940|Ga0207691_10510875All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300025941|Ga0207711_11553037All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium605Open in IMG/M
3300025942|Ga0207689_10122679All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300025942|Ga0207689_10141206All Organisms → cellular organisms → Bacteria1984Open in IMG/M
3300025942|Ga0207689_11004598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus antarcticus704Open in IMG/M
3300025942|Ga0207689_11218825All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium633Open in IMG/M
3300025942|Ga0207689_11415462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum582Open in IMG/M
3300025944|Ga0207661_11231878All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium688Open in IMG/M
3300025945|Ga0207679_11691894Not Available579Open in IMG/M
3300025949|Ga0207667_10134154All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300025960|Ga0207651_11307290All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium652Open in IMG/M
3300025961|Ga0207712_11131724Not Available697Open in IMG/M
3300025981|Ga0207640_10605423All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300025981|Ga0207640_10854302All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300026035|Ga0207703_10252910All Organisms → cellular organisms → Bacteria → Acidobacteria1589Open in IMG/M
3300026035|Ga0207703_11264751All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300026035|Ga0207703_12279426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium517Open in IMG/M
3300026041|Ga0207639_10951950All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium803Open in IMG/M
3300026067|Ga0207678_10810810All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium826Open in IMG/M
3300026075|Ga0207708_10088616All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300026088|Ga0207641_10256035All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300026088|Ga0207641_10940693All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium859Open in IMG/M
3300026088|Ga0207641_11581688All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300026088|Ga0207641_12030622All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300026095|Ga0207676_10229939All Organisms → cellular organisms → Bacteria1657Open in IMG/M
3300026095|Ga0207676_10323038All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1417Open in IMG/M
3300026095|Ga0207676_11635334Not Available642Open in IMG/M
3300026116|Ga0207674_10713085All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium968Open in IMG/M
3300026116|Ga0207674_10798419All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium911Open in IMG/M
3300026116|Ga0207674_10951464All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300026535|Ga0256867_10012048All Organisms → cellular organisms → Bacteria → Acidobacteria3777Open in IMG/M
3300027266|Ga0209215_1000035All Organisms → cellular organisms → Bacteria → Acidobacteria130044Open in IMG/M
3300027266|Ga0209215_1009166All Organisms → cellular organisms → Bacteria → Acidobacteria1189Open in IMG/M
3300027326|Ga0209731_1019446All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300027530|Ga0209216_1002951All Organisms → cellular organisms → Bacteria2714Open in IMG/M
3300027639|Ga0209387_1025508All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300027718|Ga0209795_10016225All Organisms → cellular organisms → Bacteria2762Open in IMG/M
3300027775|Ga0209177_10017659All Organisms → cellular organisms → Bacteria → Proteobacteria1717Open in IMG/M
3300027775|Ga0209177_10074840All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300027775|Ga0209177_10136980All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300027880|Ga0209481_10013655All Organisms → cellular organisms → Bacteria → Acidobacteria3530Open in IMG/M
3300027886|Ga0209486_10163395All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300027907|Ga0207428_10276989All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300027909|Ga0209382_10227313All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300027909|Ga0209382_10492991All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300028379|Ga0268266_12087711Not Available540Open in IMG/M
3300028381|Ga0268264_12094101Not Available574Open in IMG/M
3300028381|Ga0268264_12332556All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium542Open in IMG/M
3300028381|Ga0268264_12494614Not Available522Open in IMG/M
3300030499|Ga0268259_10112328All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300030511|Ga0268241_10016107All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300030511|Ga0268241_10066375All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium796Open in IMG/M
3300030511|Ga0268241_10174049Not Available536Open in IMG/M
3300031455|Ga0307505_10000089All Organisms → cellular organisms → Bacteria116210Open in IMG/M
3300031548|Ga0307408_100082167All Organisms → cellular organisms → Bacteria2411Open in IMG/M
3300031716|Ga0310813_10201045All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300031716|Ga0310813_10374416All Organisms → cellular organisms → Bacteria → Acidobacteria1219Open in IMG/M
3300031716|Ga0310813_10544033All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300031716|Ga0310813_10545910All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300031716|Ga0310813_10594194All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300031716|Ga0310813_10880140All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300031716|Ga0310813_11821175Not Available572Open in IMG/M
3300031716|Ga0310813_12252570All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium516Open in IMG/M
3300031716|Ga0310813_12293117All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium512Open in IMG/M
3300031740|Ga0307468_100226189All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300031740|Ga0307468_100342958All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300031740|Ga0307468_101706557All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300031852|Ga0307410_11726161All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium555Open in IMG/M
3300031854|Ga0310904_11114679All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300031901|Ga0307406_11272405All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium641Open in IMG/M
3300031903|Ga0307407_11589655Not Available519Open in IMG/M
3300031911|Ga0307412_10566002All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300031939|Ga0308174_10775363All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium804Open in IMG/M
3300031995|Ga0307409_101041471All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300031996|Ga0308176_12996555All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium500Open in IMG/M
3300032002|Ga0307416_101388662All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium808Open in IMG/M
3300032144|Ga0315910_10242620All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300033475|Ga0310811_11329334All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium567Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.22%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.40%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.11%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.33%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.07%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.30%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.30%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.30%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.30%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.04%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest1.04%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.04%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.52%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.52%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.52%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.26%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.26%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.26%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.26%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.26%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.26%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.26%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.26%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.26%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.26%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000531Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000532Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001116Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2EnvironmentalOpen in IMG/M
3300001464Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91EnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004016Agave microbial communities from Guanajuato, Mexico - As.Ma.rzHost-AssociatedOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005238Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005878Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104EnvironmentalOpen in IMG/M
3300005884Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302EnvironmentalOpen in IMG/M
3300005985Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011993Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014965Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2EnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300024179Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027266Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027326Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027530Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_017728602170459019Switchgrass, Maize And Mischanthus LitterMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGLGH
ICChiseqgaiiDRAFT_236648423300000033SoilMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA*
CNBas_100005723300000531Quercus RhizosphereMINQKRCSEFVETSLIYLLSAAVAVGAFVLVWLLSALLGLGQA*
CNAas_100022743300000532Quercus RhizosphereMINEKKTSDLIETSLIYLLSAGVAVGAFLLVWLIAHLLGLGQA*
JGI11643J11755_1146578323300000787SoilMLNEKKTSELIETSLIYLLSAAVAAGAFVLVGLVALLFGFSQT*
JGI10214J12806_1255603323300000891SoilMINEKKTSDLIETSLIYLLSAAVAVGAFLLVWLISHILGLGQA*
JGI10216J12902_10149113813300000956SoilMIEEKKTSELVETWLVYLLSVAVAAGAFLLVWFVSLLAGANRA
JGI10216J12902_10166859123300000956SoilMMNQKKSSELIETSLIYLLSAVVAAGGFFFVWLVSSLLCLARR*
JGI10216J12902_10856495823300000956SoilMINEKKSSDLFETWAIYLLSAAVAAGAFLLVWFISLLASPGAT*
JGI10216J12902_11492455023300000956SoilMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGRGPA*
JGI12627J13344_10266933300001116Forest SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSTFLGLGQT*
JGI12363J15224_10018963300001464SoilMINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPA*
JGI25406J46586_1002374113300003203Tabebuia Heterophylla RhizosphereMINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT*
JGI25406J46586_1021764123300003203Tabebuia Heterophylla RhizosphereMIDNKKCSDLVETWLIYLLSAAVAVGAFLLVWLISLMTGIGPA*
soilL1_10008190133300003267Sugarcane Root And Bulk SoilMINQKKNSELIETSLIYLLSAAVAVGAFVLVWLISMLLGSSQT*
soilL1_1003897733300003267Sugarcane Root And Bulk SoilMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLLSTLAGIGWA*
soilL2_1009760323300003319Sugarcane Root And Bulk SoilMIDHKKSSELLETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
rootH2_1031444923300003320Sugarcane Root And Bulk SoilMINQKKNSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
soilH1_1000566033300003321Sugarcane Root And Bulk SoilILKVKDLPMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISTLTGRGWA*
Ga0055469_1000318743300003999Natural And Restored WetlandsMMNQKKSSELLEASLIYLLSTVVAAGGFFFVWLISSLLCLGCR*
Ga0058689_1012532323300004016AgaveMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSQT*
Ga0063454_10113377523300004081SoilMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA*
Ga0062593_10024962113300004114SoilMINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGSG
Ga0062593_10031708623300004114SoilMTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA*
Ga0062593_10115233323300004114SoilMIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLISALAVPQWS*
Ga0062593_10171280213300004114SoilMIDNKKYSDLVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA*
Ga0062593_10197563923300004114SoilMINEKKNSEFVETSLIYLLSAAVAVGAFVLVYLISLLLGMGQA*
Ga0062589_10012703823300004156SoilMINSKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSLLLGFGQA*
Ga0062589_10092777023300004156SoilMIDGKKTSEFVETSLVYLLSAAVAVGAFLLVGLIFLVAGLARS*
Ga0062589_10189712913300004156SoilMINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGSGWS*
Ga0062590_10180603413300004157SoilMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT*
Ga0062595_10032845223300004479SoilMINEKKNSEVIETSLIYLLSAAVAVGAFILVWLISLLLGSGRA*
Ga0062595_10130729423300004479SoilMIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGLSQG*
Ga0062595_10174111723300004479SoilMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGFGHA*
Ga0062595_10209220523300004479SoilMIDEKKSSELLETSLIYLLSAAVAVGAFVLVWLISLLLGFGQA*
Ga0062592_10152798623300004480SoilMINQKKTSELIETSLVYLLSTAVALGAFVLVWLVSLLLGSSPT*
Ga0062591_10035406913300004643SoilMINEKKNSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA*
Ga0062591_10072871913300004643SoilKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHT*
Ga0062591_10113878223300004643SoilMIDEKKTSEVVETWLVYLLSAAVAVGAFLLVFVISLLASVNGA*
Ga0062594_10201723523300005093SoilMINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGPGRS*
Ga0062594_10236859913300005093SoilMALKVKDLPMINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT*
Ga0066671_1002093723300005184SoilMINDKKTSELIETSLIYLLSAAVAAAAFVLVWLISSLLGFGRA*
Ga0073692_104093423300005238SoilMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT*
Ga0065714_10002276203300005288Miscanthus RhizosphereMINEKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGFGQA*
Ga0065704_1007532533300005289Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFFGLSHA*
Ga0065712_1049232723300005290Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLNFGRA*
Ga0065715_1012614523300005293Miscanthus RhizosphereMIDQKKTSELIETSFIYLLSAAVAVGAFVLVWLISLFLGFSQT*
Ga0065715_1019811423300005293Miscanthus RhizosphereMINHKKSSEFLETSLIYLLSTAVAVGAFVLVWLISLLLGPSQT*
Ga0065715_1045958823300005293Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLARA*
Ga0065715_1046366923300005293Miscanthus RhizosphereMINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGS
Ga0065715_1069444423300005293Miscanthus RhizosphereMTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA*
Ga0065705_1000977923300005294Switchgrass RhizosphereMTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLARA*
Ga0065705_1101562323300005294Switchgrass RhizosphereMINGKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA*
Ga0065707_1096192513300005295Switchgrass RhizosphereTEKKRNLPMIDQKKTSELIETSLIYLLSAAVAVGAFVLVWLISMLLGPSQT*
Ga0070670_10000035883300005331Switchgrass RhizosphereMINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPT*
Ga0070670_10001669333300005331Switchgrass RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLVSSQT*
Ga0070670_10030827023300005331Switchgrass RhizosphereMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA*
Ga0070670_10089682513300005331Switchgrass RhizosphereMINQKKTSELIETSLIYLLSTAVALGAFVLVWLVSLLLGSSPT*
Ga0070670_10184566413300005331Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLSF
Ga0066388_10245929623300005332Tropical Forest SoilMINGKKDSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA*
Ga0066388_10283459423300005332Tropical Forest SoilMISEKKSSDLFETWVIYLLSAAVAVGAFLLVWLISLLANPALT*
Ga0068869_10040354823300005334Miscanthus RhizosphereMINQKKTSEFIETSLVYLLSAVVAVGAFVLVWLVSLLLGPSPM*
Ga0068869_10082457613300005334Miscanthus RhizosphereMFNQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHS*
Ga0070680_10158635913300005336Corn RhizosphereMINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAT*
Ga0070682_10000322723300005337Corn RhizosphereMIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGFSQG*
Ga0070682_10026190023300005337Corn RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVFGLGHA*
Ga0068868_10113402623300005338Miscanthus RhizosphereTEVAQRKPRNLPMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT*
Ga0068868_10138440813300005338Miscanthus RhizosphereMIDNKKSSELVETWLVYLLSAAVAIGAFLLVWLISTLTGIGWA*
Ga0070691_1027263623300005341Corn, Switchgrass And Miscanthus RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLFGSSPT*
Ga0070692_1002004623300005345Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVFGLARA*
Ga0070692_1024887923300005345Corn, Switchgrass And Miscanthus RhizosphereMINKKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT*
Ga0070675_10043917423300005354Miscanthus RhizosphereMINSKKTSELIETSVVYLLSAAVAVGAFILVWLISLFLGFGH*
Ga0070673_10012197323300005364Switchgrass RhizosphereMINGKKNSEFIETSLIYLLSAAVALGAFALVWLISLLLGSGRA*
Ga0070673_10070861013300005364Switchgrass RhizosphereMINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT*
Ga0070673_10096378023300005364Switchgrass RhizosphereMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGQA*
Ga0070673_10163677413300005364Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLSFGRA*
Ga0070688_10107633213300005365Switchgrass RhizosphereMINEKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA*
Ga0070703_1053116313300005406Corn, Switchgrass And Miscanthus RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSPT*
Ga0070701_1005542813300005438Corn, Switchgrass And Miscanthus RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHA*
Ga0070701_1071410213300005438Corn, Switchgrass And Miscanthus RhizosphereRNLPMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLFGSSPT*
Ga0070705_10009214123300005440Corn, Switchgrass And Miscanthus RhizosphereMIDEKKNSEVIETSLIYLLSAAVAVGAFILVWLISLLLGSGRA*
Ga0070705_10036343013300005440Corn, Switchgrass And Miscanthus RhizosphereTRRNLPMTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA*
Ga0070705_10038529523300005440Corn, Switchgrass And Miscanthus RhizosphereMIDNKKSAELVETWLIYLLSAAVAIGAFLLVWFISTLTGIGWA*
Ga0070705_10164267613300005440Corn, Switchgrass And Miscanthus RhizosphereMINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT*
Ga0070700_10009354623300005441Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLGHA*
Ga0070700_10034499823300005441Corn, Switchgrass And Miscanthus RhizosphereRNLPMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHA*
Ga0070700_10196659323300005441Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFMLVWLISLFLSFGRA*
Ga0070700_10197160623300005441Corn, Switchgrass And Miscanthus RhizosphereMIDSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGVGQA*
Ga0070694_10032875123300005444Corn, Switchgrass And Miscanthus RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0070694_10064453723300005444Corn, Switchgrass And Miscanthus RhizosphereMINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA*
Ga0070694_10156068013300005444Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFFLGFGRA*
Ga0070681_1005242043300005458Corn RhizosphereMINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA*
Ga0070681_1033812223300005458Corn RhizosphereMIDNKKSSELVETWLIYLLSAAVAIGAFLLAWLISTLTGIGWA*
Ga0070681_1071097013300005458Corn RhizosphereMINEKKSSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA*
Ga0070681_1079549523300005458Corn RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0068867_10003481623300005459Miscanthus RhizosphereMINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT*
Ga0070685_1090734023300005466Switchgrass RhizosphereMINQKKTSEFVETSLIYLLSAAVAVAAFVLVWLVSLLLGPSQT*
Ga0070706_100000044123300005467Corn, Switchgrass And Miscanthus RhizosphereMIHEKKTSELLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA*
Ga0070707_10002063123300005468Corn, Switchgrass And Miscanthus RhizosphereMINEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA*
Ga0070707_10088820123300005468Corn, Switchgrass And Miscanthus RhizosphereMINEKKTTELLETSLVYLLSAAVAVGAFVLIWLISLFAGLTRT*
Ga0070698_10007468523300005471Corn, Switchgrass And Miscanthus RhizosphereMINEKKTSELIETSLIYLLSAAVAVGAFILVWLISLFLGFGQA*
Ga0070679_10115697213300005530Corn RhizosphereQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0070697_10108960123300005536Corn, Switchgrass And Miscanthus RhizosphereSKKASELIETSVIYLLSAAVAVGAFVLVWLISFFLGFGRA*
Ga0068853_10052129413300005539Corn RhizosphereMTNQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA*
Ga0070695_10047861423300005545Corn, Switchgrass And Miscanthus RhizosphereMIDEKKTSELIETSLIYLLSAAVAVGAFILVWLVAVFLGLGSQA*
Ga0070695_10100726713300005545Corn, Switchgrass And Miscanthus RhizosphereMIDNKKCSDLVETWLIYLLSAAVAIGAFLLVWIISLVADIGPA*
Ga0070695_10123501223300005545Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGFGQA*
Ga0070695_10147525723300005545Corn, Switchgrass And Miscanthus RhizosphereMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISSLAGVSAT*
Ga0070695_10151860323300005545Corn, Switchgrass And Miscanthus RhizosphereQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT*
Ga0070695_10172051913300005545Corn, Switchgrass And Miscanthus RhizosphereMIEEKKTSELVETWLIYLLSAAVAVGAFLLIWFVSLVAGTGRA*
Ga0070696_10046466323300005546Corn, Switchgrass And Miscanthus RhizosphereMINQKKNSELIETSLIYLLSAAVAVGAFALVWLISMLLGSSQT*
Ga0070696_10192274123300005546Corn, Switchgrass And Miscanthus RhizosphereMINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA*
Ga0070696_10196320813300005546Corn, Switchgrass And Miscanthus RhizosphereMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHT*
Ga0070693_10007537323300005547Corn, Switchgrass And Miscanthus RhizosphereMIDNKKSAELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGWA*
Ga0070693_10070446923300005547Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGSGQA*
Ga0070704_10010850023300005549Corn, Switchgrass And Miscanthus RhizosphereMIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGFGQG*
Ga0070704_10174866613300005549Corn, Switchgrass And Miscanthus RhizosphereMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLAHA*
Ga0068855_10011350623300005563Corn RhizosphereMIDQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLFGLSQG*
Ga0070664_10153342523300005564Corn RhizosphereMINEKKNSEVIETSLIYLLSAAVAVGAFALVWLVSLLLGSGWS*
Ga0066693_1037433123300005566SoilNLPMINDKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGFGQA*
Ga0068857_10019660913300005577Corn RhizospherePMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLNFGRA*
Ga0068857_10047232123300005577Corn RhizosphereMINSKKTSELIETSLIYLLSAAVAVGAFILVWLISLFLGLGQA*
Ga0068857_10062956023300005577Corn RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGLGHA*
Ga0068857_10149522413300005577Corn RhizosphereMIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLISAL
Ga0068857_10156747123300005577Corn RhizosphereMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGVGQA*
Ga0068854_10013733913300005578Corn RhizosphereGNLPMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0070702_10128673313300005615Corn, Switchgrass And Miscanthus RhizosphereMINEKKSSELVETWLIYLLSAAVAVGAFMLVWLISVLTGFSST*
Ga0070702_10188062513300005615Corn, Switchgrass And Miscanthus RhizosphereKKCSDLVETWLIYLLSAAVAIGAFLLVWIISLVADIGPA*
Ga0068859_10026127013300005617Switchgrass RhizosphereRGNLPMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0068859_10221981023300005617Switchgrass RhizosphereMINQKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGRA*
Ga0068864_10014718833300005618Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLVSLVLGFGRA*
Ga0068864_10135505523300005618Switchgrass RhizosphereMINSKKTSELIETSFIYLLSAAVAVGAFVLVWLVSLFLGLGHA*
Ga0068864_10165986023300005618Switchgrass RhizosphereMTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKADF
Ga0068864_10171192723300005618Switchgrass RhizosphereTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA*
Ga0068864_10263988323300005618Switchgrass RhizosphereMINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAN*
Ga0068861_10052721723300005719Switchgrass RhizosphereLPMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA*
Ga0068863_10046849423300005841Switchgrass RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT*
Ga0068863_10168391313300005841Switchgrass RhizosphereMIDNKKSSELVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA*
Ga0068858_10042980213300005842Switchgrass RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT*
Ga0068860_10132573023300005843Switchgrass RhizosphereMMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA*
Ga0068862_10151281923300005844Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLSFGRA*
Ga0075287_102530413300005873Rice Paddy SoilMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0075297_101010123300005878Rice Paddy SoilMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLLG
Ga0075291_100929823300005884Rice Paddy SoilMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLLGPRQT*
Ga0081539_1012252223300005985Tabebuia Heterophylla RhizosphereMINEKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGFGQT*
Ga0075417_1016448423300006049Populus RhizosphereMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLFGFGQG*
Ga0082029_118383323300006169Termite NestMINGKKNSEFVETSLIYLLSAAVAVGAFALVWLVSLLLGSGRS*
Ga0082029_141840623300006169Termite NestMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISFFLGFGQA*
Ga0082029_1466184273300006169Termite NestMIDQKKTSELLETSLVYLLSAAVAVGAFVLVWLISLLFGLGQA*
Ga0082029_162073113300006169Termite NestNQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSAQT*
Ga0070716_10081712113300006173Corn, Switchgrass And Miscanthus RhizosphereMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLLSTLTGIGWT*
Ga0097621_10000922023300006237Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVFGLAHA*
Ga0097621_10113725023300006237Miscanthus RhizosphereQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT*
Ga0068871_10131859013300006358Miscanthus RhizosphereDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAT*
Ga0079222_1000783213300006755Agricultural SoilTRGNLPMINQKKTSEVIETSLIYLLSEAVAVGAFVLVWVISLLLGSSQT*
Ga0079222_1044555323300006755Agricultural SoilMIENKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGWA*
Ga0079222_1048374823300006755Agricultural SoilMINQKKSSELIETSLIYLLSAAVAVGAFGLVWLISL
Ga0079222_1113627113300006755Agricultural SoilNCNLKTKILKMKDLPMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLLSTLTGIGWT*
Ga0079222_1164084413300006755Agricultural SoilMINGKRTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLG
Ga0079220_1051833123300006806Agricultural SoilMIDKKKYSELVESWLFYLLSAAVAIGAFLLIWLVSSMAGVSAT*
Ga0079220_1059444623300006806Agricultural SoilMINEKKNSEFVETSVIYLLSAAVAVGAFVLVWLISVLLGSGRA*
Ga0079220_1147509123300006806Agricultural SoilMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGSA*
Ga0075421_10008884643300006845Populus RhizosphereMMDEKKTSEVIETSLIYLLSAAVAVGAFVLVWLLTPLTHF*
Ga0075421_10206922923300006845Populus RhizosphereMMNEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF*
Ga0075430_10067548313300006846Populus RhizosphereMMDEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF*
Ga0075430_10067661723300006846Populus RhizosphereMLNEKKTSEVIETSLIYLLSAAVAVGAFVLVGLIAVLFGLSQA*
Ga0075431_10027628623300006847Populus RhizosphereMMDEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVLSSPRF*
Ga0075431_10178226623300006847Populus RhizosphereMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISL
Ga0075431_10210140123300006847Populus RhizosphereKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF*
Ga0075433_1001745733300006852Populus RhizosphereMINSKRTSELLETSLIYLLSAAVAVGAFVLVWLLSLLVGLGRA*
Ga0075433_1009398813300006852Populus RhizosphereMLNEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGIARA*
Ga0075433_1013674923300006852Populus RhizosphereMINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGSGRS*
Ga0075433_1163674123300006852Populus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLVSLFLGFGHA*
Ga0075425_10010210533300006854Populus RhizosphereMINEKRTSELLETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA*
Ga0075425_10164848623300006854Populus RhizosphereRNLWMALKVKDLPMLNGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT*
Ga0079217_1001120433300006876Agricultural SoilMMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWFISLLAGVARA*
Ga0079217_1116058123300006876Agricultural SoilMMNEKKTSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA*
Ga0079215_1007338323300006894Agricultural SoilMMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWLISLLAGVAPA*
Ga0075426_1005416023300006903Populus RhizosphereMIDNKKSAELVETWLIYLLSAAVAIGAFLLVWLISALAGVSAT*
Ga0075424_10029767713300006904Populus RhizosphereMLNEKKTSELIETSLIYLLSAAVAVGAFILVWLISLLLGIARA*
Ga0075424_10129598213300006904Populus RhizosphereLNEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGIARA*
Ga0079216_1022250623300006918Agricultural SoilMMNEKKTSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGLGQA*
Ga0079219_1003029823300006954Agricultural SoilMINQKKTSELIETSLIYLLSAAVALGAFVLVWLISLLLGPSQT*
Ga0079219_1006494823300006954Agricultural SoilMINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT*
Ga0079219_1040776813300006954Agricultural SoilMTNHNKTSEFIETSLIYLLSAAVAVGAFGLVWLISLLLGSSQT*
Ga0079218_1066616023300007004Agricultural SoilMMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLFGLGRA*
Ga0079218_1173027223300007004Agricultural SoilMINEKKTSEVIETSLIYLLSAAVAVGAFVLVGLIAVVFGFSQA*
Ga0105247_1096173513300009101Switchgrass RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSRLT*
Ga0105247_1144551813300009101Switchgrass RhizosphereMIDEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGFGQA*
Ga0114129_1254755423300009147Populus RhizosphereMMNEKKTSELIETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA*
Ga0105243_1215376123300009148Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGFGRA*
Ga0075423_1001514083300009162Populus RhizosphereMALKVKDLPMLNGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT*
Ga0105241_1070850823300009174Corn RhizosphereMIEEKKTSELVETWLVYLLSVAVAVGAFLLVCLISLLAGVNRA*
Ga0105241_1137620823300009174Corn RhizosphereMKILKVKDLPMIDNKKYSDLVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA*
Ga0105242_1118136723300009176Miscanthus RhizosphereMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSS
Ga0105237_1010451233300009545Corn RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSS
Ga0105237_1162375923300009545Corn RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFGLVWLISLLLGSSQT*
Ga0105238_1277580023300009551Corn RhizosphereMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIASA*
Ga0105249_1012583813300009553Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFFGL
Ga0126307_1070628823300009789Serpentine SoilMINPKKSSELIETSLIYLLSAAVAVGAFVLVGLISVLLGLSPA*
Ga0126307_1113033113300009789Serpentine SoilRDLPMIDEKKTSELVETWLVYLLSAGVAVGAFLLVWLIVLLAGLGRA*
Ga0126374_1036856913300009792Tropical Forest SoilMINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLL
Ga0126305_1055349123300010036Serpentine SoilMIHEKKTSEFIETSLIYLLSAGVAVGAFVLVWLISLLLGFG
Ga0126305_1088310013300010036Serpentine SoilMINEKKTSELFETSLIYLLSAAVAVGAFVLVWLISLLLGFGQ
Ga0126305_1090567423300010036Serpentine SoilMISEKKTSEVIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSPT*
Ga0126308_1089788023300010040Serpentine SoilMINQKKTSELLETSVIYLLSAAVAAGAFALVWLISLLFGFGYA*
Ga0126310_1083905723300010044Serpentine SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT*
Ga0126384_1013654323300010046Tropical Forest SoilMINEKKNSEFVETSLIYLLSAAVAVGAFALVWLVSLLLGSGRS*
Ga0126306_1175257523300010166Serpentine SoilMIEEKKTSELIETWLVYLLSVAVAAGAFLLVWGISALAGLHWS*
Ga0126370_1077247213300010358Tropical Forest SoilMINEKKHSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA*
Ga0126376_1103500823300010359Tropical Forest SoilMINEKKTSDLFETWVIYLLSAAVAVGAFLLVWLISLLANPALT*
Ga0126372_1152108223300010360Tropical Forest SoilMINGKKNSEFVETSLIYLLSAAVAVAAFVLVWLISLLLGPGRA*
Ga0105239_1096003013300010375Corn RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFL
Ga0105239_1257862613300010375Corn RhizosphereMIDEKKTSELVETWLVYLLSAAVAVGAFLLVWLISLLAGMNRA
Ga0134126_1089679113300010396Terrestrial SoilMKDLPMIDNKNTSELVETWLIYLLSAAVAIAAFLLVWFVSSL
Ga0134127_1026591113300010399Terrestrial SoilMINRKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA*
Ga0134127_1162168723300010399Terrestrial SoilMINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGP
Ga0134121_1086445913300010401Terrestrial SoilTKILKMKDLPMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISSLAGVSAT*
Ga0120182_100970113300011993TerrestrialMMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISRLLGFGQL*
Ga0157299_1008766613300012899SoilMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA*
Ga0164298_1059812723300012955SoilDNKKSAELVETWLVYLLSAAVAIAAFLLVWLISSLAGISAT*
Ga0164303_1067438713300012957SoilRPNCNLKTKILKMKDLPMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISSLAGVSAT
Ga0164301_1093784123300012960SoilKMKDLPMIDNKKSSELVETWLIYLLSAAVAIGAFLLVCLISRLAGIGST*
Ga0164304_1163431423300012986SoilMINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGP
Ga0157373_1106134613300013100Corn RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVLGSGRA
Ga0157373_1124200023300013100Corn RhizosphereMINQKKNSELIETSLVYLLSAAVAVGAFVLVWLISLLLGTSHS*
Ga0163162_1048957623300013306Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGVGHA*
Ga0157372_1014274733300013307Corn RhizosphereMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISFLFGLGQG*
Ga0157375_1018484223300013308Miscanthus RhizosphereMTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLA
Ga0157377_1152192213300014745Miscanthus RhizosphereMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT*
Ga0120193_1004482523300014965TerrestrialMLNEKKTSEVIETSLIYLLSAAVAAGAFVLVGLVALLFGFSQA*
Ga0182006_132364023300015261RhizosphereMKDLPMIDNRKSSELVETWLIYLLSAAVAIGAFLLVWFISTLTGIGWA*
Ga0163161_1094213213300017792Switchgrass RhizosphereMINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT
Ga0190265_1002022813300018422SoilMINDKKTSELLETSLIYLLSAAVAVGAFVLVWLLSLLFGFGQT
Ga0190265_1018500213300018422SoilMINEKKTSEVIETSLIYLLSAAVAVGAFVLVGLIAVLFGFSQT
Ga0190265_1150908523300018422SoilMINEKKSSEVIETSLIYLLSAAVAVGAFVLVGLIAVLFG
Ga0190265_1359318423300018422SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGVSQT
Ga0190272_1100453423300018429SoilMINEKKTSELIETSVVYLLSAAVAVGAFVLVWLISLLLGFSQG
Ga0190275_1031795723300018432SoilMIDEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA
Ga0190268_1018797123300018466SoilMINSKKTSELLETSLIYLLSAAVAVGAFVLVWLLSLLFGFGQA
Ga0190268_1035918323300018466SoilMIEEKKTSELVETWLVYLLSAAVAVAAFMLVWLIVLLAGLGGRA
Ga0190268_1062295423300018466SoilMMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA
Ga0190268_1097884213300018466SoilMLNEKKTSEVIETSLIYLLSAAVAAGAFVLVGLIALLFGFNQA
Ga0190268_1160500313300018466SoilEKKTSELIETSLIYLLSAVVAAGAFVLVGLLALLFGFNQT
Ga0190270_1334366113300018469SoilMINEKKTSELIETSVVYLLSAAVAVGAFVLVWLISLLLGLGQG
Ga0190274_1090336923300018476SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHT
Ga0190274_1173926713300018476SoilMIDHKKTSELIETSFIYLLSAAVAVGAFVLVWLVSFLLGFGQT
Ga0187894_10001309193300019360Microbial Mat On RocksMIDEKKTSELVETWLIYLLSAAVAVGAFMLVWLISLLAGVNRA
Ga0173482_1073587313300019361SoilMINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVS
Ga0190264_1021609323300019377SoilMTDEKKTSELLETSFIYLLSAAVAAGAFVLVWLLSQLFGFGQA
Ga0196977_1000225103300020146SoilMIEEKKTSELVETWLVYLLSAAVAVGAFLLVWLISMLAGLNRA
Ga0193736_101215923300021412SoilMIEQKKTSELVETWLVYLLSAGVAVGAFLLVWLIVLLAGLGRA
Ga0182009_1000249433300021445SoilMINEKKTSEILETSLIYLLSAAVAVGAFVLVWLISLLLGVGGRA
Ga0182009_1002548423300021445SoilMINGKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGRA
Ga0182009_1008580113300021445SoilMINEKKNSEFVETSLVYLLSAAVAVGAFVLVWLVSLLLGPGRA
Ga0182009_1012261923300021445SoilMINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAT
Ga0182009_1037503023300021445SoilMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGWA
Ga0182009_1047566323300021445SoilINEKKSSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA
Ga0182009_1077559213300021445SoilMINGKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGWA
Ga0182009_1082352213300021445SoilMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT
Ga0247695_100794123300024179SoilMISEKKSSELFETWVIYLLSAAVAAGAFLLVWLVSLLASFSST
Ga0207697_1050471423300025315Corn, Switchgrass And Miscanthus RhizosphereMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA
Ga0207656_1001719433300025321Corn RhizosphereMIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGLSQG
Ga0207653_1014220213300025885Corn, Switchgrass And Miscanthus RhizosphereKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT
Ga0207642_1005833823300025899Miscanthus RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT
Ga0207710_1000173253300025900Switchgrass RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHA
Ga0207710_1004580423300025900Switchgrass RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSRLT
Ga0207710_1025560823300025900Switchgrass RhizosphereMINGKKNSEFIETSLIYLLSAAVALGAFALVWLISLLLGSGRA
Ga0207688_1016539823300025901Corn, Switchgrass And Miscanthus RhizosphereMINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT
Ga0207647_1000666153300025904Corn RhizosphereMINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLARA
Ga0207643_1002157923300025908Miscanthus RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFFGFGQA
Ga0207643_1016575723300025908Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGFGHA
Ga0207643_1098793423300025908Miscanthus RhizosphereLPMMNGKKTSEFLETSVIYLLSAAVAVGAFVLVWLLSLLLGLGQA
Ga0207684_10000117393300025910Corn, Switchgrass And Miscanthus RhizosphereMIHEKKTSELLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA
Ga0207654_1011400513300025911Corn RhizosphereMINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPA
Ga0207654_1011857823300025911Corn RhizosphereMALKVKDLPMINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT
Ga0207654_1012759923300025911Corn RhizosphereMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGSA
Ga0207654_1029810513300025911Corn RhizosphereMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGFGQA
Ga0207654_1034831223300025911Corn RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT
Ga0207654_1070845113300025911Corn RhizosphereMINGKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA
Ga0207654_1105844713300025911Corn RhizosphereMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHS
Ga0207654_1122238613300025911Corn RhizosphereMINEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA
Ga0207707_1074790823300025912Corn RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT
Ga0207707_1090095513300025912Corn RhizosphereMIDNKKSSELVETWLIYLLSAAVAIGAFLLAWLISTLTGIGWA
Ga0207662_1002828323300025918Switchgrass RhizosphereMTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA
Ga0207662_1049314223300025918Switchgrass RhizosphereMIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGFSQG
Ga0207649_1051934613300025920Corn RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLSFGRA
Ga0207652_1163758513300025921Corn RhizosphereRGNLPMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT
Ga0207681_1007410123300025923Switchgrass RhizosphereMINQKKTSEFIETSLVYLLSAVVAVGAFVLVWLVSLLLGPSPM
Ga0207694_1001755223300025924Corn RhizosphereMIKQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT
Ga0207694_1116115323300025924Corn RhizosphereMINQKKNSELIETSLIYLLSAAVAVGAFVLVWLISMLLGSSQT
Ga0207650_100000281783300025925Switchgrass RhizosphereMINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPT
Ga0207650_1076941023300025925Switchgrass RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLVSSQT
Ga0207650_1146150023300025925Switchgrass RhizosphereTRYLPMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA
Ga0207701_1078589913300025930Corn, Switchgrass And Miscanthus RhizosphereMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA
Ga0207690_1076106813300025932Corn RhizosphereLKRNLPMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT
Ga0207706_1044978013300025933Corn RhizosphereMINHKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT
Ga0207706_1049673923300025933Corn RhizosphereMINEKKNSEFVETSVIYLLSAAVAVGAFALVWLISLLLGSGRA
Ga0207706_1156106623300025933Corn RhizosphereMIDEKKTSELIETSLIYLLSAAVAVGAFILVWLVAVFLGLGSQA
Ga0207709_1003079823300025935Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFFLGFGRA
Ga0207709_1059937023300025935Miscanthus RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLISLLLGSSQT
Ga0207709_1125209023300025935Miscanthus RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA
Ga0207670_1037216023300025936Switchgrass RhizosphereMIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLISALAVPRWS
Ga0207704_1104328613300025938Miscanthus RhizosphereINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT
Ga0207665_1003178723300025939Corn, Switchgrass And Miscanthus RhizosphereMINEKKSSELVETWLIYLLSAAVAVGAFMLVWLISVLTGFSST
Ga0207665_1143639623300025939Corn, Switchgrass And Miscanthus RhizosphereMISEKKTSDLVETWLIYLLSAAVAVGAFMLVWLISLLTGFSST
Ga0207691_1049976523300025940Miscanthus RhizosphereMINEKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA
Ga0207691_1051087523300025940Miscanthus RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA
Ga0207711_1155303713300025941Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVLGFGRA
Ga0207689_1012267923300025942Miscanthus RhizosphereMINHKKSSEFLETSLIYLLSTAVAVGAFVLVWLISLLLGPSQT
Ga0207689_1014120623300025942Miscanthus RhizosphereMTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA
Ga0207689_1100459813300025942Miscanthus RhizosphereMIDEKKTSELVETWLVYLLSAAVAAGAFLLVWFISLLTGVNRA
Ga0207689_1121882523300025942Miscanthus RhizosphereMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLVLGFGQA
Ga0207689_1141546213300025942Miscanthus RhizosphereMIEEKKTSELVETWLIYLLSAAVAVGAFLLIWFVSLVAGTGRA
Ga0207661_1123187823300025944Corn RhizosphereMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT
Ga0207679_1169189423300025945Corn RhizosphereMINEKKNSEVIETSLIYLLSAAVAVGAFALVWLISLLLGSGRA
Ga0207667_1013415423300025949Corn RhizosphereMIDQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLFGLSQG
Ga0207651_1130729023300025960Switchgrass RhizosphereMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQ
Ga0207712_1113172413300025961Switchgrass RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLISLLLGSSHT
Ga0207640_1060542323300025981Corn RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT
Ga0207640_1085430223300025981Corn RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA
Ga0207703_1025291023300026035Switchgrass RhizosphereMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT
Ga0207703_1126475123300026035Switchgrass RhizosphereSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLARA
Ga0207703_1227942623300026035Switchgrass RhizospherePKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA
Ga0207639_1095195023300026041Corn RhizosphereMTNQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA
Ga0207678_1081081023300026067Corn RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSGRT
Ga0207708_1008861623300026075Corn, Switchgrass And Miscanthus RhizosphereMINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLGHA
Ga0207641_1025603513300026088Switchgrass RhizosphereINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT
Ga0207641_1094069323300026088Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGLGHA
Ga0207641_1158168813300026088Switchgrass RhizosphereNLPMTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA
Ga0207641_1203062223300026088Switchgrass RhizosphereSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA
Ga0207676_1022993923300026095Switchgrass RhizosphereMINSKKTSELIETSFIYLLSAAVAVGAFVLVWLVSLFLGLGHA
Ga0207676_1032303823300026095Switchgrass RhizosphereMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLVSLVLGFGRA
Ga0207676_1163533423300026095Switchgrass RhizosphereMINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAN
Ga0207674_1071308523300026116Corn RhizosphereMINQKKTSEFVETSLIYLLSAAVAVAAFVLVWLVSLLLGPSQT
Ga0207674_1079841923300026116Corn RhizosphereMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGPSPM
Ga0207674_1095146423300026116Corn RhizospherePMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLNFGRA
Ga0256867_1001204833300026535SoilMIDEKKTSELIETSLIYLLSAAVAVGAFVLVWIISMFLGFGQA
Ga0209215_1000035263300027266Forest SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSTFLGLGQT
Ga0209215_100916623300027266Forest SoilMIEEKKTAELIETWLVYLLSAAVAVGAFLLVWLISLLS
Ga0209731_101944623300027326Forest SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA
Ga0209216_100295123300027530Forest SoilMIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLVSMLAGVNRA
Ga0209387_102550823300027639Agricultural SoilMMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWLISLLAGVAPA
Ga0209795_1001622523300027718AgaveMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSQT
Ga0209177_1001765923300027775Agricultural SoilMINQKKTSELIETSLIYLLSAAVALGAFVLVWLISLLLGPSQT
Ga0209177_1007484013300027775Agricultural SoilMINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT
Ga0209177_1013698013300027775Agricultural SoilMINEKKNSEFVETSVIYLLSAAVAVGAFVLVWLISVLLGSGRA
Ga0209481_1001365543300027880Populus RhizosphereMMNEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF
Ga0209486_1016339523300027886Agricultural SoilMMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWFISLLAGVARA
Ga0207428_1027698923300027907Populus RhizosphereMIDQKKTSELIETSLVYLLSAAVAVGAFLLVWLISLLFGFGQG
Ga0209382_1022731323300027909Populus RhizosphereMMDEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF
Ga0209382_1049299123300027909Populus RhizosphereMINGKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRG
Ga0209382_1088166923300027909Populus RhizosphereRNLPMMDEKKTSEVIETSLIYLLSAAVAVGAFVLVWLLTPLTDF
Ga0268266_1208771123300028379Switchgrass RhizosphereMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSPT
Ga0268264_1209410123300028381Switchgrass RhizosphereMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA
Ga0268264_1233255613300028381Switchgrass RhizosphereMINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLIS
Ga0268264_1249461423300028381Switchgrass RhizosphereMINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSAT
Ga0268259_1011232813300030499AgaveRNLPMINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSRA
Ga0268241_1001610723300030511SoilMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISTLTGRGWA
Ga0268241_1006637523300030511SoilMIEHKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA
Ga0268241_1017404913300030511SoilRNLPMINEKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPAQT
Ga0307505_10000089863300031455SoilMIERKKTAELVETWLVYLLSAAVAVGAFLLVWFISVLAGVNRA
Ga0307408_10008216723300031548RhizosphereMIEEKKTSELVETWLVYLLSAGVAVAAFLLVWLIVLLAGLGGRA
Ga0310813_1020104523300031716SoilMIDNKKYSDLVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA
Ga0310813_1037441613300031716SoilMINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA
Ga0310813_1054403323300031716SoilMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSFFLGFGNA
Ga0310813_1054591023300031716SoilMINGKKNTEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGRA
Ga0310813_1059419423300031716SoilMINGKKNSEFVETSLIYLLSAAVAVGAFVLVYLISLLLGSGRA
Ga0310813_1088014013300031716SoilMINQKKTAEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQS
Ga0310813_1182117523300031716SoilMINEKKSSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA
Ga0310813_1225257023300031716SoilMINGKKNSEFVETSLIYLLSAAVAVGAFALVWLVSLLLGPGRA
Ga0310813_1229311713300031716SoilMINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLG
Ga0307468_10022618923300031740Hardwood Forest SoilMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFFGFGQA
Ga0307468_10034295823300031740Hardwood Forest SoilMIHEKKTSDLIETSLIYLLSAAVAVGAFLLVWLISNILGLGQA
Ga0307468_10170655713300031740Hardwood Forest SoilEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA
Ga0307410_1172616113300031852RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFG
Ga0310904_1111467923300031854SoilKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFFGLSHA
Ga0307406_1127240513300031901RhizosphereMINQKKTSEFIETSLVYLLSAAVALGAFVLVWLVSL
Ga0307407_1158965523300031903RhizosphereMINEKKTSELIETSLVYLLSAGVAVGAFVLVWLISLLLGFGQA
Ga0307412_1056600213300031911RhizosphereMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLG
Ga0308174_1077536323300031939SoilMINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPAQT
Ga0307409_10104147113300031995RhizospherePMINEKKTSELIETSLVYLLSAGVAVGAFVLVWLISLLLGFGQA
Ga0308176_1299655513300031996SoilMIEEKKRSELVETWLIYLLSAAVAAGAFLLVWFVSVLMGIGRA
Ga0307416_10138866213300032002RhizosphereMIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLFGLGQG
Ga0315910_1024262023300032144SoilMIEQKKTSELIETWLVYLLSAAVAVGAFLLVWLISLLAGVTRA
Ga0310811_1132933413300033475SoilMINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSFF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.