Metagenome / Metatranscriptome Family F005733

Basic Information
Family ID	F005733
Family Type	Metagenome / Metatranscriptome
Number of Sequences	391
Average Sequence Length	38 residues
Representative Sequence	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Number of Associated Samples	38
Number of Associated Scaffolds	390

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	85.42 %
% of genes near scaffold ends (potentially truncated)	7.67 %
% of genes from short scaffolds (< 2000 bps)	67.01 %
Associated GOLD sequencing projects	37
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Most Common Taxonomy
Group	Unclassified (84.399 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (59.847 % of family members)
Environment Ontology (ENVO)	Unclassified (61.893 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (60.870 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 17.19% β-sheet: 0.00% Coil/Unstructured: 82.81%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 390 Family Scaffolds
PF07727	RVT_2	1.03
PF03184	DDE_1	0.51
PF13843	DDE_Tnp_1_7	0.26
PF05425	CopD	0.26
PF04042	DNA_pol_E_B	0.26
PF09612	HtrL_YibB	0.26
PF04153	NOT2_3_5	0.26
PF00004	AAA	0.26
PF05175	MTS	0.26
PF07707	BACK	0.26
PF02037	SAP	0.26
PF05050	Methyltransf_21	0.26
PF14214	Helitron_like_N	0.26
PF00078	RVT_1	0.26
PF05699	Dimer_Tnp_hAT	0.26
PF05970	PIF1	0.26
PF03462	PCRF	0.26
PF13306	LRR_5	0.26
PF03159	XRN_N	0.26
PF00106	adh_short	0.26
PF07808	RED_N	0.26

COG ID	Name	Functional Category	% Frequency in 390 Family Scaffolds
COG0216	Protein chain release factor RF1	Translation, ribosomal structure and biogenesis [J]	0.26
COG0507	ATPase/5Ã¢â‚¬â„¢-3Ã¢â‚¬â„¢ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)	Replication, recombination and repair [L]	0.26
COG1186	Protein chain release factor PrfB	Translation, ribosomal structure and biogenesis [J]	0.26
COG1276	Putative copper export protein	Inorganic ion transport and metabolism [P]	0.26
COG1311	Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B	Replication, recombination and repair [L]	0.26
COG5665	CCR4-NOT transcriptional regulation complex, NOT5 subunit	Transcription [K]	0.26

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
All Organisms	root	All Organisms	15.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
cellular organisms	root	All Organisms → cellular organisms	15.60 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	14.83 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	13.81 %
Haptista	clade	All Organisms → cellular organisms → Eukaryota → Haptista	0.51 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.26 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Stramenopiles	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles	12.53 %
Haptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta	0.51 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Ochrophyta	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta	12.53 %
Prymnesiophyceae	clade	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae	0.26 %
Pavlovales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales	0.26 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Bacillariophyta	phylum	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	12.53 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Pavlovaceae	family	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae	0.26 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Coscinodiscophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae	9.21 %
Bacillariophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae	0.77 %
Mediophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae	0.26 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.26 %
Diacronema	genus	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosirophycidae	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae	8.95 %
Bacillariophycidae	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae	0.77 %
Chaetocerotophycidae	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Biddulphiophycidae	subclass	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae	0.26 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosirales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	8.95 %
Naviculales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales	0.77 %
Eupodiscales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales	0.26 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.26 %
Leptocylindrales	order	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosiraceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae	7.16 %
Naviculaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae	0.51 %
Skeletonemataceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae	0.51 %
Amphipleuraceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae	0.26 %
Parodontellaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae	0.26 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.26 %
Leptocylindraceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosira	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	7.16 %
Fistulifera	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera	0.51 %
Skeletonema	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema	0.51 %
Amphiprora	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora	0.26 %
Trieres	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres	0.26 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.26 %
Leptocylindrus	genus	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3.84 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	1.53 %
Skeletonema marinoi-dohrnii complex	clade	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex	0.51 %
Fistulifera solaris	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	0.51 %
Amphiprora paludosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	0.26 %
Trieres chinensis	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	0.26 %
Leptocylindrus aporus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	0.26 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3.84 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	1.53 %
Skeletonema marinoi	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	0.51 %
Fistulifera solaris	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	0.51 %
Alismatales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales	0.26 %
Amphiprora paludosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	0.26 %
Trieres chinensis	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	0.26 %
Leptocylindrus aporus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3.84 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	1.53 %
Skeletonema marinoi	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	0.51 %
Fistulifera solaris	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	0.51 %
Zosteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales → Zosteraceae	0.26 %
Amphiprora paludosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	0.26 %
Trieres chinensis	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	0.26 %
Leptocylindrus aporus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3.84 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	1.53 %
Skeletonema marinoi	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	0.51 %
Fistulifera solaris	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	0.51 %
Zostera	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales → Zosteraceae → Zostera	0.26 %
Amphiprora paludosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	0.26 %
Trieres chinensis	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	0.26 %
Leptocylindrus aporus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	84.40 %
Thalassiosira oceanica	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3.84 %
Thalassiosira pseudonana	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	1.53 %
Skeletonema marinoi	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	0.51 %
Fistulifera solaris	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	0.51 %
Zostera marina	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales → Zosteraceae → Zostera → Zostera marina	0.26 %
Amphiprora paludosa	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	0.26 %
Trieres chinensis	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	0.26 %
Leptocylindrus aporus	species	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	0.26 %
Diacronema lutheri	species	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	0.26 %
Coccolithales	order	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	0.26 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.26 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090005\|LWSO_GFMCQXZ02GDMED	Not Available	512	Open in IMG/M
3300005525\|Ga0068877_10737881	Not Available	524	Open in IMG/M
3300005805\|Ga0079957_1247209	Not Available	830	Open in IMG/M
3300007561\|Ga0102914_1282479	Not Available	508	Open in IMG/M
3300007600\|Ga0102920_1316155	Not Available	503	Open in IMG/M
3300007629\|Ga0102895_1032544	Not Available	1326	Open in IMG/M
3300007718\|Ga0102852_1068205	Not Available	684	Open in IMG/M
3300008115\|Ga0114348_1016827	All Organisms → cellular organisms → Bacteria	1833	Open in IMG/M
3300008115\|Ga0114348_1018943	Not Available	1712	Open in IMG/M
3300008115\|Ga0114348_1042500	Not Available	1096	Open in IMG/M
3300008115\|Ga0114348_1073145	Not Available	797	Open in IMG/M
3300008115\|Ga0114348_1129785	Not Available	526	Open in IMG/M
3300008121\|Ga0114356_1355381	Not Available	1386	Open in IMG/M
3300008122\|Ga0114359_1282111	Not Available	579	Open in IMG/M
3300008263\|Ga0114349_1003162	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	8114	Open in IMG/M
3300008263\|Ga0114349_1006354	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	8440	Open in IMG/M
3300008263\|Ga0114349_1011546	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	4440	Open in IMG/M
3300008263\|Ga0114349_1012361	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales	4294	Open in IMG/M
3300008263\|Ga0114349_1013691	Not Available	4076	Open in IMG/M
3300008263\|Ga0114349_1020227	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3355	Open in IMG/M
3300008263\|Ga0114349_1021605	Not Available	3246	Open in IMG/M
3300008263\|Ga0114349_1022364	Not Available	3187	Open in IMG/M
3300008263\|Ga0114349_1022892	Not Available	3147	Open in IMG/M
3300008263\|Ga0114349_1023447	Not Available	6077	Open in IMG/M
3300008263\|Ga0114349_1025400	Not Available	2976	Open in IMG/M
3300008263\|Ga0114349_1027346	Not Available	2860	Open in IMG/M
3300008263\|Ga0114349_1028989	Not Available	3775	Open in IMG/M
3300008263\|Ga0114349_1047097	Not Available	2092	Open in IMG/M
3300008263\|Ga0114349_1048271	Not Available	2060	Open in IMG/M
3300008263\|Ga0114349_1048832	Not Available	2046	Open in IMG/M
3300008263\|Ga0114349_1050545	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	2004	Open in IMG/M
3300008263\|Ga0114349_1055455	All Organisms → cellular organisms → Eukaryota	1892	Open in IMG/M
3300008263\|Ga0114349_1059408	All Organisms → cellular organisms → Bacteria	3361	Open in IMG/M
3300008263\|Ga0114349_1059667	Not Available	1804	Open in IMG/M
3300008263\|Ga0114349_1064688	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Alismatales → Zosteraceae → Zostera → Zostera marina	1713	Open in IMG/M
3300008263\|Ga0114349_1068667	Not Available	1649	Open in IMG/M
3300008263\|Ga0114349_1073285	Not Available	1580	Open in IMG/M
3300008263\|Ga0114349_1074151	Not Available	1567	Open in IMG/M
3300008263\|Ga0114349_1075418	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	1549	Open in IMG/M
3300008263\|Ga0114349_1076114	Not Available	1539	Open in IMG/M
3300008263\|Ga0114349_1082242	Not Available	1460	Open in IMG/M
3300008263\|Ga0114349_1083339	Not Available	1447	Open in IMG/M
3300008263\|Ga0114349_1084897	Not Available	2116	Open in IMG/M
3300008263\|Ga0114349_1085343	Not Available	1423	Open in IMG/M
3300008263\|Ga0114349_1091930	Not Available	1349	Open in IMG/M
3300008263\|Ga0114349_1092354	Not Available	1344	Open in IMG/M
3300008263\|Ga0114349_1095470	Not Available	1311	Open in IMG/M
3300008263\|Ga0114349_1095862	Not Available	1307	Open in IMG/M
3300008263\|Ga0114349_1098950	Not Available	1277	Open in IMG/M
3300008263\|Ga0114349_1099569	Not Available	1271	Open in IMG/M
3300008263\|Ga0114349_1110385	Not Available	1178	Open in IMG/M
3300008263\|Ga0114349_1131795	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	1029	Open in IMG/M
3300008263\|Ga0114349_1142414	Not Available	967	Open in IMG/M
3300008263\|Ga0114349_1148176	Not Available	936	Open in IMG/M
3300008263\|Ga0114349_1163363	Not Available	865	Open in IMG/M
3300008263\|Ga0114349_1170647	Not Available	834	Open in IMG/M
3300008263\|Ga0114349_1170693	Not Available	833	Open in IMG/M
3300008263\|Ga0114349_1188567	Not Available	763	Open in IMG/M
3300008263\|Ga0114349_1200828	Not Available	720	Open in IMG/M
3300008263\|Ga0114349_1213681	Not Available	678	Open in IMG/M
3300008263\|Ga0114349_1214375	Not Available	676	Open in IMG/M
3300008263\|Ga0114349_1216273	Not Available	671	Open in IMG/M
3300008263\|Ga0114349_1241148	Not Available	599	Open in IMG/M
3300008263\|Ga0114349_1263955	Not Available	542	Open in IMG/M
3300008263\|Ga0114349_1282870	Not Available	506	Open in IMG/M
3300008264\|Ga0114353_1351266	Not Available	571	Open in IMG/M
3300008264\|Ga0114353_1354771	Not Available	565	Open in IMG/M
3300008265\|Ga0114361_1000672	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	9742	Open in IMG/M
3300008265\|Ga0114361_1002725	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	6458	Open in IMG/M
3300008265\|Ga0114361_1002746	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	7715	Open in IMG/M
3300008265\|Ga0114361_1003653	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	5782	Open in IMG/M
3300008265\|Ga0114361_1004376	Not Available	5397	Open in IMG/M
3300008265\|Ga0114361_1004657	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	5256	Open in IMG/M
3300008265\|Ga0114361_1004803	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	5193	Open in IMG/M
3300008265\|Ga0114361_1005526	Not Available	6169	Open in IMG/M
3300008265\|Ga0114361_1005565	Not Available	4874	Open in IMG/M
3300008265\|Ga0114361_1006752	Not Available	4457	Open in IMG/M
3300008265\|Ga0114361_1007727	Not Available	4183	Open in IMG/M
3300008265\|Ga0114361_1009099	Not Available	3848	Open in IMG/M
3300008265\|Ga0114361_1009963	Not Available	6312	Open in IMG/M
3300008265\|Ga0114361_1010583	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	6554	Open in IMG/M
3300008265\|Ga0114361_1010587	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	3571	Open in IMG/M
3300008265\|Ga0114361_1011962	Not Available	3333	Open in IMG/M
3300008265\|Ga0114361_1014237	Not Available	3011	Open in IMG/M
3300008265\|Ga0114361_1014544	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	2970	Open in IMG/M
3300008265\|Ga0114361_1014592	Not Available	2965	Open in IMG/M
3300008265\|Ga0114361_1015680	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	2846	Open in IMG/M
3300008265\|Ga0114361_1017761	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	6354	Open in IMG/M
3300008265\|Ga0114361_1020550	Not Available	2392	Open in IMG/M
3300008265\|Ga0114361_1021237	Not Available	2341	Open in IMG/M
3300008265\|Ga0114361_1022511	Not Available	2248	Open in IMG/M
3300008265\|Ga0114361_1025540	All Organisms → cellular organisms → Eukaryota → Sar	2064	Open in IMG/M
3300008265\|Ga0114361_1027224	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	1979	Open in IMG/M
3300008265\|Ga0114361_1027270	Not Available	1977	Open in IMG/M
3300008265\|Ga0114361_1030177	Not Available	1844	Open in IMG/M
3300008265\|Ga0114361_1032984	Not Available	1738	Open in IMG/M
3300008265\|Ga0114361_1034545	Not Available	1684	Open in IMG/M
3300008265\|Ga0114361_1039535	Not Available	1539	Open in IMG/M
3300008265\|Ga0114361_1042187	Not Available	1476	Open in IMG/M
3300008265\|Ga0114361_1042979	Not Available	1458	Open in IMG/M
3300008265\|Ga0114361_1047629	Not Available	1369	Open in IMG/M
3300008265\|Ga0114361_1049457	Not Available	1339	Open in IMG/M
3300008265\|Ga0114361_1056845	Not Available	1230	Open in IMG/M
3300008265\|Ga0114361_1065113	Not Available	1137	Open in IMG/M
3300008265\|Ga0114361_1067999	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	1109	Open in IMG/M
3300008265\|Ga0114361_1068981	Not Available	1100	Open in IMG/M
3300008265\|Ga0114361_1070074	Not Available	1091	Open in IMG/M
3300008265\|Ga0114361_1072944	Not Available	1067	Open in IMG/M
3300008265\|Ga0114361_1082920	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris	994	Open in IMG/M
3300008265\|Ga0114361_1083164	Not Available	993	Open in IMG/M
3300008265\|Ga0114361_1083193	Not Available	992	Open in IMG/M
3300008265\|Ga0114361_1090260	Not Available	950	Open in IMG/M
3300008265\|Ga0114361_1092075	Not Available	940	Open in IMG/M
3300008265\|Ga0114361_1092123	Not Available	940	Open in IMG/M
3300008265\|Ga0114361_1097517	Not Available	912	Open in IMG/M
3300008265\|Ga0114361_1100976	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	895	Open in IMG/M
3300008265\|Ga0114361_1106570	Not Available	870	Open in IMG/M
3300008265\|Ga0114361_1111352	Not Available	850	Open in IMG/M
3300008265\|Ga0114361_1125017	Not Available	800	Open in IMG/M
3300008265\|Ga0114361_1135388	Not Available	768	Open in IMG/M
3300008265\|Ga0114361_1145494	Not Available	1063	Open in IMG/M
3300008265\|Ga0114361_1145993	Not Available	738	Open in IMG/M
3300008265\|Ga0114361_1157200	Not Available	710	Open in IMG/M
3300008265\|Ga0114361_1160311	Not Available	702	Open in IMG/M
3300008265\|Ga0114361_1191320	Not Available	638	Open in IMG/M
3300008265\|Ga0114361_1197274	Not Available	627	Open in IMG/M
3300008265\|Ga0114361_1202765	Not Available	618	Open in IMG/M
3300008265\|Ga0114361_1225687	Not Available	581	Open in IMG/M
3300008265\|Ga0114361_1240175	Not Available	559	Open in IMG/M
3300008265\|Ga0114361_1246058	Not Available	551	Open in IMG/M
3300008265\|Ga0114361_1251122	Not Available	544	Open in IMG/M
3300008265\|Ga0114361_1251420	Not Available	544	Open in IMG/M
3300008265\|Ga0114361_1266143	Not Available	525	Open in IMG/M
3300008265\|Ga0114361_1271865	Not Available	517	Open in IMG/M
3300009002\|Ga0102810_1189231	Not Available	633	Open in IMG/M
3300009024\|Ga0102811_1227690	Not Available	696	Open in IMG/M
3300009142\|Ga0102885_1083152	Not Available	768	Open in IMG/M
3300013005\|Ga0164292_10863562	Not Available	569	Open in IMG/M
3300013372\|Ga0177922_10160852	Not Available	696	Open in IMG/M
3300013372\|Ga0177922_11137086	Not Available	1101	Open in IMG/M
3300020048\|Ga0207193_1121695	Not Available	2288	Open in IMG/M
3300020048\|Ga0207193_1137670	Not Available	2087	Open in IMG/M
3300020048\|Ga0207193_1514153	Not Available	794	Open in IMG/M
3300020160\|Ga0211733_10430764	Not Available	576	Open in IMG/M
3300020205\|Ga0211731_10724885	Not Available	649	Open in IMG/M
3300020505\|Ga0208088_1027018	Not Available	729	Open in IMG/M
3300020505\|Ga0208088_1041099	Not Available	563	Open in IMG/M
3300020510\|Ga0208086_1024254	Not Available	778	Open in IMG/M
3300021845\|Ga0210297_1019629	Not Available	530	Open in IMG/M
3300024343\|Ga0244777_10835869	Not Available	542	Open in IMG/M
3300027806\|Ga0209985_10307387	Not Available	714	Open in IMG/M
3300031758\|Ga0315907_10792411	Not Available	709	Open in IMG/M
3300032092\|Ga0315905_11563101	Not Available	514	Open in IMG/M
3300033984\|Ga0334989_0001064	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	13148	Open in IMG/M
3300033984\|Ga0334989_0002031	Not Available	9913	Open in IMG/M
3300033984\|Ga0334989_0003466	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	7716	Open in IMG/M
3300033984\|Ga0334989_0003603	Not Available	7600	Open in IMG/M
3300033984\|Ga0334989_0004998	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	6555	Open in IMG/M
3300033984\|Ga0334989_0005764	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	6174	Open in IMG/M
3300033984\|Ga0334989_0006752	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	5782	Open in IMG/M
3300033984\|Ga0334989_0007195	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	5624	Open in IMG/M
3300033984\|Ga0334989_0007261	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	5601	Open in IMG/M
3300033984\|Ga0334989_0007877	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi	5395	Open in IMG/M
3300033984\|Ga0334989_0010438	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus aporus	4766	Open in IMG/M
3300033984\|Ga0334989_0012422	All Organisms → cellular organisms → Eukaryota → Sar	4413	Open in IMG/M
3300033984\|Ga0334989_0013681	Not Available	4230	Open in IMG/M
3300033984\|Ga0334989_0013817	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Pavlovales → Pavlovaceae → Diacronema → Diacronema lutheri	4210	Open in IMG/M
3300033984\|Ga0334989_0015443	Not Available	3997	Open in IMG/M
3300033984\|Ga0334989_0016626	Not Available	3859	Open in IMG/M
3300033984\|Ga0334989_0017357	Not Available	3787	Open in IMG/M
3300033984\|Ga0334989_0017640	Not Available	3758	Open in IMG/M
3300033984\|Ga0334989_0018007	Not Available	3723	Open in IMG/M
3300033984\|Ga0334989_0018740	Not Available	3656	Open in IMG/M
3300033984\|Ga0334989_0019511	Not Available	3585	Open in IMG/M
3300033984\|Ga0334989_0019731	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	3567	Open in IMG/M
3300033984\|Ga0334989_0020580	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	3499	Open in IMG/M
3300033984\|Ga0334989_0022897	Not Available	3325	Open in IMG/M
3300033984\|Ga0334989_0024449	Not Available	3221	Open in IMG/M
3300033984\|Ga0334989_0025126	Not Available	3181	Open in IMG/M
3300033984\|Ga0334989_0025730	Not Available	3146	Open in IMG/M
3300033984\|Ga0334989_0026366	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	3108	Open in IMG/M
3300033984\|Ga0334989_0027870	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	3026	Open in IMG/M
3300033984\|Ga0334989_0028336	Not Available	3003	Open in IMG/M
3300033984\|Ga0334989_0028336	Not Available	3003	Open in IMG/M
3300033984\|Ga0334989_0028932	All Organisms → cellular organisms → Eukaryota → Sar	2976	Open in IMG/M
3300033984\|Ga0334989_0034455	Not Available	2741	Open in IMG/M
3300033984\|Ga0334989_0034674	Not Available	2732	Open in IMG/M
3300033984\|Ga0334989_0036483	Not Available	2668	Open in IMG/M
3300033984\|Ga0334989_0039998	Not Available	2556	Open in IMG/M
3300033984\|Ga0334989_0040221	Not Available	2549	Open in IMG/M
3300033984\|Ga0334989_0040417	Not Available	2543	Open in IMG/M
3300033984\|Ga0334989_0041622	Not Available	2506	Open in IMG/M
3300033984\|Ga0334989_0041647	Not Available	2505	Open in IMG/M
3300033984\|Ga0334989_0042832	Not Available	2472	Open in IMG/M
3300033984\|Ga0334989_0045217	Not Available	2406	Open in IMG/M
3300033984\|Ga0334989_0046584	Not Available	2372	Open in IMG/M
3300033984\|Ga0334989_0046884	Not Available	2365	Open in IMG/M
3300033984\|Ga0334989_0047131	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	2358	Open in IMG/M
3300033984\|Ga0334989_0048119	Not Available	2335	Open in IMG/M
3300033984\|Ga0334989_0049130	Not Available	2312	Open in IMG/M
3300033984\|Ga0334989_0052913	Not Available	2229	Open in IMG/M
3300033984\|Ga0334989_0055037	Not Available	2185	Open in IMG/M
3300033984\|Ga0334989_0056909	Not Available	2150	Open in IMG/M
3300033984\|Ga0334989_0057366	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	2141	Open in IMG/M
3300033984\|Ga0334989_0061897	Not Available	2063	Open in IMG/M
3300033984\|Ga0334989_0063172	Not Available	2042	Open in IMG/M
3300033984\|Ga0334989_0064086	Not Available	2027	Open in IMG/M
3300033984\|Ga0334989_0071419	Not Available	1918	Open in IMG/M
3300033984\|Ga0334989_0074149	Not Available	1879	Open in IMG/M
3300033984\|Ga0334989_0074312	Not Available	1877	Open in IMG/M
3300033984\|Ga0334989_0078201	All Organisms → cellular organisms → Eukaryota → Sar	1828	Open in IMG/M
3300033984\|Ga0334989_0080670	Not Available	1798	Open in IMG/M
3300033984\|Ga0334989_0081167	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	1792	Open in IMG/M
3300033984\|Ga0334989_0087166	Not Available	1728	Open in IMG/M
3300033984\|Ga0334989_0088357	Not Available	1716	Open in IMG/M
3300033984\|Ga0334989_0090279	Not Available	1696	Open in IMG/M
3300033984\|Ga0334989_0092794	Not Available	1672	Open in IMG/M
3300033984\|Ga0334989_0096800	Not Available	1637	Open in IMG/M
3300033984\|Ga0334989_0099700	Not Available	1612	Open in IMG/M
3300033984\|Ga0334989_0099808	Not Available	1611	Open in IMG/M
3300033984\|Ga0334989_0101473	Not Available	1597	Open in IMG/M
3300033984\|Ga0334989_0102969	Not Available	1585	Open in IMG/M
3300033984\|Ga0334989_0103419	Not Available	1581	Open in IMG/M
3300033984\|Ga0334989_0105537	Not Available	1564	Open in IMG/M
3300033984\|Ga0334989_0107170	Not Available	1551	Open in IMG/M
3300033984\|Ga0334989_0107603	Not Available	1548	Open in IMG/M
3300033984\|Ga0334989_0109620	Not Available	1533	Open in IMG/M
3300033984\|Ga0334989_0110044	Not Available	1530	Open in IMG/M
3300033984\|Ga0334989_0120719	Not Available	1456	Open in IMG/M
3300033984\|Ga0334989_0122113	Not Available	1447	Open in IMG/M
3300033984\|Ga0334989_0124852	Not Available	1430	Open in IMG/M
3300033984\|Ga0334989_0130781	Not Available	1395	Open in IMG/M
3300033984\|Ga0334989_0134473	Not Available	1374	Open in IMG/M
3300033984\|Ga0334989_0139581	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Amphipleuraceae → Amphiprora → Amphiprora paludosa	1346	Open in IMG/M
3300033984\|Ga0334989_0141040	Not Available	1338	Open in IMG/M
3300033984\|Ga0334989_0145571	Not Available	1315	Open in IMG/M
3300033984\|Ga0334989_0155656	Not Available	1267	Open in IMG/M
3300033984\|Ga0334989_0156793	Not Available	1262	Open in IMG/M
3300033984\|Ga0334989_0164189	Not Available	1230	Open in IMG/M
3300033984\|Ga0334989_0165806	Not Available	1223	Open in IMG/M
3300033984\|Ga0334989_0170754	Not Available	1203	Open in IMG/M
3300033984\|Ga0334989_0170760	Not Available	1203	Open in IMG/M
3300033984\|Ga0334989_0171725	Not Available	1199	Open in IMG/M
3300033984\|Ga0334989_0173014	Not Available	1194	Open in IMG/M
3300033984\|Ga0334989_0180005	Not Available	1167	Open in IMG/M
3300033984\|Ga0334989_0183190	Not Available	1155	Open in IMG/M
3300033984\|Ga0334989_0189787	Not Available	1132	Open in IMG/M
3300033984\|Ga0334989_0191859	Not Available	1125	Open in IMG/M
3300033984\|Ga0334989_0207281	Not Available	1075	Open in IMG/M
3300033984\|Ga0334989_0207965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1073	Open in IMG/M
3300033984\|Ga0334989_0210809	All Organisms → cellular organisms → Eukaryota → Sar	1064	Open in IMG/M
3300033984\|Ga0334989_0216488	Not Available	1047	Open in IMG/M
3300033984\|Ga0334989_0221775	Not Available	1032	Open in IMG/M
3300033984\|Ga0334989_0222189	Not Available	1031	Open in IMG/M
3300033984\|Ga0334989_0222224	Not Available	1031	Open in IMG/M
3300033984\|Ga0334989_0248330	Not Available	964	Open in IMG/M
3300033984\|Ga0334989_0250484	Not Available	959	Open in IMG/M
3300033984\|Ga0334989_0260121	Not Available	937	Open in IMG/M
3300033984\|Ga0334989_0268945	Not Available	917	Open in IMG/M
3300033984\|Ga0334989_0273122	Not Available	908	Open in IMG/M
3300033984\|Ga0334989_0287254	Not Available	879	Open in IMG/M
3300033984\|Ga0334989_0288750	Not Available	876	Open in IMG/M
3300033984\|Ga0334989_0291271	Not Available	871	Open in IMG/M
3300033984\|Ga0334989_0291854	Not Available	870	Open in IMG/M
3300033984\|Ga0334989_0296612	Not Available	861	Open in IMG/M
3300033984\|Ga0334989_0303812	Not Available	848	Open in IMG/M
3300033984\|Ga0334989_0306002	Not Available	844	Open in IMG/M
3300033984\|Ga0334989_0309336	Not Available	838	Open in IMG/M
3300033984\|Ga0334989_0309999	Not Available	837	Open in IMG/M
3300033984\|Ga0334989_0325266	Not Available	811	Open in IMG/M
3300033984\|Ga0334989_0325273	Not Available	811	Open in IMG/M
3300033984\|Ga0334989_0327890	Not Available	807	Open in IMG/M
3300033984\|Ga0334989_0332395	Not Available	800	Open in IMG/M
3300033984\|Ga0334989_0332979	Not Available	799	Open in IMG/M
3300033984\|Ga0334989_0340670	Not Available	787	Open in IMG/M
3300033984\|Ga0334989_0349877	Not Available	773	Open in IMG/M
3300033984\|Ga0334989_0350535	Not Available	772	Open in IMG/M
3300033984\|Ga0334989_0351166	Not Available	771	Open in IMG/M
3300033984\|Ga0334989_0352521	Not Available	769	Open in IMG/M
3300033984\|Ga0334989_0355977	Not Available	764	Open in IMG/M
3300033984\|Ga0334989_0356689	Not Available	763	Open in IMG/M
3300033984\|Ga0334989_0358804	Not Available	760	Open in IMG/M
3300033984\|Ga0334989_0366419	Not Available	749	Open in IMG/M
3300033984\|Ga0334989_0368583	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	746	Open in IMG/M
3300033984\|Ga0334989_0368660	Not Available	746	Open in IMG/M
3300033984\|Ga0334989_0379924	Not Available	731	Open in IMG/M
3300033984\|Ga0334989_0396616	Not Available	710	Open in IMG/M
3300033984\|Ga0334989_0414152	Not Available	689	Open in IMG/M
3300033984\|Ga0334989_0416935	Not Available	686	Open in IMG/M
3300033984\|Ga0334989_0454778	Not Available	646	Open in IMG/M
3300033984\|Ga0334989_0465431	Not Available	636	Open in IMG/M
3300033984\|Ga0334989_0484351	Not Available	618	Open in IMG/M
3300033984\|Ga0334989_0494083	Not Available	609	Open in IMG/M
3300033984\|Ga0334989_0514768	Not Available	591	Open in IMG/M
3300033984\|Ga0334989_0525407	Not Available	582	Open in IMG/M
3300033984\|Ga0334989_0525460	Not Available	582	Open in IMG/M
3300033984\|Ga0334989_0531739	Not Available	577	Open in IMG/M
3300033984\|Ga0334989_0543231	Not Available	568	Open in IMG/M
3300033984\|Ga0334989_0548269	Not Available	564	Open in IMG/M
3300033984\|Ga0334989_0550956	Not Available	562	Open in IMG/M
3300033984\|Ga0334989_0553691	Not Available	560	Open in IMG/M
3300033984\|Ga0334989_0553752	Not Available	560	Open in IMG/M
3300033984\|Ga0334989_0563330	Not Available	553	Open in IMG/M
3300033984\|Ga0334989_0563346	Not Available	553	Open in IMG/M
3300033984\|Ga0334989_0568831	Not Available	550	Open in IMG/M
3300033984\|Ga0334989_0570496	Not Available	548	Open in IMG/M
3300033984\|Ga0334989_0571777	Not Available	547	Open in IMG/M
3300033984\|Ga0334989_0576318	Not Available	544	Open in IMG/M
3300033984\|Ga0334989_0583624	Not Available	539	Open in IMG/M
3300033984\|Ga0334989_0604962	Not Available	525	Open in IMG/M
3300033984\|Ga0334989_0616430	Not Available	518	Open in IMG/M
3300033984\|Ga0334989_0626554	Not Available	512	Open in IMG/M
3300033984\|Ga0334989_0629767	Not Available	510	Open in IMG/M
3300033984\|Ga0334989_0646987	Not Available	500	Open in IMG/M
3300034022\|Ga0335005_0041200	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	3147	Open in IMG/M
3300034022\|Ga0335005_0188816	Not Available	1285	Open in IMG/M
3300034022\|Ga0335005_0201432	Not Available	1234	Open in IMG/M
3300034022\|Ga0335005_0215997	Not Available	1181	Open in IMG/M
3300034022\|Ga0335005_0478356	Not Available	697	Open in IMG/M
3300034022\|Ga0335005_0584785	Not Available	607	Open in IMG/M
3300034022\|Ga0335005_0588992	Not Available	604	Open in IMG/M
3300034064\|Ga0335001_0045928	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	2540	Open in IMG/M
3300034064\|Ga0335001_0233805	Not Available	1018	Open in IMG/M
3300034064\|Ga0335001_0530287	Not Available	623	Open in IMG/M
3300034064\|Ga0335001_0625617	Not Available	564	Open in IMG/M
3300034064\|Ga0335001_0627410	Not Available	563	Open in IMG/M
3300034064\|Ga0335001_0652385	Not Available	550	Open in IMG/M
3300034068\|Ga0334990_0540724	Not Available	617	Open in IMG/M
3300034068\|Ga0334990_0596625	Not Available	580	Open in IMG/M
3300034095\|Ga0335022_0438559	Not Available	696	Open in IMG/M
3300034105\|Ga0335035_0667984	Not Available	538	Open in IMG/M
3300034107\|Ga0335037_0326699	Not Available	833	Open in IMG/M
3300034107\|Ga0335037_0613920	Not Available	573	Open in IMG/M
3300034167\|Ga0335017_0011940	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira pseudonana	4879	Open in IMG/M
3300034167\|Ga0335017_0014901	Not Available	4417	Open in IMG/M
3300034167\|Ga0335017_0017810	Not Available	4074	Open in IMG/M
3300034167\|Ga0335017_0018272	Not Available	4029	Open in IMG/M
3300034167\|Ga0335017_0021413	Not Available	3739	Open in IMG/M
3300034167\|Ga0335017_0027085	Not Available	3344	Open in IMG/M
3300034167\|Ga0335017_0034321	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	2979	Open in IMG/M
3300034167\|Ga0335017_0036589	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Parodontellaceae → Trieres → Trieres chinensis	2887	Open in IMG/M
3300034167\|Ga0335017_0037532	Not Available	2850	Open in IMG/M
3300034167\|Ga0335017_0041366	Not Available	2717	Open in IMG/M
3300034167\|Ga0335017_0045339	Not Available	2594	Open in IMG/M
3300034167\|Ga0335017_0045529	Not Available	2588	Open in IMG/M
3300034167\|Ga0335017_0049815	Not Available	2471	Open in IMG/M
3300034167\|Ga0335017_0051528	Not Available	2429	Open in IMG/M
3300034167\|Ga0335017_0051611	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira → Thalassiosira oceanica	2427	Open in IMG/M
3300034167\|Ga0335017_0059445	Not Available	2256	Open in IMG/M
3300034167\|Ga0335017_0063520	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales	2179	Open in IMG/M
3300034167\|Ga0335017_0069235	Not Available	2082	Open in IMG/M
3300034167\|Ga0335017_0072732	Not Available	2029	Open in IMG/M
3300034167\|Ga0335017_0080608	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1920	Open in IMG/M
3300034167\|Ga0335017_0082709	Not Available	1893	Open in IMG/M
3300034167\|Ga0335017_0083094	Not Available	1888	Open in IMG/M
3300034167\|Ga0335017_0084273	Not Available	1874	Open in IMG/M
3300034167\|Ga0335017_0092828	Not Available	1778	Open in IMG/M
3300034167\|Ga0335017_0109582	Not Available	1622	Open in IMG/M
3300034167\|Ga0335017_0112693	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Thalassiosiraceae → Thalassiosira	1597	Open in IMG/M
3300034167\|Ga0335017_0142447	Not Available	1400	Open in IMG/M
3300034167\|Ga0335017_0171661	Not Available	1256	Open in IMG/M
3300034167\|Ga0335017_0174397	Not Available	1244	Open in IMG/M
3300034167\|Ga0335017_0364461	Not Available	790	Open in IMG/M
3300034167\|Ga0335017_0380115	Not Available	769	Open in IMG/M
3300034167\|Ga0335017_0385659	Not Available	762	Open in IMG/M
3300034167\|Ga0335017_0387116	Not Available	760	Open in IMG/M
3300034167\|Ga0335017_0442303	Not Available	697	Open in IMG/M
3300034167\|Ga0335017_0462530	Not Available	677	Open in IMG/M
3300034167\|Ga0335017_0483061	Not Available	658	Open in IMG/M
3300034167\|Ga0335017_0515545	Not Available	631	Open in IMG/M
3300034167\|Ga0335017_0531601	Not Available	618	Open in IMG/M
3300034167\|Ga0335017_0582963	Not Available	581	Open in IMG/M
3300034167\|Ga0335017_0604640	Not Available	567	Open in IMG/M
3300034167\|Ga0335017_0660015	Not Available	535	Open in IMG/M
3300034167\|Ga0335017_0686945	Not Available	521	Open in IMG/M
3300034168\|Ga0335061_0038178	Not Available	2569	Open in IMG/M
3300034168\|Ga0335061_0104594	Not Available	1508	Open in IMG/M
3300034168\|Ga0335061_0138648	Not Available	1294	Open in IMG/M
3300034168\|Ga0335061_0223778	Not Available	993	Open in IMG/M
3300034168\|Ga0335061_0238876	Not Available	957	Open in IMG/M
3300034168\|Ga0335061_0245540	Not Available	942	Open in IMG/M
3300034168\|Ga0335061_0386906	Not Available	723	Open in IMG/M
3300034168\|Ga0335061_0422090	Not Available	686	Open in IMG/M
3300034168\|Ga0335061_0693992	Not Available	506	Open in IMG/M

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	97.70%
Marine	Environmental → Aquatic → Marine	2.30%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	95.65%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.30%
Lentic	Environmental → Aquatic → Freshwater → Lentic	1.53%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	94.88%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.30%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	1.02%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.77%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.51%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.26%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.26%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	59.85%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	33.76%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	2.30%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.02%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.77%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.51%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.51%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.51%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	0.26%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment	0.26%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.26%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090005	Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300007561	Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3	Environmental	Open in IMG/M
3300007600	Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3	Environmental	Open in IMG/M
3300007629	Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3	Environmental	Open in IMG/M
3300007718	Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3	Environmental	Open in IMG/M
3300008115	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-100-LTR	Environmental	Open in IMG/M
3300008121	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR	Environmental	Open in IMG/M
3300008122	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR	Environmental	Open in IMG/M
3300008263	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR	Environmental	Open in IMG/M
3300008264	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR	Environmental	Open in IMG/M
3300008265	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR	Environmental	Open in IMG/M
3300009002	Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573	Environmental	Open in IMG/M
3300009024	Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705	Environmental	Open in IMG/M
3300009142	Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020505	Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020510	Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021845	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R876 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300027806	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300033984	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034068	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031	Environmental	Open in IMG/M
3300034095	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034107	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133	Environmental	Open in IMG/M
3300034167	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082	Environmental	Open in IMG/M
3300034168	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183	Environmental	Open in IMG/M
3300034355	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135	Environmental	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
LWSO_09475380	2088090005	Freshwater Sediment	MERISGFMRSHYMLPSGVCSRRIGPADAMVITVAVV
Ga0068877_107378811	3300005525	Freshwater Lake	MEHIGGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0079957_12472092	3300005805	Lake	MERIGGFMRSHYMLSSGVCSRRIGPADAMVIVVAVV*
Ga0102914_12824791	3300007561	Estuarine	MEHIGGFMRSHYMPPSGVCSRRIGPADAMVIAVAVV*
Ga0102920_13161551	3300007600	Estuarine	EAHPPMERIIGFMRSHYMLPSGVCSRRIDPADAMVIAVAVV*
Ga0102895_10325442	3300007629	Estuarine	MERINGFMRSHYMLPSGVCSRRIGLADAMVIAVAVV*
Ga0102852_10682051	3300007718	Estuarine	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114348_10168271	3300008115	Freshwater, Plankton	MERIGGFMRSHYMLPSGMCSHRIGPADAMVIAVAVV*
Ga0114348_10189431	3300008115	Freshwater, Plankton	CEPHRPMEHIGGFVQSHYMLPSDVCSRRIGPADAMVIAVAVV*
Ga0114348_10425001	3300008115	Freshwater, Plankton	EPHRPMERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114348_10731451	3300008115	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRRIGPADAMVIAVAVV*
Ga0114348_11297851	3300008115	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPADTMVIAVAVV*
Ga0114356_13553811	3300008121	Freshwater, Plankton	MERIGGFMQSHYMLSSGVCSRRIGPADAMVIAVAVV*
Ga0114359_12821111	3300008122	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAIV*
Ga0114349_10031627	3300008263	Freshwater, Plankton	MERFSGLMQSCYMPSSGVCSRRIGPADAMVIAIAVV*
Ga0114349_10063543	3300008263	Freshwater, Plankton	MERIGGGFMQSHYMPPSGVCSRRIGPADAMVITVTIV*
Ga0114349_10115466	3300008263	Freshwater, Plankton	MERIGGFMQSHYMLPSGVCSRRIGPADAMVIAVAIV*
Ga0114349_10123617	3300008263	Freshwater, Plankton	DAHRLMERIGGFMRSHYMPPSGVCSRRIGPADAIVIAVAVGQNTTQNTTFN*
Ga0114349_10136911	3300008263	Freshwater, Plankton	MERIGGFMQSRNMLPLGKCSRRIGSADTIVIAVAVV*
Ga0114349_10202272	3300008263	Freshwater, Plankton	MERIGGFMQSHYMPPSGVCSRRIGPADTMVIVIAVV*
Ga0114349_10216052	3300008263	Freshwater, Plankton	MERIGGFMRSHYMPPSGMCSRRIGPADAMVIAVTVV*
Ga0114349_10223646	3300008263	Freshwater, Plankton	MEHIGGFMRSYYMLSSGECSSRIGPVDIMVVAIAIV*
Ga0114349_10228922	3300008263	Freshwater, Plankton	MERNGGFMQSHYVPPSGVCLRRIGPADAMVIAIAVV*
Ga0114349_10234477	3300008263	Freshwater, Plankton	MECIDGFMQSRYMLPSGECSRCIGLADAIMVITNAITVM*
Ga0114349_10254002	3300008263	Freshwater, Plankton	MERIGGFMQSHYMPPSSVCLRRIGPANAMVIAVAVV*
Ga0114349_10273461	3300008263	Freshwater, Plankton	MEHIGGFMRSHYMLPLGVCSRRIGPADAMVIAVAVV*
Ga0114349_10289891	3300008263	Freshwater, Plankton	MERIGGFMRSHFMPPSGVCSRCIGLADAMVIAVTVV*
Ga0114349_10470971	3300008263	Freshwater, Plankton	MERIGGFMQSSYMLPSGKCLRPIGPADAMVIAIAVV*
Ga0114349_10482712	3300008263	Freshwater, Plankton	MERISGFMQSHHMLQSGVCSRSIGPADAMVIAIAVM*
Ga0114349_10488322	3300008263	Freshwater, Plankton	MERVGGFMRSHYMPPSGVCSRRIGPADAMVIAIAVV*
Ga0114349_10505453	3300008263	Freshwater, Plankton	MERISGFMRSHYMLPAGVCLRRIGPADTMVIAVAVV*
Ga0114349_10554554	3300008263	Freshwater, Plankton	RREAHRPMERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114349_10594084	3300008263	Freshwater, Plankton	MEHISGFMRSHYMLPLSVCPHRIGPADAMVIAVAVM*
Ga0114349_10596673	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRISPADTMVIAVAVV*
Ga0114349_10646881	3300008263	Freshwater, Plankton	MERIGGFMLSHYMLPSGVCSRRIGPADTMVIAVAVV*
Ga0114349_10686671	3300008263	Freshwater, Plankton	HRPMERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAIV*
Ga0114349_10732851	3300008263	Freshwater, Plankton	MEHIGGFMRSHYMPPSGVCSRGIGPVDAMVIAIAVAVV*
Ga0114349_10741511	3300008263	Freshwater, Plankton	MERIGGFMQNHYMPPSGVCSRRIGPADAMVNAVAVV*
Ga0114349_10754183	3300008263	Freshwater, Plankton	MERISGFMQSHYMLSSGVCSRRIGPADAMVIAVAVV*
Ga0114349_10761141	3300008263	Freshwater, Plankton	MERIGGFMRSHYMPPSGMCSRRISPADAMVIAVAIM*
Ga0114349_10822421	3300008263	Freshwater, Plankton	MERIGGFMRSHLIAPSGVCSRRIGPANAMVIAIAVV*
Ga0114349_10833391	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLQSGVCSRRIGPADAMVIAVAVV*
Ga0114349_10848971	3300008263	Freshwater, Plankton	MERFDGFMGSHSMPPSGVCSRRIGLADAMVIAVAIV*
Ga0114349_10853432	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCLRRIGPADAMVIAVAVV*
Ga0114349_10919304	3300008263	Freshwater, Plankton	MEHIGGFMQSHYMPPSGVCLRRIGPTDAMVITFAVV*
Ga0114349_10923541	3300008263	Freshwater, Plankton	MEHISGFMRSHYMLPSGMCSRRIGPADAMVIAIAVV*
Ga0114349_10954702	3300008263	Freshwater, Plankton	MERIGDFMRSHYIAPLGVCLRRISPADAVVIAIAVGQNTTQNTTFS*
Ga0114349_10958621	3300008263	Freshwater, Plankton	MERIGGFMQSHYMLPSGVCSRCIGTTDAMVIAVAIV*
Ga0114349_10989501	3300008263	Freshwater, Plankton	HHPIKRIGGFMRSHYMPPSGVCSRRIGPADAMVIAVAIGRNTTQNTTFS*
Ga0114349_10995692	3300008263	Freshwater, Plankton	MERIGGFMGSHYMLPSGVRSRCIGPTDAMVIAVTIV*
Ga0114349_11103852	3300008263	Freshwater, Plankton	MEHISGFMRSHYMLPSGVCPRRIGPADAMVIAVAVV*
Ga0114349_11317952	3300008263	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRRIGPADAMVIVVAVV
Ga0114349_11424141	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLTSGVCSHRIGPADAMVIAIAVGQNTTQNTTFS*
Ga0114349_11481761	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLPSGACSRCIGPAGAMVIAIAVV*
Ga0114349_11633632	3300008263	Freshwater, Plankton	MERIGGFMQSHFMSPLGVCSRRIGPADAMVIAVAIV*
Ga0114349_11706471	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLPLGVCLRRIGPADAMVIAVAIV*
Ga0114349_11706931	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLTSGMRSRRIGPADAMVIAIAVGQNTTQNTTFS*
Ga0114349_11885671	3300008263	Freshwater, Plankton	MEHISGFMRSHYMLPSGVCSRRIGPADAMVIAIAVV*
Ga0114349_12008281	3300008263	Freshwater, Plankton	ERIGGFMRSHYMPPSGVCSRRIGPADAMVIAVAVV*
Ga0114349_12136811	3300008263	Freshwater, Plankton	REAHRPMERISGFMRSHYMLPSGVCSRRIGPADAMVIAIAVV*
Ga0114349_12143752	3300008263	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAIAVGQNTTQNTTFS*
Ga0114349_12162731	3300008263	Freshwater, Plankton	HRPMERISGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114349_12411481	3300008263	Freshwater, Plankton	MEHIGGFMRSHYMLPLGVCSRRIRPADAMVIAVAVV*
Ga0114349_12639551	3300008263	Freshwater, Plankton	MERISGFMRSHYTPPSGVCSRRIGPADAMVIAVAIV*
Ga0114349_12828702	3300008263	Freshwater, Plankton	MERISGFMRSHYMMPLGVCSRRIGPADAMVIAVTVV*
Ga0114353_13512661	3300008264	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPVDAMVIAVAVV*
Ga0114353_13547712	3300008264	Freshwater, Plankton	MERISGFMRSHYMLTSGVCSRRIGPADAMVIAVAIV*
Ga0114361_10006722	3300008265	Freshwater, Plankton	MVEAHRPMEHISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114361_10027255	3300008265	Freshwater, Plankton	MERIGGFMQSHYMPPSGVCSRRIGPADVMVIAVAVV*
Ga0114361_100274612	3300008265	Freshwater, Plankton	MERIGGFMQSHYLLPSGVCSRCIGPTDAMVIAVAIV*
Ga0114361_10036532	3300008265	Freshwater, Plankton	MERISGFMRSHNMLSSGVFSRRIGLANAMVIAVAIV*
Ga0114361_10043765	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGMCSRRIGPADAMVIAVTVV*
Ga0114361_10046572	3300008265	Freshwater, Plankton	MERIVGFMRSHYMPPSGVCSRRIGPANAMFIIVAVV*
Ga0114361_10048037	3300008265	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRRIGPADVMVIAIAVV*
Ga0114361_10055261	3300008265	Freshwater, Plankton	MECIDGFMQSHYMPPSGVCLRRIGPADAKVIAVTAV*
Ga0114361_10055652	3300008265	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRRIGPADAVVITVAVV*
Ga0114361_10067521	3300008265	Freshwater, Plankton	MERISGFMRSQYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114361_10077271	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRRIDLADAMVIAVTVVQNTTQNTTFS*
Ga0114361_10090991	3300008265	Freshwater, Plankton	MEHISGFMRSHYMLPSGVCLRRIGLADAMVIAVAVV*
Ga0114361_10099634	3300008265	Freshwater, Plankton	MERISGFMHSHYMLPLGVCSRRIGLADAMVIAIAVVQNTTQNTTFS*
Ga0114361_10105832	3300008265	Freshwater, Plankton	MERISGFMRSHYMLLSGECSRRIGLADAMVIAVAIV*
Ga0114361_10105871	3300008265	Freshwater, Plankton	PMERIGGFMRSHYMPPSGVCSRRIGLADAMVIAVAVV*
Ga0114361_10119627	3300008265	Freshwater, Plankton	MEHIGGFMRSHYMPPSGVCSRHISPADAMVIAVAVV*
Ga0114361_10142371	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCPRRIGPADAMVIAIAVM*
Ga0114361_10145444	3300008265	Freshwater, Plankton	MERIGGFMRSHCMLPSGVWSRRIGPADAMVIAVVVV*
Ga0114361_10145925	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSQRIGPADAMVIAIAVVQNTPQNTTFS*
Ga0114361_10156804	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRNGPADAMVIAVAVV*
Ga0114361_10165032	3300008265	Freshwater, Plankton	MERTSGFMQSHYMLPSGMCSRRIGPADAMVIAVAVVSKHNTKHNF*
Ga0114361_10177616	3300008265	Freshwater, Plankton	MEHIGGFMRSHYMPPSGMFSRRIGPEDAMVIAVAVVWKTHTKHNF*
Ga0114361_10205501	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAIM*
Ga0114361_10212371	3300008265	Freshwater, Plankton	MERISGFMQSHYMLPSGVCSRRIGPADAMVIAIAVV*
Ga0114361_10225115	3300008265	Freshwater, Plankton	REPHRPMERIGGFMRSHYMLPSGVCSRRIGPADAMVIAISIV*
Ga0114361_10255403	3300008265	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRHIGPADAMVIAVAVV*
Ga0114361_10272241	3300008265	Freshwater, Plankton	REPHRPMERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVTVV*
Ga0114361_10272705	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSHRIGLADAMVIAVAIM*
Ga0114361_10301771	3300008265	Freshwater, Plankton	MERISGIMRSHYMLPLGVCSRRIGPADAMVIAVAVV*
Ga0114361_10314912	3300008265	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRRIGPAVAMVIAVAVVSKHNTKHNF*
Ga0114361_10329844	3300008265	Freshwater, Plankton	EAHRPIKRIGGFMRSHYMPPSGVCSRRIGPADAMVIAVAIGRNTTQNTTFS*
Ga0114361_10345451	3300008265	Freshwater, Plankton	MERIGDFMQSHYIAPLGVCLRRISPADAVVIAIAVGQNTTQNTTFS*
Ga0114361_10395352	3300008265	Freshwater, Plankton	MEHIGGFMQSHYMLPSGVCSRRIGPADTMVIAVAVV*
Ga0114361_10421873	3300008265	Freshwater, Plankton	MERIGGFMQSHYMPPSGMCSRRIGPADAMVIAAAVV*
Ga0114361_10429791	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAIV*
Ga0114361_10476291	3300008265	Freshwater, Plankton	MERISGFMQSHYMLPSGVCLRRIGPADAMVIAVVVV*
Ga0114361_10494572	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCLRRIGPADAMVIAIAVM*
Ga0114361_10568451	3300008265	Freshwater, Plankton	MERISGFMQSHYMLPSGVCSRRIGPADAMVIAVAVVRNTTQNTTFS*
Ga0114361_10651131	3300008265	Freshwater, Plankton	MERIGGFMQSHFMSPLGLCSRRIGPADAMVIAVAIV*
Ga0114361_10679991	3300008265	Freshwater, Plankton	MERISGFMQSHYMLPSGVCSRRIGLADTMVITIAVV*
Ga0114361_10689812	3300008265	Freshwater, Plankton	MERISGFMRSHYMLSSGVCSRRIGPADAMVIAFAVV*
Ga0114361_10700742	3300008265	Freshwater, Plankton	MEHIGGFMRSHYMLPSGVCSRRIGPVDAMVIDVAVV*
Ga0114361_10729441	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCLRRIGPADAMVIAVAVL*
Ga0114361_10763282	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRRIGPADAMVIVVAVVSKHNTKHNF*
Ga0114361_10829202	3300008265	Freshwater, Plankton	MECIGGFMRSHYMLPSGVCSRRIGPADAMVIAIGVV*
Ga0114361_10831642	3300008265	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRCTGPADAMVIAIAVV*
Ga0114361_10831931	3300008265	Freshwater, Plankton	MERISGFMQSHYMLPLGMCPRRIGPADAMVIASHTQNTTFS*
Ga0114361_10834822	3300008265	Freshwater, Plankton	MERIGGFMQSHYMPPSGVCSRRIGPADAMVIVVAVVSKHNTKHNF*
Ga0114361_10902602	3300008265	Freshwater, Plankton	MERIGGFMRSHCMPPSGVCSRRIGPADTMVIAIAVM*
Ga0114361_10920751	3300008265	Freshwater, Plankton	MEHIGGFMQSHYMLPSGVCSRRIGPVDTMVIAVAIV*
Ga0114361_10921231	3300008265	Freshwater, Plankton	MERIGGFMRSHYVPPSGVCSRRIGPADAMGIAVTVV*
Ga0114361_10975171	3300008265	Freshwater, Plankton	MELIGGFMQSHKIAPSGVCLRRIGPADAMVIAVAVV*
Ga0114361_11009762	3300008265	Freshwater, Plankton	MERIGGFMQSHYMLPLGVCSRHIGPADTMLIAVAVV*
Ga0114361_11065702	3300008265	Freshwater, Plankton	MERISGFMQSHYMLPSGVCSRRIVPVDAMVIAVAVV*
Ga0114361_11113522	3300008265	Freshwater, Plankton	MEHIGGFMRSHYMPPSGVCLHRIGPADAMVIAVAVV*
Ga0114361_11250171	3300008265	Freshwater, Plankton	RREAHRPMEHISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114361_11353881	3300008265	Freshwater, Plankton	MERIGGFMRSHYMPPSGVCSRRIGPADAMVIAIAVV*
Ga0114361_11454941	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGLCSRRIGPADAMVIAIAVGQNTTQNTTFS*
Ga0114361_11459931	3300008265	Freshwater, Plankton	MERIGGFMRSHYLPPSGVCSRRIGPADAMVIVVAVV*
Ga0114361_11572002	3300008265	Freshwater, Plankton	MERISGFMQSHYMPPSGVCSRRIGPADAVVIIVAIV*
Ga0114361_11603111	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPADTMVIAIAVV*
Ga0114361_11913202	3300008265	Freshwater, Plankton	REAHRPMERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114361_11957442	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRHIGPADAMVIVVAVVSEHNTKHNF*
Ga0114361_11972741	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPADVMVIAVAVV*
Ga0114361_12027651	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRCIGPMDAMVIAITIV*
Ga0114361_12256871	3300008265	Freshwater, Plankton	MERIGSFMRSHYMLPSGVCSRRIGLADAMVIAVAIV*
Ga0114361_12401751	3300008265	Freshwater, Plankton	MERIGGFMQSHYMLPSGMCSRRIGPADAMVIAVAVV*
Ga0114361_12460581	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRHIGPADAMVIAVAVM*
Ga0114361_12511221	3300008265	Freshwater, Plankton	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVVQNTTQNTTFS*
Ga0114361_12514201	3300008265	Freshwater, Plankton	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAIAVV*
Ga0114361_12661432	3300008265	Freshwater, Plankton	MEHIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV*
Ga0114361_12718652	3300008265	Freshwater, Plankton	HRPMERISGFMQSHNMLPSGMCSRRIGPADAMVIAVAVV*
Ga0102810_11892312	3300009002	Estuarine	MERIGGFMRSHYMLPSGMCSRRIGPADAMVIAIAVGQNTTQNTTFS*
Ga0102811_12276901	3300009024	Estuarine	MERIGGFMRSHYMPPSGVCSRRIGPADAMVIAVAVVSQNTTFS*
Ga0102885_10831521	3300009142	Estuarine	MERIGGFMRSHYMPPSGVCSRRIGPADAMVIVVAVV*
Ga0164292_108635622	3300013005	Freshwater	MERISGFMRSHYMLPLGMCSRRIGPADAMVIAVAVV*
Ga0177922_101608522	3300013372	Freshwater	MERIGGFMRSHYMLPSGMCLRRIGPADAMVIAVAVV*
Ga0177922_111370862	3300013372	Freshwater	MERIGGFMQSHYMLSSGVCSRLIGPADAMVIVVAVV*
Ga0207193_11216952	3300020048	Freshwater Lake Sediment	MERFDGFMGSHSMPPSGVCSRRIGPADAMVIAVAVV
Ga0207193_11376701	3300020048	Freshwater Lake Sediment	MERIGGFMRSRYMPPSGECSRRIGTADAMLIAVTVV
Ga0207193_15141531	3300020048	Freshwater Lake Sediment	PMERISGFMQSHYMLPSGVCSRRIGPADTMVNAAAIV
Ga0211733_104307642	3300020160	Freshwater	MERIGGFMRSHHMLSSGVCSRRIGPADAMVIVVAVV
Ga0211731_107248851	3300020205	Freshwater	MEHIGGFMRSHYMPPSGMCSRRIGPADAMVIAVAVV
Ga0208088_10270181	3300020505	Freshwater	MERIGGFMQSQYMPPSGMCSCRIGPADAMVIAVAVV
Ga0208088_10410991	3300020505	Freshwater	MKRIGGFMRSHYMLPSGVCSRRISPADAMVIAIAVGQNTTQNTTFS
Ga0208086_10242542	3300020510	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIVVAVV
Ga0210297_10196292	3300021845	Estuarine	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAVAVDQN
Ga0244777_108358691	3300024343	Estuarine	MERIGGFMRSHYILPSGVCSRRIGPADAMVIAVAVGQNTTQNT
Ga0209985_103073871	3300027806	Freshwater Lake	MERIGGFMRSHYMLSSGVCSRRIGPADAMVIVVAVV
Ga0315907_107924111	3300031758	Freshwater	MERISGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0315905_115631011	3300032092	Freshwater	MERIGGFMRSRQMLPSGVCSRRIGPADAMVIVVVVVSKHEQNTTFS
Ga0334989_0001064_1139_1279	3300033984	Freshwater	MEHIGGFMRSHYIAPSGVCSRRISLADAMVIAIAVGQNTTQNTTFS
Ga0334989_0002031_4045_4155	3300033984	Freshwater	MERISGFMRSHNMLPSGVCSRRIGPTDAMVIAVAVV
Ga0334989_0003466_7536_7646	3300033984	Freshwater	MEHIGGFMQSHYIAPSGVCSRHIGPADAMVIAVAVV
Ga0334989_0003603_7315_7425	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAIV
Ga0334989_0004998_6387_6497	3300033984	Freshwater	MELISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0005764_2712_2822	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAAAVV
Ga0334989_0006752_384_494	3300033984	Freshwater	MERIGGFMQSHYMPPSGMCSRRIGPADAMVIAVAGV
Ga0334989_0007195_4526_4636	3300033984	Freshwater	MERISGFMRSHYMLPLGVCSRRIGPADAMVIAVAIV
Ga0334989_0007261_3339_3449	3300033984	Freshwater	MERISGFMRSHYMLPSGVCLRHIGPADTMVIAVAVV
Ga0334989_0007877_114_224	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRISPADAMVIAIAVV
Ga0334989_0010438_2580_2690	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIKPADAMVIAVAVV
Ga0334989_0012422_2086_2196	3300033984	Freshwater	MERIGGFMRSHYMPPSGMCSHCISPADAMVIAVTVV
Ga0334989_0013681_3553_3663	3300033984	Freshwater	MERIGGFMRSHYMLRSGVCSRRIGPADAMVIAIAVM
Ga0334989_0013817_1303_1413	3300033984	Freshwater	MERISGFMQSHYMLPPGVCLRRIGPADAMVIAVAVV
Ga0334989_0015443_2964_3074	3300033984	Freshwater	MEHIGGFMQSHYMPPSGVCLRRIGPADAMVIAIAVV
Ga0334989_0016626_1954_2064	3300033984	Freshwater	MERIGGFMQSHYMPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0017357_162_272	3300033984	Freshwater	MERISGFMRSPYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0017640_1354_1464	3300033984	Freshwater	MERIGGFMQSHYMPPLGVCSRRISPADAMVIAVAVV
Ga0334989_0018007_1215_1325	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPANAMVIAVAVV
Ga0334989_0018740_3309_3419	3300033984	Freshwater	MERIGDFMRSHYMLPSGVCLRRIGPADAMVIAIAVV
Ga0334989_0019511_328_438	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPVDAMVIAVAVV
Ga0334989_0019731_656_766	3300033984	Freshwater	MEHISGFMRSNYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0020580_3317_3427	3300033984	Freshwater	MERIIGFMQSHYMLPSGVYSHRIGPADAMVIAVAVV
Ga0334989_0022897_29_169	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAVTVGQNTTQNTTFS
Ga0334989_0024449_547_657	3300033984	Freshwater	MKRIGGFMQSHNMLPSGECSRPIGPANDMVINITVV
Ga0334989_0025126_562_672	3300033984	Freshwater	MERISGFMRSHYKPPSGVCSRRIGPADAMVIAVTVV
Ga0334989_0025730_940_1080	3300033984	Freshwater	MKRISGFMRSHYTPPSGVCLRRIGPADAMVIAVAVGQKTTQNTTFS
Ga0334989_0026366_320_430	3300033984	Freshwater	MERISGFMQSHYKPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0027870_2788_2898	3300033984	Freshwater	MERIGGFMRSHYMLPSGMCSGRIGPADAMVIAVAVV
Ga0334989_0028336_1012_1173	3300033984	Freshwater	MECIGGFMRSHYMLPSGVCSRRIGPADAMVIAVTVGLNATQNTTFSKFIVLFY
Ga0334989_0028336_267_377	3300033984	Freshwater	MEHISGFMRSHYMLPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0028932_2123_2233	3300033984	Freshwater	MERIIGFMQSHYMLPSGVCSRRIGPADAMVIAIAVV
Ga0334989_0034455_792_902	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSHRIGSADAMVIAVAVV
Ga0334989_0034674_1363_1473	3300033984	Freshwater	MERIIGFMRSHFMLPSGVCSRRIGPADAMVIVVAIV
Ga0334989_0036483_2287_2397	3300033984	Freshwater	MERITGFMRSHYTPPLGVCSRRIGPADAMVIAVAVV
Ga0334989_0039998_1795_1905	3300033984	Freshwater	MERFGGFMRSHYMPPSGVCSRRIGLAGAMVIAVAVA
Ga0334989_0040221_1781_1891	3300033984	Freshwater	MELIIGFMRSHYMLPSGVCLRRIGPADARVIAVAVV
Ga0334989_0040417_2289_2399	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAGV
Ga0334989_0041622_1993_2103	3300033984	Freshwater	MDRISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVM
Ga0334989_0041647_636_746	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVITVAVV
Ga0334989_0042832_1982_2119	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAVAVGVKHNTKHNF
Ga0334989_0045217_340_450	3300033984	Freshwater	MERISGFMRSHFMLPSGVCSRRIGPADAMVIDVAVV
Ga0334989_0046584_966_1106	3300033984	Freshwater	MKRISGFMRSYYTPPSGVCSRRIGPADAMVIAIAVGQKTTQNTTFS
Ga0334989_0046884_8_118	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPVDAMVIAVAVM
Ga0334989_0047131_1910_2050	3300033984	Freshwater	MERIGGFMQSHYIAPLGVCLRRISPADAMVITVAVGLNTTQNTTFS
Ga0334989_0048119_741_851	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSLRIGLVDAMVIAVAVV
Ga0334989_0049130_2035_2145	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPADAMIIAVAVV
Ga0334989_0052913_1812_1922	3300033984	Freshwater	MERIIGFMQSHYMLPSGVCSRRIGPADAMVITVAVV
Ga0334989_0055037_263_373	3300033984	Freshwater	MERMIGFMPSHYMLPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0056909_50_160	3300033984	Freshwater	MKRISGFMRSHYMLPSGVCSHRIGSADAMVIAVAVV
Ga0334989_0057366_169_279	3300033984	Freshwater	MERFDGFMGSHSMPPSGVCLRRIGPADAMVIAVAIV
Ga0334989_0061897_1804_1914	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCPRRIGPADAMVIAVAVV
Ga0334989_0063172_1221_1361	3300033984	Freshwater	MERISGFMRSHYKPPLGVCSRRIGPANAMDIAIAVGQNTTQNTTFS
Ga0334989_0064086_1591_1701	3300033984	Freshwater	MERIGGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0071419_1639_1749	3300033984	Freshwater	MERISGFMRSHYMLASGVCSHRIGPADAMVIAVADV
Ga0334989_0074149_336_446	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVITIAVV
Ga0334989_0074312_1682_1792	3300033984	Freshwater	MERIGGFMRSHYMPPSGVCSRRIGPVDAMVIAVAVV
Ga0334989_0078201_1418_1558	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPANAMVIAVAVGQNTTQNTIFS
Ga0334989_0080670_944_1054	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPANAMVIAIAVV
Ga0334989_0081167_1_141	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334989_0087166_1079_1189	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCLRRIGPADAMVITVAVV
Ga0334989_0088357_1590_1700	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0090279_184_294	3300033984	Freshwater	MERISGFMRSHYMPPSVVCSRRIGPADAMVIDVAVV
Ga0334989_0092794_500_610	3300033984	Freshwater	MERISGFMRSHYTPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0096800_1498_1608	3300033984	Freshwater	MEHIIGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0099700_1488_1598	3300033984	Freshwater	MERISGFMQSHYMPPSGVCSRRIGLADAMVIAVAVV
Ga0334989_0099808_18_128	3300033984	Freshwater	MERIGGFMQSHYMPPSGVCSRCIGPADAMVIAVAVV
Ga0334989_0101473_1329_1439	3300033984	Freshwater	MEHISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0102969_432_542	3300033984	Freshwater	MEHIGGFMRSHNMPPSGVCSRRIGPADAMVIAIAVV
Ga0334989_0103419_781_891	3300033984	Freshwater	MERISGFMRSQYMLPSGVCSRCIGPTDAMVIAVAIV
Ga0334989_0105537_1388_1498	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPADVMVIAVAVV
Ga0334989_0107170_1339_1449	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0107603_1302_1412	3300033984	Freshwater	MERIIGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0109620_302_412	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSCRIGPADAMVITVAVV
Ga0334989_0110044_51_161	3300033984	Freshwater	MEHISGFMRSHNMLPSGVCSRRIGPADPMVIAVAVV
Ga0334989_0120719_224_334	3300033984	Freshwater	MERISGFMQSHYKPPSGVCSRSIGPADAMVIAVAVV
Ga0334989_0122113_1141_1251	3300033984	Freshwater	MERISGFMRSPYKPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0124852_1058_1168	3300033984	Freshwater	MERISGFMRSHYTPPSSVCSRRIGPADAMVIAVAVM
Ga0334989_0130781_171_281	3300033984	Freshwater	MERIVGFMRRHYMVPSGECSRRIGPADAMVVAIAVV
Ga0334989_0134473_512_622	3300033984	Freshwater	MERIGGFLQSHYMPPSGVCSRRISPADAMVIAVAVV
Ga0334989_0139581_1156_1266	3300033984	Freshwater	MERIGGFMQSHYIAPLGVCSCHIGLADGMVIAVVVV
Ga0334989_0141040_703_813	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAISVV
Ga0334989_0145571_143_253	3300033984	Freshwater	MERISGFMQSHYMLPSGVCSRRIGPADAMVIAVTVV
Ga0334989_0155656_2_142	3300033984	Freshwater	MDRIGGFMRSHYMLPSGMCSRRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334989_0156793_267_377	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAVAIV
Ga0334989_0164189_746_856	3300033984	Freshwater	MERFDGFMGSHSMPPSGVCLRRIGPADALVITIAIV
Ga0334989_0165806_269_409	3300033984	Freshwater	MERISGFMQSHYMPPSGVCSRRIGPADAMVITVAVVRKHTQNTTFS
Ga0334989_0170754_1060_1170	3300033984	Freshwater	MERIIGFMRSHYMLPSSVCSRRIGPADAMVIAVAVV
Ga0334989_0170760_1061_1171	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSGRIGPADAMVIAVAVV
Ga0334989_0171725_913_1023	3300033984	Freshwater	MERISGFMRSHYKPPSGMCSRRIGPADAMVIAVAVV
Ga0334989_0173014_551_691	3300033984	Freshwater	MERIGGFMRSHYIAPLGVCSRRIGPADAVVIAIAVGQNTTQNTTFS
Ga0334989_0180005_849_959	3300033984	Freshwater	MERISGFMRSHYKPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0183190_51_161	3300033984	Freshwater	MERISGFMQSHYMLPSGVCLRRIGPADAMVIAVTVV
Ga0334989_0189787_851_961	3300033984	Freshwater	MERIGGFMQSHYKPPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0191859_15_125	3300033984	Freshwater	MEHISGFMQSHYMLPLGVCLRRIGPADAMVVAVAVL
Ga0334989_0207281_262_372	3300033984	Freshwater	MEHISGFMQSYYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0207965_64_174	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCLRRIGMADAMVIAVAVV
Ga0334989_0210809_619_729	3300033984	Freshwater	MEHIIGFMRSHYMLPSGVCSRHIGPADAMVIAVAVV
Ga0334989_0216488_302_412	3300033984	Freshwater	MERIIGFMRSHYMLQLGVCSRRIGPADAMVIAVAVV
Ga0334989_0221775_846_956	3300033984	Freshwater	MERISGFMQSHYMLPSGVCSRCIGPADAMVIAVAVV
Ga0334989_0222189_17_157	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334989_0222224_473_613	3300033984	Freshwater	MERIGGFKRSHLIPPSGVCSCRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334989_0248330_594_704	3300033984	Freshwater	MERISGFMRSHYMLPSGVCLRRISPVEAMVIAVAVV
Ga0334989_0250484_703_813	3300033984	Freshwater	MELIIGFMRSHYMLPSGVCSRRISPADAMVIAVAVV
Ga0334989_0260121_529_639	3300033984	Freshwater	MERISGFMRSQYKPPLGMCSRRIGPADAMVIDVAVV
Ga0334989_0268945_461_571	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRCIGPADTMVIAVAVV
Ga0334989_0273122_760_870	3300033984	Freshwater	MERISGFMRSHYTPPSGVCSRRIGLADAMVIAVAVV
Ga0334989_0287254_486_620	3300033984	Freshwater	MERIGGFMRSHYKPPSGVCSRRIGPADAMVIAVAVVVAFIVLFT
Ga0334989_0288750_146_256	3300033984	Freshwater	MERISGFMRSHYKMPSGVCSRHIGPADAMVIAVAVV
Ga0334989_0291271_437_547	3300033984	Freshwater	MERIGGFMRSHYMLPFGVCSRRIGPADAMVIAVAVM
Ga0334989_0291854_591_701	3300033984	Freshwater	MERISGFMRSHYMLPSGVFSRRIGPADAMVIAVAVM
Ga0334989_0296612_77_187	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0303812_303_443	3300033984	Freshwater	MEHIGGFMQSHYMLPSGVCSRRIGPADAMVITVAVGQNTTQNTTFS
Ga0334989_0306002_421_531	3300033984	Freshwater	MERISGFMQSHYMLPSGVCSRRIGPADAVVIAVAVV
Ga0334989_0309336_16_126	3300033984	Freshwater	MERIGGFTRSHHMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0309999_479_589	3300033984	Freshwater	MEHISDFMRSHYTPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0325266_315_449	3300033984	Freshwater	MRREAHRPMERIIGFMRSHYMLPLGVCSRRIGPADAMVIAVAVV
Ga0334989_0325273_50_160	3300033984	Freshwater	MERIGGFMQSHSIAPLGVCSCRIGPADAMVIAIAVE
Ga0334989_0327890_451_561	3300033984	Freshwater	MERIGGFMRSHNMPPSGVFSRRIGPADAMVIAIAVV
Ga0334989_0332395_400_510	3300033984	Freshwater	MERISGFMQSHYMLPSGVCSCLIGLMDAMVIAIAVM
Ga0334989_0332979_312_422	3300033984	Freshwater	MERISGFMRSQYMLPSGVCSRRIGPAYTMVIAVAVE
Ga0334989_0340670_671_781	3300033984	Freshwater	MERISGFMQSHYMLPPGVCSRRIGPADAMVIAIAVV
Ga0334989_0349877_328_441	3300033984	Freshwater	MECISGFMRSHYMLPFLGVCSRRIGPADAMVIAIAVV
Ga0334989_0350535_268_378	3300033984	Freshwater	MDRISGFMRSHYTLPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0351166_216_326	3300033984	Freshwater	MEHIVGFMRSHYMLPSGVCLRRIGPADAMVIAIAVV
Ga0334989_0352521_194_304	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAIAVV
Ga0334989_0355977_124_234	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVISVAVV
Ga0334989_0356689_537_647	3300033984	Freshwater	MERISGFMRSQKIAPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0358804_467_577	3300033984	Freshwater	MERIGGFMQGHYMLPSGVCLCRIDPADAMVIAVAVV
Ga0334989_0366419_96_206	3300033984	Freshwater	MKRIGGFMQSHYMLPSGECSRPIGPADDMVINITVV
Ga0334989_0368583_577_687	3300033984	Freshwater	MERIGGFMRSHHMLPSGVCSRRIGPADAMVITVTVV
Ga0334989_0368660_482_592	3300033984	Freshwater	MERIGGFMQSHYMLPSGVCSRRIGPTDAMVIAIAVV
Ga0334989_0379924_572_712	3300033984	Freshwater	MELIGGFMRSHKIAPSGVCSHRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334989_0396616_341_451	3300033984	Freshwater	MERISGVMRSHYMLPSGVCSRRIGPADAMVIAIAVV
Ga0334989_0414152_563_673	3300033984	Freshwater	MERISGFMQSHYMLPSVVCSRRIGPADAMVIAVAVV
Ga0334989_0416935_397_507	3300033984	Freshwater	MEHISGFMQSHYMLPSGVCSRRIGPADAMVIAVAIV
Ga0334989_0454778_466_576	3300033984	Freshwater	MERISGFMRSHYMLPSGVCLRRIGPSDAMVIAVAIV
Ga0334989_0465431_337_447	3300033984	Freshwater	MERIGGFMQSHYMLPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0484351_52_162	3300033984	Freshwater	MEHIVGFMRSHFMLPSGVCSRRIGPADAMVIAIAVV
Ga0334989_0494083_26_136	3300033984	Freshwater	MERISGFMLSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0514768_449_559	3300033984	Freshwater	MERISGFMQSHYMLPSGMCSRHIGPADAMVIAVAVV
Ga0334989_0525407_288_398	3300033984	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPADAIVIAVAIV
Ga0334989_0525460_386_496	3300033984	Freshwater	MEHISGFMRSHYMLPLGMCSRRIGPADAMVIAVAVV
Ga0334989_0531739_352_462	3300033984	Freshwater	MERISGFMQSHYMLPLGVCSRRIGPADAMVIAVTVV
Ga0334989_0543231_16_123	3300033984	Freshwater	MERISGFMQSHYKPPSGVCSRRIGPADAMVIAAVV
Ga0334989_0548269_228_338	3300033984	Freshwater	MERIVGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0550956_42_152	3300033984	Freshwater	MGRIGGFMRSHYMLPSGVCLRRIGPADAMVIAVAVV
Ga0334989_0553691_412_522	3300033984	Freshwater	MERISGFMRSHYMLPSGVCSRRISPADAMVIAVAVM
Ga0334989_0553752_25_135	3300033984	Freshwater	MEHISGFMRSHYKPPSGVCSRRIGPADAMVIAVAVV
Ga0334989_0563330_156_266	3300033984	Freshwater	MERIIGFMRSHCMLPSGVCSRRIGPADAMVIAIAVV
Ga0334989_0563346_351_461	3300033984	Freshwater	MEHIGGFMRSHYIAPSGVCSRRIGPADAMVINIAVV
Ga0334989_0568831_43_153	3300033984	Freshwater	MERISGFMRSHYMLPSGMCSRRIGPADAMVIAVAVV
Ga0334989_0570496_126_236	3300033984	Freshwater	MERIIGFMRSHYMLPSGVFSRRIGPADAMVIAIAVV
Ga0334989_0571777_194_304	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRLIGAADAMVIAVAVV
Ga0334989_0576318_343_483	3300033984	Freshwater	MKRIGGFMRSHYMLTSGVCSRRIGLADAMVITIAVGQNTTQNTTFS
Ga0334989_0583624_244_354	3300033984	Freshwater	MECIIGFMRSHYMLPSGVCSRLIGVADAMVIAVAVV
Ga0334989_0604962_330_470	3300033984	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334989_0616430_33_149	3300033984	Freshwater	MERISGFMQSHYMLPSGVCSRRIGPADAMVIAHTKHNF
Ga0334989_0626554_18_128	3300033984	Freshwater	MERIGDFMRSHYMLPSGVCSCRIGPADAMVIAVAVV
Ga0334989_0629767_155_265	3300033984	Freshwater	MERISGFMRSHYMLSSGVCSRRIGPADAMVIAVAIV
Ga0334989_0646987_309_419	3300033984	Freshwater	MERISGFMRSHYMLPLGVCSRRIGPADDMVIAVAVV
Ga0335005_0041200_16_126	3300034022	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVIAIAVV
Ga0335005_0188816_4_114	3300034022	Freshwater	MERISGFMQSHYMLPSGVCSRRIGLADAMVIAVAVV
Ga0335005_0201432_976_1086	3300034022	Freshwater	MERISGFMQSHYKPPSGVCSRRIGPVDAMVIAVAVV
Ga0335005_0215997_217_327	3300034022	Freshwater	MERIGGFMRSHYMPPSGVCSRRISPADAMVIAVAVV
Ga0335005_0478356_325_438	3300034022	Freshwater	MERISGFMRSHYMLPFLGVCSRRISPADAMVIAVAVV
Ga0335005_0584785_14_154	3300034022	Freshwater	MKLISGFMRSHYTPPSGVCSRRIGPADAMVIAVAVGQKTTQNTTFS
Ga0335005_0588992_351_461	3300034022	Freshwater	MERIVGFMRSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0335001_0045928_2298_2408	3300034064	Freshwater	MKRIGGFMQSHNMLPSGECSRPIGPANDMVINITIV
Ga0335001_0233805_31_141	3300034064	Freshwater	MEHISGFIQSHYMPPSGVCLRHISLGDTMVIAVAIV
Ga0335001_0530287_288_398	3300034064	Freshwater	MERIGGFMRSLYMPPSGMCSHCISPADAMVIAVTVV
Ga0335001_0625617_336_446	3300034064	Freshwater	MEHIGGFMSSHYMPPSGVCSRHISPADAMFIAIAVV
Ga0335001_0627410_105_215	3300034064	Freshwater	MERISGFMQSHYMPPSVVCSRRIGPTDAMVIDVAVV
Ga0335001_0652385_255_395	3300034064	Freshwater	MERIIGFMRSHYMLPLGVCSRRIGPADAMVIAVAVGQNTTQNTTFS
Ga0334990_0540724_414_524	3300034068	Freshwater	MELIVGFMQSHYMLPSGVCSRRIGPADIMVIAIAVV
Ga0334990_0596625_416_526	3300034068	Freshwater	MERISGFMRSHYMLPSGVCSSRIGPADAMVIAVAVV
Ga0335022_0438559_568_696	3300034095	Freshwater	REAHRPMRRISGFMQGHYKPPSGVCSRRIGLADAMVIAFAVV
Ga0335035_0667984_45_155	3300034105	Freshwater	MERIGGFMRNHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0335037_0326699_184_294	3300034107	Freshwater	MERIGGFMRSHYMLSSGVCSRRIGPADAMVIAVAVV
Ga0335037_0613920_396_506	3300034107	Freshwater	MERISGFMRSHYMLPSGVCSRRIGLADAMVIAVAVV
Ga0335017_0011940_2295_2405	3300034167	Freshwater	MEHIIGFMQSHYLLPLGVCSRHIGPADAMVIAVAVV
Ga0335017_0014901_4205_4315	3300034167	Freshwater	MERIGGFMRNHYMLPLGVCSRRIGPADAMVIAVAVV
Ga0335017_0017810_240_350	3300034167	Freshwater	MERICGFMRSHYMLPLGVCSRRIGPADAMVIAVAVV
Ga0335017_0018272_144_254	3300034167	Freshwater	MERISGFMRSHYMLPSGVCSRRISPADAMVIAAAVV
Ga0335017_0021413_3195_3305	3300034167	Freshwater	MDRISGFMQSHSMLPSGVCSRRIGPADAMVIAVAVM
Ga0335017_0027085_205_315	3300034167	Freshwater	MERISGFMRSHYMLPSGVFSRRIGPADAMVIAVAVV
Ga0335017_0034321_1414_1524	3300034167	Freshwater	MERIDGFMRSHYMPPLGVCSHRISQADAMVIAVAVV
Ga0335017_0036589_1945_2055	3300034167	Freshwater	MERIGGFMRSHYIPPSGVCPRRIGPADAMVIAVAVM
Ga0335017_0037532_1292_1402	3300034167	Freshwater	MEHISGFMRSHYTPPSGVCSRRIGLADAMVIAVAVV
Ga0335017_0041366_1261_1371	3300034167	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGQADAMVIAVAVV
Ga0335017_0045339_395_505	3300034167	Freshwater	MERISGFMRSHYMLPSGVCLRRISPADAMVIAVAVV
Ga0335017_0045529_158_268	3300034167	Freshwater	MERIGGFMRSHYMLPSGVCSRRIGPAVAMVIAVAVV
Ga0335017_0049815_176_286	3300034167	Freshwater	MGRIGGFMRSHYMLPSGVCLRRIGPADAMVIAVAVL
Ga0335017_0051528_2301_2411	3300034167	Freshwater	MERISGFMRSHYMLPSGVCLRRIGPADAMVIAVTVV
Ga0335017_0051611_2276_2386	3300034167	Freshwater	MERIIGFMRSHYMLPSGVCSRRISPADAMVIAVAVV
Ga0335017_0059445_542_652	3300034167	Freshwater	MERIIGFMRSHYMLPLGVCSRRIGPADAMVIAVAVV
Ga0335017_0063520_2015_2155	3300034167	Freshwater	VERIGGFMRSHYMLPSGVCSRRIGPADAMVIAIAVGQNTTQNTTFS
Ga0335017_0069235_643_753	3300034167	Freshwater	MEHIIGFMRSHYMLPSGVCSRRIGPADAMVITVAVV
Ga0335017_0072732_410_520	3300034167	Freshwater	MEHISGFMRSHYMLPSGVCSSRIGPADAMVIAVAVV
Ga0335017_0080608_848_958	3300034167	Freshwater	MERISGFMQSHYTPPSGVCSRRIGPADAMVIAVAVV
Ga0335017_0082709_262_372	3300034167	Freshwater	MERISGFMRSHYTPPSGVCLRRIGPADAMVIAAAVV
Ga0335017_0083094_106_216	3300034167	Freshwater	MEHISGFMQSHYMLPSGVCSRRIGPADAMVIAVAVV
Ga0335017_0084273_431_541	3300034167	Freshwater	MERISGFMRSHYMLPSGVCSRCIGPADAMVIAVAVV
Ga0335017_0092828_1542_1652	3300034167	Freshwater	MERISGFMRSHNMLPSGVCSRRIGPADAMVIAVAVV
Ga0335017_0109582_565_675	3300034167	Freshwater	MERISGFMRSHYKPPSGVCVRRIGPVDAMVIAVAVV
Ga0335017_0112693_45_155	3300034167	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADVMVITVAVV
Ga0335017_0142447_920_1030	3300034167	Freshwater	MERISGFMRSHYTPPSGVCSRRIGPVDAMVIAVTVV
Ga0335017_0171661_82_192	3300034167	Freshwater	MERISGFMRSHYMLPLGVCLRHIGPADAMVIAVAVV
Ga0335017_0174397_761_871	3300034167	Freshwater	MERIIGFMQSHYMLSSGVCSRRIGPADAMVIAVAVV
Ga0335017_0260091_344_487	3300034167	Freshwater	MERIIGFMRSHYMLPLGVCSRRIGPADAMVIAVAVVRRVKTHTKHNF
Ga0335017_0364461_2_127	3300034167	Freshwater	IGGFMRSHYKPPSGVCSRRIGPADAMVIAVAVVVAFIVLFT
Ga0335017_0380115_410_520	3300034167	Freshwater	MERIGGFMRSHYMPPLGMCSRCIGPADAMVIAVAVV
Ga0335017_0385659_35_145	3300034167	Freshwater	MERIIGFMRSHYMLPSGVCSRRIGPADAMVITVTVV
Ga0335017_0387116_290_400	3300034167	Freshwater	MECIVGFMRSHYMLPLGVCSRRIGPADAMVIAIAVV
Ga0335017_0442303_27_137	3300034167	Freshwater	MDRISGFMRSHYMLPSGVCSRRIGLADAMVIAVAAV
Ga0335017_0462530_428_538	3300034167	Freshwater	MERIIGFMQSHYMLPSGVFSCRIGPADAMVIAVAVV
Ga0335017_0483061_94_204	3300034167	Freshwater	MERINGFMRSHYMLPSGMCSRRIGPADAMVIGVAVV
Ga0335017_0515545_149_259	3300034167	Freshwater	MEHISGFMRSHYMLPSGVFSRLIGPVDAMVIAVAVV
Ga0335017_0531601_426_536	3300034167	Freshwater	MERISGFMQSHYMLPSGVCSRRIGLVDAMVIAVAVV
Ga0335017_0582963_21_131	3300034167	Freshwater	MERISGFMQSHYMPPSGVCSHRIGLADAMVIAVAVV
Ga0335017_0604640_403_513	3300034167	Freshwater	MERISGFMRSHYMPPSGVCSRRIGPADAMVIDVAVV
Ga0335017_0660015_52_192	3300034167	Freshwater	MEHIGGFMRSHYIAPSGVCSRRIGPADAMVIAVAVGQNTTQNTTFS
Ga0335017_0686945_147_287	3300034167	Freshwater	MKRISGFMRSHYMPPSGVCSRIIGPADAMVIAVAVGQKTTQNTTFS
Ga0335061_0038178_2351_2461	3300034168	Freshwater	MERISGFMGSHYTPPSGVCSRRISPADAMVIAAAVV
Ga0335061_0104594_168_278	3300034168	Freshwater	MERISGFMRSHYMLPSGVCSRRIGPADAMVIAVTVV
Ga0335061_0138648_7_123	3300034168	Freshwater	MAMERIGGFMRSHLIAPSGVRSRRIGPADAMVIAVAVV
Ga0335061_0223778_354_464	3300034168	Freshwater	MERISGFMRSQYMLPSGVCSRRIGPADTMVIAVAVE
Ga0335061_0238876_67_177	3300034168	Freshwater	MERIIGFMRSHYMLPSGVCSCRIGPADAMVIAVAVV
Ga0335061_0245540_342_452	3300034168	Freshwater	MEHISGFMRSHYKPPLGVCSRRIGPADAMVIAVAIV
Ga0335061_0386906_558_674	3300034168	Freshwater	MNRIIGFMRSHYMLPSGVCSRHIGIGPADTMVIAVAVV
Ga0335061_0422090_46_156	3300034168	Freshwater	MERIIGFMRSHYMLPSSVCLRRIGPADAMVITVAVV
Ga0335061_0693992_333_506	3300034168	Freshwater	AGKIRREAHPPIKRIGGFMRSHKIAPSGVCSRSIGLADAMVIAVAVGQNTTQNTTFS
Ga0335039_0381872_120_257	3300034355	Freshwater	MERIGGFMRSHYMLPSGVCSRHIGPADAMVIVVTIVSKHNTKHNF

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F005733

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign