Basic Information | |
---|---|
Family ID | F005543 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 397 |
Average Sequence Length | 44 residues |
Representative Sequence | MKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIIIGGILRQN |
Number of Associated Samples | 267 |
Number of Associated Scaffolds | 397 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.57 % |
% of genes near scaffold ends (potentially truncated) | 66.50 % |
% of genes from short scaffolds (< 2000 bps) | 86.40 % |
Associated GOLD sequencing projects | 252 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.932 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.884 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.486 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.904 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 397 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 3.02 |
PF01070 | FMN_dh | 2.52 |
PF03401 | TctC | 1.51 |
PF00665 | rve | 1.51 |
PF01408 | GFO_IDH_MocA | 1.26 |
PF01042 | Ribonuc_L-PSP | 1.26 |
PF09084 | NMT1 | 1.26 |
PF13683 | rve_3 | 1.01 |
PF05598 | DUF772 | 1.01 |
PF02653 | BPD_transp_2 | 0.76 |
PF09361 | Phasin_2 | 0.76 |
PF00166 | Cpn10 | 0.76 |
PF07690 | MFS_1 | 0.76 |
PF03781 | FGE-sulfatase | 0.76 |
PF00589 | Phage_integrase | 0.76 |
PF01925 | TauE | 0.50 |
PF13561 | adh_short_C2 | 0.50 |
PF00118 | Cpn60_TCP1 | 0.50 |
PF02705 | K_trans | 0.50 |
PF00005 | ABC_tran | 0.50 |
PF00144 | Beta-lactamase | 0.50 |
PF11975 | Glyco_hydro_4C | 0.50 |
PF13193 | AMP-binding_C | 0.50 |
PF01425 | Amidase | 0.50 |
PF07369 | DUF1488 | 0.50 |
PF03797 | Autotransporter | 0.50 |
PF00174 | Oxidored_molyb | 0.50 |
PF13531 | SBP_bac_11 | 0.50 |
PF00083 | Sugar_tr | 0.50 |
PF12867 | DinB_2 | 0.50 |
PF02056 | Glyco_hydro_4 | 0.50 |
PF00581 | Rhodanese | 0.50 |
PF13478 | XdhC_C | 0.50 |
PF04545 | Sigma70_r4 | 0.50 |
PF10518 | TAT_signal | 0.50 |
PF06472 | ABC_membrane_2 | 0.50 |
PF00501 | AMP-binding | 0.25 |
PF00582 | Usp | 0.25 |
PF00873 | ACR_tran | 0.25 |
PF11752 | DUF3309 | 0.25 |
PF13472 | Lipase_GDSL_2 | 0.25 |
PF03480 | DctP | 0.25 |
PF01522 | Polysacc_deac_1 | 0.25 |
PF01494 | FAD_binding_3 | 0.25 |
PF03404 | Mo-co_dimer | 0.25 |
PF00211 | Guanylate_cyc | 0.25 |
PF02668 | TauD | 0.25 |
PF02518 | HATPase_c | 0.25 |
PF13417 | GST_N_3 | 0.25 |
PF00857 | Isochorismatase | 0.25 |
PF13249 | SQHop_cyclase_N | 0.25 |
PF01068 | DNA_ligase_A_M | 0.25 |
PF01527 | HTH_Tnp_1 | 0.25 |
PF00216 | Bac_DNA_binding | 0.25 |
PF00561 | Abhydrolase_1 | 0.25 |
PF00550 | PP-binding | 0.25 |
PF08281 | Sigma70_r4_2 | 0.25 |
PF04055 | Radical_SAM | 0.25 |
PF00027 | cNMP_binding | 0.25 |
PF00011 | HSP20 | 0.25 |
PF08388 | GIIM | 0.25 |
PF13517 | FG-GAP_3 | 0.25 |
PF06048 | DUF927 | 0.25 |
PF04955 | HupE_UreJ | 0.25 |
PF12697 | Abhydrolase_6 | 0.25 |
PF09347 | DUF1989 | 0.25 |
PF12778 | PXPV | 0.25 |
PF01841 | Transglut_core | 0.25 |
PF00941 | FAD_binding_5 | 0.25 |
PF00515 | TPR_1 | 0.25 |
PF00300 | His_Phos_1 | 0.25 |
PF08808 | RES | 0.25 |
PF00072 | Response_reg | 0.25 |
PF13564 | DoxX_2 | 0.25 |
PF14294 | DUF4372 | 0.25 |
PF13458 | Peripla_BP_6 | 0.25 |
PF01177 | Asp_Glu_race | 0.25 |
PF00583 | Acetyltransf_1 | 0.25 |
PF16868 | NMT1_3 | 0.25 |
PF02615 | Ldh_2 | 0.25 |
PF13467 | RHH_4 | 0.25 |
PF01381 | HTH_3 | 0.25 |
PF12849 | PBP_like_2 | 0.25 |
PF02690 | Na_Pi_cotrans | 0.25 |
PF00753 | Lactamase_B | 0.25 |
PF07883 | Cupin_2 | 0.25 |
PF01139 | RtcB | 0.25 |
PF10009 | DUF2252 | 0.25 |
PF08774 | VRR_NUC | 0.25 |
PF11953 | DUF3470 | 0.25 |
PF00326 | Peptidase_S9 | 0.25 |
PF13407 | Peripla_BP_4 | 0.25 |
PF12833 | HTH_18 | 0.25 |
PF05853 | BKACE | 0.25 |
PF01520 | Amidase_3 | 0.25 |
PF01734 | Patatin | 0.25 |
PF00034 | Cytochrom_C | 0.25 |
PF06742 | DUF1214 | 0.25 |
PF13701 | DDE_Tnp_1_4 | 0.25 |
PF09722 | Xre_MbcA_ParS_C | 0.25 |
PF00848 | Ring_hydroxyl_A | 0.25 |
PF07750 | GcrA | 0.25 |
PF02661 | Fic | 0.25 |
PF00656 | Peptidase_C14 | 0.25 |
PF00701 | DHDPS | 0.25 |
PF00082 | Peptidase_S8 | 0.25 |
PF02738 | MoCoBD_1 | 0.25 |
COG ID | Name | Functional Category | % Frequency in 397 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.02 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.52 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.52 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.51 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.51 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.51 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.51 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.51 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.26 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.26 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.26 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.50 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.50 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.50 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.50 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.50 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.50 |
COG1486 | Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase | Carbohydrate transport and metabolism [G] | 0.50 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 0.50 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.50 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.25 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.25 |
COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.25 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.25 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.25 |
COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.25 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.25 |
COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.25 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.25 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.25 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.25 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.25 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.25 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.25 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.25 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.25 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.25 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.25 |
COG1283 | Na+/phosphate symporter | Inorganic ion transport and metabolism [P] | 0.25 |
COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 0.25 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.25 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.25 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.25 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.25 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.25 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.25 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.25 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.93 % |
Unclassified | root | N/A | 9.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459015|G14TP7Y01DWWSF | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1020725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
3300000890|JGI11643J12802_11532962 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300000956|JGI10216J12902_105147123 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300001228|SwM_128468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300001661|JGI12053J15887_10008323 | All Organisms → cellular organisms → Bacteria | 5614 | Open in IMG/M |
3300001661|JGI12053J15887_10061067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2094 | Open in IMG/M |
3300001661|JGI12053J15887_10104151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1534 | Open in IMG/M |
3300001661|JGI12053J15887_10230203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 929 | Open in IMG/M |
3300001661|JGI12053J15887_10298724 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300002906|JGI25614J43888_10097319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
3300002907|JGI25613J43889_10102628 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
3300002911|JGI25390J43892_10164351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 520 | Open in IMG/M |
3300002914|JGI25617J43924_10068246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1299 | Open in IMG/M |
3300002917|JGI25616J43925_10132627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1006 | Open in IMG/M |
3300002917|JGI25616J43925_10170155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 860 | Open in IMG/M |
3300002917|JGI25616J43925_10384519 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300004463|Ga0063356_103733547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
3300005147|Ga0066821_1028188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300005166|Ga0066674_10073989 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300005169|Ga0066810_10009333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1412 | Open in IMG/M |
3300005172|Ga0066683_10102410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1738 | Open in IMG/M |
3300005172|Ga0066683_10453809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
3300005174|Ga0066680_10713910 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300005178|Ga0066688_10416773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
3300005178|Ga0066688_10750555 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300005180|Ga0066685_10967673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
3300005187|Ga0066675_10271880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1217 | Open in IMG/M |
3300005187|Ga0066675_10537018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 876 | Open in IMG/M |
3300005187|Ga0066675_10940919 | Not Available | 651 | Open in IMG/M |
3300005329|Ga0070683_101271382 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
3300005332|Ga0066388_105983159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300005335|Ga0070666_10155581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1596 | Open in IMG/M |
3300005447|Ga0066689_10288157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1017 | Open in IMG/M |
3300005450|Ga0066682_10894684 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300005451|Ga0066681_10118685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1529 | Open in IMG/M |
3300005467|Ga0070706_100189061 | Not Available | 1924 | Open in IMG/M |
3300005467|Ga0070706_101183692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 702 | Open in IMG/M |
3300005468|Ga0070707_100137343 | All Organisms → cellular organisms → Bacteria | 2378 | Open in IMG/M |
3300005468|Ga0070707_100642458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1024 | Open in IMG/M |
3300005471|Ga0070698_100685519 | Not Available | 966 | Open in IMG/M |
3300005471|Ga0070698_102042040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300005518|Ga0070699_100092074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2651 | Open in IMG/M |
3300005518|Ga0070699_100180646 | Not Available | 1872 | Open in IMG/M |
3300005539|Ga0068853_100471391 | Not Available | 1183 | Open in IMG/M |
3300005549|Ga0070704_100065701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2613 | Open in IMG/M |
3300005553|Ga0066695_10314839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 985 | Open in IMG/M |
3300005554|Ga0066661_10362703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
3300005554|Ga0066661_10809780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300005555|Ga0066692_11011108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300005556|Ga0066707_10358121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
3300005557|Ga0066704_10827888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300005558|Ga0066698_10314802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
3300005558|Ga0066698_10406156 | Not Available | 935 | Open in IMG/M |
3300005558|Ga0066698_10407727 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300005559|Ga0066700_10219869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
3300005559|Ga0066700_10514994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 834 | Open in IMG/M |
3300005587|Ga0066654_10407275 | Not Available | 742 | Open in IMG/M |
3300005598|Ga0066706_10788156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
3300005764|Ga0066903_101262886 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
3300005764|Ga0066903_105446343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300005764|Ga0066903_107138143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8 | 579 | Open in IMG/M |
3300006032|Ga0066696_10238284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1172 | Open in IMG/M |
3300006032|Ga0066696_10325550 | Not Available | 1000 | Open in IMG/M |
3300006032|Ga0066696_10655776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300006034|Ga0066656_10387092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 904 | Open in IMG/M |
3300006038|Ga0075365_10357448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes | 1029 | Open in IMG/M |
3300006046|Ga0066652_101543510 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300006049|Ga0075417_10653808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
3300006172|Ga0075018_10703035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300006173|Ga0070716_100800001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 730 | Open in IMG/M |
3300006175|Ga0070712_101613297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
3300006575|Ga0074053_10014822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300006796|Ga0066665_10121004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1950 | Open in IMG/M |
3300006796|Ga0066665_10167348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1681 | Open in IMG/M |
3300006796|Ga0066665_10590033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 896 | Open in IMG/M |
3300006797|Ga0066659_10207436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1439 | Open in IMG/M |
3300006797|Ga0066659_10618859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 880 | Open in IMG/M |
3300006800|Ga0066660_11446468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300006852|Ga0075433_10786599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
3300006854|Ga0075425_100615903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
3300006904|Ga0075424_100416322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. 17Sr1-1 | 1433 | Open in IMG/M |
3300006953|Ga0074063_10002009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300006969|Ga0075419_10739365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
3300007265|Ga0099794_10011980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3728 | Open in IMG/M |
3300007265|Ga0099794_10701303 | Not Available | 539 | Open in IMG/M |
3300007788|Ga0099795_10023562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2044 | Open in IMG/M |
3300009012|Ga0066710_100022481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7048 | Open in IMG/M |
3300009012|Ga0066710_100051549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5095 | Open in IMG/M |
3300009012|Ga0066710_100544367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1755 | Open in IMG/M |
3300009012|Ga0066710_100583736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1694 | Open in IMG/M |
3300009012|Ga0066710_101348587 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300009012|Ga0066710_101894615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 893 | Open in IMG/M |
3300009088|Ga0099830_10900317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 732 | Open in IMG/M |
3300009088|Ga0099830_11832489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300009089|Ga0099828_10269108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1530 | Open in IMG/M |
3300009089|Ga0099828_10525838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1066 | Open in IMG/M |
3300009094|Ga0111539_10340676 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
3300009100|Ga0075418_10471155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1346 | Open in IMG/M |
3300009100|Ga0075418_10676679 | Not Available | 1112 | Open in IMG/M |
3300009100|Ga0075418_11306767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
3300009100|Ga0075418_12660389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300009137|Ga0066709_100460966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1780 | Open in IMG/M |
3300009137|Ga0066709_100584755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1588 | Open in IMG/M |
3300009137|Ga0066709_100974964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1240 | Open in IMG/M |
3300009137|Ga0066709_100981682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1235 | Open in IMG/M |
3300009137|Ga0066709_101221305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1106 | Open in IMG/M |
3300009137|Ga0066709_101446927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
3300009147|Ga0114129_10706651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1295 | Open in IMG/M |
3300009162|Ga0075423_10800754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
3300009162|Ga0075423_13169072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300009661|Ga0105858_1088638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
3300010046|Ga0126384_10503737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1044 | Open in IMG/M |
3300010046|Ga0126384_11332407 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300010048|Ga0126373_11610403 | Not Available | 714 | Open in IMG/M |
3300010159|Ga0099796_10443376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
3300010303|Ga0134082_10010284 | Not Available | 3373 | Open in IMG/M |
3300010303|Ga0134082_10214221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Leo121 | 791 | Open in IMG/M |
3300010304|Ga0134088_10511326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
3300010304|Ga0134088_10685442 | Not Available | 514 | Open in IMG/M |
3300010321|Ga0134067_10351609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300010323|Ga0134086_10236503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
3300010325|Ga0134064_10227573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300010329|Ga0134111_10336454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
3300010333|Ga0134080_10481670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
3300010335|Ga0134063_10002810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6264 | Open in IMG/M |
3300010335|Ga0134063_10084349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1427 | Open in IMG/M |
3300010335|Ga0134063_10123017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1190 | Open in IMG/M |
3300010335|Ga0134063_10178255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
3300010361|Ga0126378_10245251 | Not Available | 1883 | Open in IMG/M |
3300010375|Ga0105239_11845357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
3300010375|Ga0105239_12421737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
3300010398|Ga0126383_11463376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
3300010398|Ga0126383_11839564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
3300010398|Ga0126383_13172913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
3300010999|Ga0138505_100061890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
3300011000|Ga0138513_100022875 | Not Available | 872 | Open in IMG/M |
3300011119|Ga0105246_10880612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 801 | Open in IMG/M |
3300011269|Ga0137392_10628124 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300011270|Ga0137391_10790914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 782 | Open in IMG/M |
3300011270|Ga0137391_11276302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 581 | Open in IMG/M |
3300011437|Ga0137429_1200803 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
3300012022|Ga0120191_10071438 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300012198|Ga0137364_10096546 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
3300012198|Ga0137364_10258809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
3300012198|Ga0137364_10549465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
3300012198|Ga0137364_10963730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 646 | Open in IMG/M |
3300012198|Ga0137364_11061353 | Not Available | 611 | Open in IMG/M |
3300012198|Ga0137364_11207222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 566 | Open in IMG/M |
3300012199|Ga0137383_10262827 | Not Available | 1264 | Open in IMG/M |
3300012199|Ga0137383_10630140 | Not Available | 784 | Open in IMG/M |
3300012201|Ga0137365_10523863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 871 | Open in IMG/M |
3300012202|Ga0137363_10626836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium 8X | 908 | Open in IMG/M |
3300012202|Ga0137363_11138132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 664 | Open in IMG/M |
3300012202|Ga0137363_11262752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
3300012202|Ga0137363_11732647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300012202|Ga0137363_11831623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300012203|Ga0137399_10292422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1344 | Open in IMG/M |
3300012204|Ga0137374_10537001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
3300012205|Ga0137362_10240846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1561 | Open in IMG/M |
3300012205|Ga0137362_11504951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 560 | Open in IMG/M |
3300012207|Ga0137381_10052929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum | 3357 | Open in IMG/M |
3300012207|Ga0137381_10652467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
3300012210|Ga0137378_10065933 | All Organisms → cellular organisms → Bacteria | 3280 | Open in IMG/M |
3300012210|Ga0137378_10857554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
3300012210|Ga0137378_11000860 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300012210|Ga0137378_11177704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
3300012211|Ga0137377_10183583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2008 | Open in IMG/M |
3300012211|Ga0137377_10450110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
3300012211|Ga0137377_10462312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1207 | Open in IMG/M |
3300012212|Ga0150985_101371255 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300012285|Ga0137370_10051967 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
3300012285|Ga0137370_10341941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 899 | Open in IMG/M |
3300012285|Ga0137370_10430371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 802 | Open in IMG/M |
3300012351|Ga0137386_11317389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300012354|Ga0137366_10442399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
3300012355|Ga0137369_11132548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300012356|Ga0137371_10201933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1557 | Open in IMG/M |
3300012357|Ga0137384_10507565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 990 | Open in IMG/M |
3300012361|Ga0137360_10065912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2663 | Open in IMG/M |
3300012361|Ga0137360_10254108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1444 | Open in IMG/M |
3300012361|Ga0137360_10885215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
3300012361|Ga0137360_10921710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Sediminicoccus → Sediminicoccus rosea | 753 | Open in IMG/M |
3300012362|Ga0137361_10050798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3419 | Open in IMG/M |
3300012362|Ga0137361_10202587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1795 | Open in IMG/M |
3300012362|Ga0137361_10788085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
3300012362|Ga0137361_11348052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
3300012363|Ga0137390_10565332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
3300012363|Ga0137390_10634479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1034 | Open in IMG/M |
3300012363|Ga0137390_11260059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 686 | Open in IMG/M |
3300012363|Ga0137390_12000668 | Not Available | 505 | Open in IMG/M |
3300012391|Ga0134035_1297473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300012582|Ga0137358_10240497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
3300012908|Ga0157286_10232864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
3300012918|Ga0137396_10819244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
3300012923|Ga0137359_10222235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1686 | Open in IMG/M |
3300012923|Ga0137359_10582108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
3300012923|Ga0137359_11075492 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300012924|Ga0137413_11251299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
3300012925|Ga0137419_10958736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
3300012927|Ga0137416_12020286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
3300012930|Ga0137407_10070494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2909 | Open in IMG/M |
3300012948|Ga0126375_11698186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
3300012955|Ga0164298_11009323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300012955|Ga0164298_11529654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300012957|Ga0164303_10000139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13786 | Open in IMG/M |
3300012958|Ga0164299_10956068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
3300012960|Ga0164301_10008267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4037 | Open in IMG/M |
3300012960|Ga0164301_10354478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
3300012960|Ga0164301_10689742 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300012960|Ga0164301_10872618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300012971|Ga0126369_13082317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300012971|Ga0126369_13204962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
3300012975|Ga0134110_10130070 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1031 | Open in IMG/M |
3300012975|Ga0134110_10204507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 829 | Open in IMG/M |
3300012975|Ga0134110_10262488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
3300012975|Ga0134110_10456128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300012977|Ga0134087_10266807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
3300012977|Ga0134087_10469080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 627 | Open in IMG/M |
3300012987|Ga0164307_10516562 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300012989|Ga0164305_10920361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 736 | Open in IMG/M |
3300013297|Ga0157378_10396733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
3300014157|Ga0134078_10182139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 846 | Open in IMG/M |
3300014867|Ga0180076_1053169 | Not Available | 726 | Open in IMG/M |
3300015357|Ga0134072_10155787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300015359|Ga0134085_10215453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 829 | Open in IMG/M |
3300015359|Ga0134085_10219364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300015372|Ga0132256_100088552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga | 2983 | Open in IMG/M |
3300015373|Ga0132257_101546855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
3300015374|Ga0132255_105446147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300016319|Ga0182033_11495245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300016341|Ga0182035_10007794 | All Organisms → cellular organisms → Bacteria | 6115 | Open in IMG/M |
3300017654|Ga0134069_1204103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
3300017657|Ga0134074_1029923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1815 | Open in IMG/M |
3300017659|Ga0134083_10145302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 957 | Open in IMG/M |
3300017965|Ga0190266_10092995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1216 | Open in IMG/M |
3300018000|Ga0184604_10207733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300018027|Ga0184605_10012508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3280 | Open in IMG/M |
3300018033|Ga0187867_10353399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 818 | Open in IMG/M |
3300018054|Ga0184621_10006799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3179 | Open in IMG/M |
3300018054|Ga0184621_10042921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1488 | Open in IMG/M |
3300018054|Ga0184621_10064373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1250 | Open in IMG/M |
3300018061|Ga0184619_10026830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2402 | Open in IMG/M |
3300018061|Ga0184619_10056814 | Not Available | 1711 | Open in IMG/M |
3300018071|Ga0184618_10051234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1502 | Open in IMG/M |
3300018072|Ga0184635_10018606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2523 | Open in IMG/M |
3300018073|Ga0184624_10048137 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
3300018077|Ga0184633_10561364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300018081|Ga0184625_10082668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1644 | Open in IMG/M |
3300018431|Ga0066655_10081437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1765 | Open in IMG/M |
3300018431|Ga0066655_10224318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1180 | Open in IMG/M |
3300018431|Ga0066655_10723792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300018433|Ga0066667_10520706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
3300018433|Ga0066667_10548844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 959 | Open in IMG/M |
3300018433|Ga0066667_10596010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
3300018433|Ga0066667_11716220 | Not Available | 564 | Open in IMG/M |
3300018433|Ga0066667_12179786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300018468|Ga0066662_10770964 | Not Available | 929 | Open in IMG/M |
3300018468|Ga0066662_11828345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM4349 | 635 | Open in IMG/M |
3300018468|Ga0066662_12743607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 522 | Open in IMG/M |
3300018469|Ga0190270_12867317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 545 | Open in IMG/M |
3300018481|Ga0190271_11995681 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300018482|Ga0066669_10667085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
3300018482|Ga0066669_11365684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300018482|Ga0066669_11526089 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300018482|Ga0066669_12058756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
3300018482|Ga0066669_12376492 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300019257|Ga0180115_1041230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1429 | Open in IMG/M |
3300019887|Ga0193729_1032715 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
3300019887|Ga0193729_1068035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1412 | Open in IMG/M |
3300020001|Ga0193731_1011951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2238 | Open in IMG/M |
3300020170|Ga0179594_10037340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1586 | Open in IMG/M |
3300020199|Ga0179592_10499341 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
3300021088|Ga0210404_10755733 | Not Available | 555 | Open in IMG/M |
3300021168|Ga0210406_10965157 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300021363|Ga0193699_10006115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4340 | Open in IMG/M |
3300021363|Ga0193699_10385072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
3300021363|Ga0193699_10490971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
3300021403|Ga0210397_11293546 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
3300021415|Ga0193694_1028119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
3300021475|Ga0210392_10748707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 729 | Open in IMG/M |
3300022195|Ga0222625_1821832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300022901|Ga0247788_1110124 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300024254|Ga0247661_1009277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1623 | Open in IMG/M |
3300025893|Ga0207682_10119445 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium | 1168 | Open in IMG/M |
3300025904|Ga0207647_10097891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1744 | Open in IMG/M |
3300025905|Ga0207685_10465412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
3300025918|Ga0207662_10803438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
3300025922|Ga0207646_10153633 | Not Available | 2076 | Open in IMG/M |
3300025928|Ga0207700_10414603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1182 | Open in IMG/M |
3300025934|Ga0207686_10154986 | Not Available | 1599 | Open in IMG/M |
3300025960|Ga0207651_11018105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
3300026023|Ga0207677_10921334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 789 | Open in IMG/M |
3300026067|Ga0207678_10004194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12937 | Open in IMG/M |
3300026095|Ga0207676_12154725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
3300026118|Ga0207675_101151173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
3300026301|Ga0209238_1124890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
3300026304|Ga0209240_1135112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300026304|Ga0209240_1181400 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300026308|Ga0209265_1060313 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300026319|Ga0209647_1066284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1850 | Open in IMG/M |
3300026320|Ga0209131_1024118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3619 | Open in IMG/M |
3300026324|Ga0209470_1334257 | Not Available | 547 | Open in IMG/M |
3300026330|Ga0209473_1120701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1087 | Open in IMG/M |
3300026342|Ga0209057_1127640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 926 | Open in IMG/M |
3300026343|Ga0209159_1163174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
3300026360|Ga0257173_1003654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1483 | Open in IMG/M |
3300026496|Ga0257157_1036411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
3300026498|Ga0257156_1029146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1115 | Open in IMG/M |
3300026507|Ga0257165_1059012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300026524|Ga0209690_1105113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1146 | Open in IMG/M |
3300026528|Ga0209378_1061288 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300026529|Ga0209806_1017502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3723 | Open in IMG/M |
3300026538|Ga0209056_10077434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2822 | Open in IMG/M |
3300026538|Ga0209056_10298644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1110 | Open in IMG/M |
3300026538|Ga0209056_10409365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
3300026540|Ga0209376_1215427 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300026547|Ga0209156_10395536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
3300026548|Ga0209161_10199075 | Not Available | 1109 | Open in IMG/M |
3300026548|Ga0209161_10450867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
3300026550|Ga0209474_10051545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2942 | Open in IMG/M |
3300026551|Ga0209648_10045586 | All Organisms → cellular organisms → Bacteria | 3778 | Open in IMG/M |
3300026551|Ga0209648_10723464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300026551|Ga0209648_10772864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300026552|Ga0209577_10866283 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300027383|Ga0209213_1059854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ghvi | 714 | Open in IMG/M |
3300027401|Ga0208637_1006062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1138 | Open in IMG/M |
3300027546|Ga0208984_1030321 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300027663|Ga0208990_1021254 | Not Available | 2114 | Open in IMG/M |
3300027875|Ga0209283_10101279 | Not Available | 1884 | Open in IMG/M |
3300027903|Ga0209488_10755437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 693 | Open in IMG/M |
3300028708|Ga0307295_10025027 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300028711|Ga0307293_10151614 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300028712|Ga0307285_10008665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2142 | Open in IMG/M |
3300028755|Ga0307316_10037646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1598 | Open in IMG/M |
3300028755|Ga0307316_10307678 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300028768|Ga0307280_10264599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300028787|Ga0307323_10021927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2188 | Open in IMG/M |
3300028787|Ga0307323_10085821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1124 | Open in IMG/M |
3300028787|Ga0307323_10203764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 714 | Open in IMG/M |
3300028791|Ga0307290_10029957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1927 | Open in IMG/M |
3300028793|Ga0307299_10366309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300028796|Ga0307287_10033020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1854 | Open in IMG/M |
3300028796|Ga0307287_10148292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 891 | Open in IMG/M |
3300028807|Ga0307305_10005594 | All Organisms → cellular organisms → Bacteria | 5360 | Open in IMG/M |
3300028810|Ga0307294_10249323 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300028811|Ga0307292_10292582 | Not Available | 681 | Open in IMG/M |
3300028811|Ga0307292_10375290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300028814|Ga0307302_10001944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9069 | Open in IMG/M |
3300028814|Ga0307302_10006672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5144 | Open in IMG/M |
3300028814|Ga0307302_10560194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
3300028819|Ga0307296_10108504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
3300028819|Ga0307296_10343652 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300028819|Ga0307296_10840868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300028875|Ga0307289_10079524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1328 | Open in IMG/M |
3300028876|Ga0307286_10047494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1450 | Open in IMG/M |
3300028878|Ga0307278_10273682 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 748 | Open in IMG/M |
3300028880|Ga0307300_10182972 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300028884|Ga0307308_10001908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8551 | Open in IMG/M |
3300028884|Ga0307308_10041530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2157 | Open in IMG/M |
3300028884|Ga0307308_10083592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1514 | Open in IMG/M |
3300030829|Ga0308203_1063266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
3300030989|Ga0308196_1069818 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
3300030993|Ga0308190_1164834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
3300031114|Ga0308187_10368820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300031152|Ga0307501_10001699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2525 | Open in IMG/M |
3300031198|Ga0307500_10104877 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300031226|Ga0307497_10019235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2081 | Open in IMG/M |
3300031231|Ga0170824_113433347 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300031545|Ga0318541_10657910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300031572|Ga0318515_10555314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
3300031640|Ga0318555_10118711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1404 | Open in IMG/M |
3300031668|Ga0318542_10028845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2370 | Open in IMG/M |
3300031681|Ga0318572_10934118 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300031740|Ga0307468_101656710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300031763|Ga0318537_10133851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 922 | Open in IMG/M |
3300031771|Ga0318546_10584491 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
3300031792|Ga0318529_10032665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2166 | Open in IMG/M |
3300031792|Ga0318529_10316193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300031795|Ga0318557_10432689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → Methylosinus sporium | 605 | Open in IMG/M |
3300031832|Ga0318499_10294487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas harenae | 627 | Open in IMG/M |
3300031845|Ga0318511_10219887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
3300031912|Ga0306921_11188290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 850 | Open in IMG/M |
3300032001|Ga0306922_11543946 | Not Available | 662 | Open in IMG/M |
3300032013|Ga0310906_10719019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 699 | Open in IMG/M |
3300032041|Ga0318549_10022955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2385 | Open in IMG/M |
3300032055|Ga0318575_10084780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1515 | Open in IMG/M |
3300032180|Ga0307471_100106077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2568 | Open in IMG/M |
3300032516|Ga0315273_13251238 | Not Available | 501 | Open in IMG/M |
3300033412|Ga0310810_10357536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1532 | Open in IMG/M |
3300033475|Ga0310811_10628490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
3300034149|Ga0364929_0025539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1727 | Open in IMG/M |
3300034384|Ga0372946_0216736 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300034681|Ga0370546_070166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.53% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.27% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.02% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.02% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.01% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.01% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.50% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.50% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.50% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.50% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.50% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.25% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.25% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.25% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.25% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.25% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.25% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.25% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.25% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.25% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.25% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.25% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.25% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.25% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001228 | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined | Host-Associated | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019257 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030989 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4PV_00498280 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | DDRLRCDATYVLDGTMDWSVFAKRPMGPQLVIISAILRQDSA |
AP72_2010_repI_A01DRAFT_10207251 | 3300000579 | Forest Soil | MVMKSAQDGNRCDAAYVLDGAMDRSVFAKRPMSPLLVIIRGISHQDAK* |
JGI11643J12802_115329622 | 3300000890 | Soil | MKSAEDWRRYDAAHVLDGAMDRSVLVERPVGPQLVVVGDILRQNPAQVRFAQDN |
JGI10216J12902_1051471233 | 3300000956 | Soil | MVMESAEDGRRYDASYVLDGAMDRGIPVERPMSPQLVI |
SwM_1284682 | 3300001228 | Switchgrass Rhizosphere | MVMKAAEDGRRYDAAHVLDSAMDRSVFVERPMSPQLVIIGSILRQDPAQV |
JGI12053J15887_100083238 | 3300001661 | Forest Soil | MVVKATDDRLRCDAAYVLAGTMDWSVFAKRPMSPQLVIVRSILRQDPA* |
JGI12053J15887_100610671 | 3300001661 | Forest Soil | MVVKATDDRLRCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDLA* |
JGI12053J15887_101041512 | 3300001661 | Forest Soil | MVVKSAEDARRYDAAHVLDGAMDRSVLVERPMSPQLIIVGGILRQDPA* |
JGI12053J15887_102302032 | 3300001661 | Forest Soil | MVMKSAEDRHRCDAAYVLDGAMDRSVFAKRPMSPQLVI |
JGI12053J15887_102987241 | 3300001661 | Forest Soil | MVMKSAEGRHRYDATYVLDGAMDRSVFAKRPMSPQLV |
JGI25614J43888_100973191 | 3300002906 | Grasslands Soil | MKAAEDGCRYDSTDVLDGAMDRSVLVERPMSPQLIIIGSILRQNPA* |
JGI25613J43889_101026282 | 3300002907 | Grasslands Soil | MKAAEDGCRYDAAHVLDGAMDRSVFVERPMGPQLVIVGGILRQNSA* |
JGI25390J43892_101643511 | 3300002911 | Grasslands Soil | MKAAEDGRRCDAAHVLDGAMDRSVLVERPMSPEFIIIGGILRQNPA* |
JGI25617J43924_100682461 | 3300002914 | Grasslands Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVVCTEN* |
JGI25616J43925_101326271 | 3300002917 | Grasslands Soil | KLDSAIVVMKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVVRTEN* |
JGI25616J43925_101701551 | 3300002917 | Grasslands Soil | VVMKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVVRTEN* |
JGI25616J43925_103845191 | 3300002917 | Grasslands Soil | VVMKAAKDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIG |
Ga0063356_1037335471 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVMKSAEDGRRCDAAHLLDGAMDRSVLVERPMRPQLVIIGGNLRQDSA* |
Ga0066821_10281881 | 3300005147 | Soil | MVMKSAEDGRRCDAAHLLDGAMDRSVLVERPMSPEFIIIGGILRQNPA* |
Ga0066674_100739892 | 3300005166 | Soil | MKAAEDGRRYDAAHVLDGAIDRGVLVERSMSPQLIIIGGILRQNLA* |
Ga0066810_100093332 | 3300005169 | Soil | MVMKSAEDGRRYDAAHVLDGAMDRSIFAKRSMSPQLVIIGGIFRQNPA* |
Ga0066683_101024104 | 3300005172 | Soil | MKAAEDRRRYDAAHVLDGATDPSVLVERSMGPQLIIIGGVLRQDPA* |
Ga0066683_104538092 | 3300005172 | Soil | VVMKAAQDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGG |
Ga0066680_107139101 | 3300005174 | Soil | MKSAEDGRRYDAAHVLDGAMDRRVLVERPMRPQLVIIDKGGNPAS* |
Ga0066688_104167732 | 3300005178 | Soil | VVMKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIG |
Ga0066688_107505552 | 3300005178 | Soil | MVMKSSEDGRRYDAAHVLDGAMYWSVLVERAMRPQLVIVDGILR* |
Ga0066685_109676731 | 3300005180 | Soil | MVMKSAEDGRRYNVAHVPDGAMDRSVLVERPMSPQLIIVGG |
Ga0066675_102718803 | 3300005187 | Soil | MKAAEDGHRYNVAHVLDGAMDRSVLVERPMSPQLIIVGGILRQNPA* |
Ga0066675_105370182 | 3300005187 | Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQNPA* |
Ga0066675_109409191 | 3300005187 | Soil | MVMKAAEDGRRYDAAHVLDRAIDRSVLVERPMSPQLIIISGILRQYPAQVRFA |
Ga0070683_1012713821 | 3300005329 | Corn Rhizosphere | ATDDRLRCDATYVLDGTMDRSVFAKRPMGPQLVIISAILRQDSA* |
Ga0066388_1059831591 | 3300005332 | Tropical Forest Soil | MVVKSAEDRNRCDAAYGLDGAMDRSVFAKRPMSPLLVIIGGI |
Ga0070666_101555811 | 3300005335 | Switchgrass Rhizosphere | MVVKATDDRLRCDATYVLDGTMDRSVFAKRPMGPQLVIISAILRQDSA* |
Ga0066689_102881571 | 3300005447 | Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIIGGILRQNPA |
Ga0066682_108946841 | 3300005450 | Soil | MVMKSAEDGRRYNVAHVLDGATDWSVFVEGPMSAQLIIIGGVLRQNQA* |
Ga0066681_101186852 | 3300005451 | Soil | VVMKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIIIG |
Ga0070706_1001890613 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDRDRCDAAYVLDGAMDRSVFAKRPMSPRLIIIGGILPKDPAQVCLPRT* |
Ga0070706_1011836921 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDGRRYGAAHVLDGAMDRSVLAERPMRPQLVIIGGNFRQNSA* |
Ga0070707_1001373431 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDRDRCDAAYALDGAMDRSVFAQRPMSPRLIIIGGILRQNPA* |
Ga0070707_1006424582 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSSEDGRRYDAAHVLDGAMDRSVLVERAMRPQLVIVGGILR* |
Ga0070698_1006855191 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDGRRYDAADVLDGAMDRSVLVERPMSSQLIIIGGILRQNPT* |
Ga0070698_1020420402 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDWHRYDAASVLDGALDRSILLERPMSPQLVIVGDIFPQNPP* |
Ga0070699_1000920745 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDGRRYDAAQVLDGAMDRSVLVERPMRPQLVIKGGNLRQDSA* |
Ga0070699_1001806462 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDRDRCDAAYVLDGAMDRSVFAKRPMSPRLIIIGGIL |
Ga0068853_1004713912 | 3300005539 | Corn Rhizosphere | MVVKATDDRLRCDATYVLDSARDGGVFAKRPMSPQLVIISG |
Ga0070704_1000657013 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVKATDDRLRCDATYVLDSARDGGVFGKRLMSPQLVIISGIFRQDPA* |
Ga0066695_103148393 | 3300005553 | Soil | VVIKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVL |
Ga0066661_103627031 | 3300005554 | Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVLVERPMSPQLIIIGSIL |
Ga0066661_108097801 | 3300005554 | Soil | MVMKSAEDGRRYDAAHLPDGAMDRSVFVERPMSSQLIIIDGILHQNPA* |
Ga0066692_110111081 | 3300005555 | Soil | MVMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIV |
Ga0066707_103581211 | 3300005556 | Soil | MKAAEDRRRYDAAHVLDGATDPSVLVERSMGPQLIIIGGVLRQ |
Ga0066704_108278882 | 3300005557 | Soil | VVMKAAEDGHRYDAALVLDGATDRSVFVERPMSPQL |
Ga0066698_103148023 | 3300005558 | Soil | MKAAQDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGG |
Ga0066698_104061561 | 3300005558 | Soil | MKAAETGCRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0066698_104077272 | 3300005558 | Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVL |
Ga0066700_102198693 | 3300005559 | Soil | MAMKSSADGRRYDAAHVLDGAMDRSVLVERPMSPQLIIISGILRQYPAQVRFA |
Ga0066700_105149942 | 3300005559 | Soil | MKAAEDGHRYDAAHVLDGATDRGVFVERPMSPQLIIIGGVLRQNPA* |
Ga0066654_104072751 | 3300005587 | Soil | MKAAKDGRRYDAAYLLDGAMDRSVFVEKPISPQLVIIVTMR* |
Ga0066706_107881561 | 3300005598 | Soil | MKAAEDGHRYDAAHVLDGATDRGVFVERPMSPQLIIIGGVLRQNPA |
Ga0066903_1012628861 | 3300005764 | Tropical Forest Soil | MVMKCAEDERRYYAAHVLDGAMGRSVLVERSTSPQLVIIGGILRQN |
Ga0066903_1054463431 | 3300005764 | Tropical Forest Soil | MVMKSAEDGRRYDAASAVDGAMERSVLVEGSMSPQLVIIGGILRQNPA* |
Ga0066903_1071381432 | 3300005764 | Tropical Forest Soil | MKSAEDGRRYDTAHVLDGAMDRSVFVERSVSSQLVVIGGIL |
Ga0066696_102382842 | 3300006032 | Soil | VVMKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0066696_103255501 | 3300006032 | Soil | MAMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLII |
Ga0066696_106557762 | 3300006032 | Soil | MVMKSAEDRRRYDAARVLDRAMDWGVFVERPMSPQLIIIGGIPGQNPACATDRSFAFS |
Ga0066656_103870922 | 3300006034 | Soil | MVMKAAEDGRRYDAAHVLDRAIDRSVLVERPMSPQ |
Ga0075365_103574481 | 3300006038 | Populus Endosphere | AIMVMKSAEDRNRCDAAYVLDRAMDRSVFAKRPMSPLLVIIGGISHQDAK* |
Ga0066652_1015435102 | 3300006046 | Soil | MVMKSAEDGHRYNVAHVLDGAMDRSVLVERPMSPQLIIVGGILRQN |
Ga0075417_106538082 | 3300006049 | Populus Rhizosphere | VVMKAAEHGCRYDAAHVLDGATVRSVFVERPMSPQLIIIGG |
Ga0075018_107030352 | 3300006172 | Watersheds | MVMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIIGGVLRQ |
Ga0070716_1008000012 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMQAAEGGRRYDAANVLDGALERSVFVERPMCPQLVVIGGILRQNPA* |
Ga0070712_1016132971 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQL |
Ga0074053_100148222 | 3300006575 | Soil | MVMKSAEDRHGCDAAYVLNGAMDRSVFAKRPMSPQLVIISGILRQNPA* |
Ga0066665_101210043 | 3300006796 | Soil | MVMKAAEDGRRYDAAHMLDGAMDRRVLVKRPMSPQLVVIGG |
Ga0066665_101673481 | 3300006796 | Soil | MVMKAAEDGRRYDAAHVLDRAIDRSVLVERPMSPQLIIISGILRQYP |
Ga0066665_105900331 | 3300006796 | Soil | VRKSDSAIMVMKAAQDGRRYDAAHVLDRAIDRSVLVERPMSPQLIIISGILRQYP |
Ga0066659_102074364 | 3300006797 | Soil | MKAAEDGRRYDAAHVLDGAIDRGVLVERPMSPQLIIIGGILRQNLA* |
Ga0066659_106188593 | 3300006797 | Soil | MKAAEDGRRYDAAHMLDGATDRSVFVEGPMSPQLIIIG |
Ga0066660_114464681 | 3300006800 | Soil | MVMNSAEDGRRYDAAHVLDGTTDRSVLIERPMSSQLIII |
Ga0075433_107865993 | 3300006852 | Populus Rhizosphere | VVMKAAKDGRRYDAAHLLDGAMDRSVFVERPMSPQLIII |
Ga0075425_1006159031 | 3300006854 | Populus Rhizosphere | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGSILRQDPA |
Ga0075424_1004163221 | 3300006904 | Populus Rhizosphere | MKAAEDGRMYDAAHVLDGAMDRSVLVERPMSPQLIIIG |
Ga0074063_100020092 | 3300006953 | Soil | IMVVKATDDRLRCDATYVLDSARDGGVFAKRLMSPQLVIISGIFRQDPA* |
Ga0075419_107393651 | 3300006969 | Populus Rhizosphere | MVVKAPDDRLRCDAADVLDGTMDWSVFVAKRPMSSQLVVVGSIL |
Ga0099794_100119801 | 3300007265 | Vadose Zone Soil | MKAAEDGRRYDATHVLNCAIDRSVLVERPMSPQLIIIGGILR |
Ga0099794_107013031 | 3300007265 | Vadose Zone Soil | MKAAEGGRRYDAAHVLDRATDRSVFVETPMGPQLIIIGG |
Ga0099795_100235622 | 3300007788 | Vadose Zone Soil | MVMKSAEDGHSCDAAYVLDGAMDRSIFAKRPMSPQLVIISGILRQDPA* |
Ga0066710_1000224818 | 3300009012 | Grasslands Soil | MKAAETGCRYDAAHVLDGATDRSVFVERPMSPQLIIIDGVLRQNPA |
Ga0066710_1000515491 | 3300009012 | Grasslands Soil | MKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0066710_1005443672 | 3300009012 | Grasslands Soil | MVMKSAEDGRRYDAAHLPDGAMDRSVFVERPMSSQLIIIDGILHQNPA |
Ga0066710_1005837361 | 3300009012 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDGAINRSVLVERPMGPQLIIISGILRQYPAQVRFA |
Ga0066710_1013485874 | 3300009012 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDRAIDRSVLVERPMSPQLIIISGILR |
Ga0066710_1018946151 | 3300009012 | Grasslands Soil | MKAAKDGRRYDAAHVLDGATDRGVLVERPMSPQLIIIGGILRQNPA |
Ga0099830_109003172 | 3300009088 | Vadose Zone Soil | MKAAEDGCGYDAAHVLDGAMDLSVLVETSMGPQIIIIGGV |
Ga0099830_118324893 | 3300009088 | Vadose Zone Soil | MKAAEDGRGSDRAHALDGAMDRSVFVERPMSPQPVIVGGILRQN |
Ga0099828_102691081 | 3300009089 | Vadose Zone Soil | MKAAEDGRRYDATHVLNCAIDRSVLVERPMSPQLIIIGGI |
Ga0099828_105258381 | 3300009089 | Vadose Zone Soil | MVMKAAEDGRRYDAAHVLDRAIYRSVLVERPMSPQLI |
Ga0111539_103406764 | 3300009094 | Populus Rhizosphere | MVVEAPNDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGSILRQDPAQVRFAQD |
Ga0075418_104711551 | 3300009100 | Populus Rhizosphere | MVMKSVEDRNRCDATYVLDGAMDRSVFVKRPMSPLRVIIGGISHQDAK* |
Ga0075418_106766792 | 3300009100 | Populus Rhizosphere | MVMKSAEDRNRCDAAYVLDRAMDRSVFAKRPMSPLLVIIGGISHQDAK* |
Ga0075418_113067671 | 3300009100 | Populus Rhizosphere | MVVKATDDRLRCDAAYVLDGTMDWSVFAKRPMGPQLVIISAILRQDSA* |
Ga0075418_126603891 | 3300009100 | Populus Rhizosphere | MVMKSAEDGRRYDTAHVLDGAMDWSVFFERPMRPQLVIISGILRQNPA* |
Ga0066709_1004609661 | 3300009137 | Grasslands Soil | MKVAEDGRRYDAAHVLDGAIDRGVLVERSMSPQLIIIGGILRQNLA* |
Ga0066709_1005847554 | 3300009137 | Grasslands Soil | MVMKAAEDGRRYEAAHVLDRATDRSVLVESPMSPQLIIISGILRQDPA* |
Ga0066709_1009749643 | 3300009137 | Grasslands Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIIGGILRQNPAQVHFAQ |
Ga0066709_1009816821 | 3300009137 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDGDRSVLVERPMSPQLIIISGILRQYPAQVRFA* |
Ga0066709_1012213051 | 3300009137 | Grasslands Soil | MVMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIVGGIL |
Ga0066709_1014469272 | 3300009137 | Grasslands Soil | MEAAKDGRRYDAAHLLDGAMDRSVLVERAMRPQLVIVGGILRQ |
Ga0114129_107066511 | 3300009147 | Populus Rhizosphere | MKAAEDGRGSDRAHALDGAMDRSVFVERPMSPQPVIVGGILRQ |
Ga0075423_108007542 | 3300009162 | Populus Rhizosphere | MVVKAPDDRLRCDAAYVLDGTMDWSVFVAKRPMSSQLVVVGSILR* |
Ga0075423_131690721 | 3300009162 | Populus Rhizosphere | VMKAAEDGRRYDAAQLLDGAMDRSVLVERPMSPQLIIIASILR* |
Ga0105858_10886381 | 3300009661 | Permafrost Soil | MVMQSTQDGRRYDAARVLDGSMHRRILVERPVRPQLIIVSGIP |
Ga0126384_105037372 | 3300010046 | Tropical Forest Soil | MMMKSAEDGRRYDAAYVVDGAMDRSVLVQRSMSPQLVIIGGILSQYPA* |
Ga0126384_113324072 | 3300010046 | Tropical Forest Soil | MKAVEDGRRYNVAHALDGAVDRSITLERSLSRQLVIIGGI |
Ga0126373_116104031 | 3300010048 | Tropical Forest Soil | MVMKSAEDGRRYDAAAVVDGAMDRSVLVEGSMSPQLVIIDGILRQNPA* |
Ga0099796_104433762 | 3300010159 | Vadose Zone Soil | MVMKSAEDRHSRDAAYVLDGAMDRSIFAKRPMSPQLVIISGILRQDPA* |
Ga0134082_100102846 | 3300010303 | Grasslands Soil | MKAAEDGHRYDAALVLNGATDRSVFVERPMSPQRIIIG |
Ga0134082_102142211 | 3300010303 | Grasslands Soil | MKAAEDGDRYDADHVLDGATDRGVFVERPMSPHLIILG |
Ga0134088_105113261 | 3300010304 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDGAINRSVLVERPMSPQL |
Ga0134088_106854422 | 3300010304 | Grasslands Soil | MTAAQDGRRYDAAHVLDGAMDRSVLVERPMSPQLIIVGGILR |
Ga0134067_103516092 | 3300010321 | Grasslands Soil | GRRYDVARMLDGAMDRSVLVERPMSPQLIIIDGIIIDGILRQNPA* |
Ga0134086_102365032 | 3300010323 | Grasslands Soil | MKAAEDGCRAAHVLDGATDRSVFVERPMSPQLIIIGGV |
Ga0134064_102275731 | 3300010325 | Grasslands Soil | MVMKAADDGRRYDAAHVLDRATYRSVLVERPMSPQLIIIGGILRQNPA |
Ga0134111_103364541 | 3300010329 | Grasslands Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIISGIL |
Ga0134080_104816702 | 3300010333 | Grasslands Soil | MKVAEDGHRYDAAHVLDGAIDRGVVVERSMSPQLIIIDGILRQNPA* |
Ga0134063_100028101 | 3300010335 | Grasslands Soil | MKAAETGCRYDAAHVLDGATDPSVLVERSMGPQLIIIGGVL |
Ga0134063_100843491 | 3300010335 | Grasslands Soil | MKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQNPA |
Ga0134063_101230171 | 3300010335 | Grasslands Soil | MKAAEDRRRYDAAHVLDGATDPSVLVERSMGPQLIIIGGVLRQNPA* |
Ga0134063_101782553 | 3300010335 | Grasslands Soil | MVMKAAQDGRRYDAAHVLDRAIDRSVLVERPMSPQLIIISGILRQYP |
Ga0126378_102452513 | 3300010361 | Tropical Forest Soil | MVMKSAEDGRRYDAAHVLDVTMDRSVLVERSMSPQLVIIAGILRQNPAQVRFAQDN* |
Ga0105239_118453571 | 3300010375 | Corn Rhizosphere | MVMKSAEDGRRYDTAHVLDGAMDWSVFVERPMRPQLVIISGILRQNPA* |
Ga0105239_124217371 | 3300010375 | Corn Rhizosphere | MVVKATDDRLRCDAAYVLDGTMDWSAFAKRPMSPQLV |
Ga0126383_114633762 | 3300010398 | Tropical Forest Soil | MVMKSAEDGRRYDAASVVDGAMDRSVLVEGSMSPQLVIIGGILRQNP |
Ga0126383_118395641 | 3300010398 | Tropical Forest Soil | MVMKSAEDRNRCDAAYVLDGAMDRSVFAKRPMSPLIIGGISHQDAK* |
Ga0126383_131729132 | 3300010398 | Tropical Forest Soil | MVMKSAKDGRRYDAASVVDGAMDRSVLVEGSMSPQLVIIGGILRQNP |
Ga0138505_1000618901 | 3300010999 | Soil | DMKSAEDGRRYDAARMLDGAMARSVFVERSMCPQLIIISGILRQNPA* |
Ga0138513_1000228751 | 3300011000 | Soil | LVVKATDDRHRCDAAFVLDGTMDWSVFAKRPMSPQ |
Ga0105246_108806121 | 3300011119 | Miscanthus Rhizosphere | KLNSTIMVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMGPQLVIISAILRQDSA* |
Ga0137392_106281242 | 3300011269 | Vadose Zone Soil | MKAAEDGRRCDAAHVLDRAIDRGVLVERSMSPQLIIIDGILRQNPA* |
Ga0137391_107909141 | 3300011270 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVLRQ |
Ga0137391_112763021 | 3300011270 | Vadose Zone Soil | MKAAEDGRRYDATHVLNCAIDRSVLVERPMSPQLIIIGGILRQN |
Ga0137429_12008032 | 3300011437 | Soil | MVMKSAEDGRRYDAAHVLDGAMDRSIFAKRSMSPQRVIIGGIFRQNPA* |
Ga0120191_100714381 | 3300012022 | Terrestrial | IMGMKSAEDERRYYAAHVLDGAMDRSVLVERSMSPQLVIIGGILRQNPA* |
Ga0137364_100965461 | 3300012198 | Vadose Zone Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0137364_102588091 | 3300012198 | Vadose Zone Soil | MVMKAAEDGRRYDAAHVLDGAINRSVLVERPMSPQLIIISGILRQYPAQVRFA* |
Ga0137364_105494652 | 3300012198 | Vadose Zone Soil | VCTENLDAAIVVMKPAEDRCRYDVAHVLDGATDRSVFVERPMSPQLIIIGGVLRQNPA* |
Ga0137364_109637302 | 3300012198 | Vadose Zone Soil | MKAAEHGCRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0137364_110613532 | 3300012198 | Vadose Zone Soil | MVMKAAEDGHRYNVAHVLDGAMDRSVLVERPMSPQLIIVGGILRQNPA* |
Ga0137364_112072221 | 3300012198 | Vadose Zone Soil | MKAAEDGRRYDSTNVLDGATDRSVLVEKPMSPQHIII |
Ga0137383_102628272 | 3300012199 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVLRQNP |
Ga0137383_106301401 | 3300012199 | Vadose Zone Soil | MKAAEDGGRYDVAQLLDGAMDRSVFVKRPMGPQLIIIGGILRQNPA* |
Ga0137365_105238631 | 3300012201 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVLRQNPA* |
Ga0137363_106268362 | 3300012202 | Vadose Zone Soil | MKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQ |
Ga0137363_111381322 | 3300012202 | Vadose Zone Soil | SAIMVMKSAEDGRRYDAAHVLDGAMDRSVFVERPMSSQLIIIGGILRQNPA* |
Ga0137363_112627522 | 3300012202 | Vadose Zone Soil | MKAAEDGRGSDRAHALDGAMDRSVFVERPMSPQPVIVGGI |
Ga0137363_117326471 | 3300012202 | Vadose Zone Soil | MIVMKPAEDGRRNDAAHVLDGAMDRCVLVERPMSPQLIIVG |
Ga0137363_118316232 | 3300012202 | Vadose Zone Soil | MKAVKDGHRYDAAHVLDGAMDRSVLVERSMSSQLGIVGGIPR* |
Ga0137399_102924224 | 3300012203 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVVRTEN* |
Ga0137374_105370013 | 3300012204 | Vadose Zone Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVFVERQMSPQLIIVGSILRQNPA* |
Ga0137362_102408463 | 3300012205 | Vadose Zone Soil | MKSAEDGRRYDAAHVLDGAMDRSVFVERPMSSQLIIIGGILRQNPA* |
Ga0137362_115049512 | 3300012205 | Vadose Zone Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVLVERPMRPQLVIIDKGGNPAS* |
Ga0137381_100529296 | 3300012207 | Vadose Zone Soil | LDSAIVVMKAAADGRRYDAAHVLDGAIDRGVLVERPMSPQLIIIGGILRQNLA* |
Ga0137381_106524671 | 3300012207 | Vadose Zone Soil | MVMKSAEDGRRYDAAHVLDGAMDRRVLVERPMRPQLVIIDKGGNPAS |
Ga0137378_100659331 | 3300012210 | Vadose Zone Soil | MVMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIVGGILR |
Ga0137378_108575541 | 3300012210 | Vadose Zone Soil | VVIKAAEDGRGSDGAHALDGAMDRSVFVERPMSPQPVIVGGILRQNP |
Ga0137378_110008601 | 3300012210 | Vadose Zone Soil | DGHRYDAALVLDGATDRSVFVERPMSPQLIIIDGVLRQNPA* |
Ga0137378_111777042 | 3300012210 | Vadose Zone Soil | MKAAKDGRRYDAAHVLDGAMDRSVFVERPMSPQLIIIGGVLRQNPA* |
Ga0137377_101835832 | 3300012211 | Vadose Zone Soil | MKAAEDGRRYDAAHVLDGAMDRSVLVERPMSPQLII |
Ga0137377_104501104 | 3300012211 | Vadose Zone Soil | LDSAIVVMKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVVCTEN* |
Ga0137377_104623122 | 3300012211 | Vadose Zone Soil | MVMKSAEDGRRYDVAHVLDGAMDRSVLVERPMSPQLIIVGGILRQNPA* |
Ga0150985_1013712551 | 3300012212 | Avena Fatua Rhizosphere | MVVKATDDRLRCDATYVLDSSRDGGVFAKRLMSPQLVIISGIFRQDPA* |
Ga0137370_100519671 | 3300012285 | Vadose Zone Soil | MVMKSAEDGHRYDAAHVLDGTMDRSVLIERPMSSQLIIIGGILRQNPA* |
Ga0137370_103419411 | 3300012285 | Vadose Zone Soil | VVIKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLR |
Ga0137370_104303711 | 3300012285 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGV |
Ga0137386_113173892 | 3300012351 | Vadose Zone Soil | MVMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLII |
Ga0137366_104423991 | 3300012354 | Vadose Zone Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVFVERPMSPQLIIVGSILRQNPA* |
Ga0137369_111325482 | 3300012355 | Vadose Zone Soil | MAMKSSADGRRYDAAHVLDGAMDRSVLVERPMSPQLIIIGGI |
Ga0137371_102019331 | 3300012356 | Vadose Zone Soil | MVMKSSEDGRRYDAAHVLDGAMYWSVLVERAMRPQLVIVDGIL |
Ga0137384_105075651 | 3300012357 | Vadose Zone Soil | MVMKAAEDGRRYDAAHVLDRAINRSVLVERPMSPQLII |
Ga0137360_100659121 | 3300012361 | Vadose Zone Soil | MEIKSSEDGRRYDAAHVLDGAMDRSVLVERAMRPQLVIVGGILR* |
Ga0137360_102541081 | 3300012361 | Vadose Zone Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVFVERPMSSQLIIIGGILRQNPA* |
Ga0137360_108852152 | 3300012361 | Vadose Zone Soil | MVMKSSEDGRRYDAAHVLDGAMDRSVLVERAMRPQLV |
Ga0137360_109217102 | 3300012361 | Vadose Zone Soil | MKAAEDGCRYDAAHVLDGAMDRSVLVERPMSPQLIIIGSILRQNPA* |
Ga0137361_100507986 | 3300012362 | Vadose Zone Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIIGGILRQ |
Ga0137361_102025875 | 3300012362 | Vadose Zone Soil | MKAAEDGRGYDAAHVLDGAMDRSVFVERPMSPQLIIVGSILRQNPA* |
Ga0137361_107880853 | 3300012362 | Vadose Zone Soil | MKAAEDGRGSDRAHALDGAMDRSVFVERPMSPQPVIVGGILRQNPA |
Ga0137361_113480522 | 3300012362 | Vadose Zone Soil | MKAAEDGRMYDAAHVLNGAMDRSVLLERSMSPQLVIVGGIPH* |
Ga0137390_105653323 | 3300012363 | Vadose Zone Soil | MNEQEVVKSAEDGRRYDAAHVLDGAMDRSVLVERPMSPQLIIIDSIL |
Ga0137390_106344793 | 3300012363 | Vadose Zone Soil | MKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQNPA* |
Ga0137390_112600592 | 3300012363 | Vadose Zone Soil | MKSAEDGRRYDAAHVLDGAMDRSVLVERPMSPQLIIIDSIL |
Ga0137390_120006681 | 3300012363 | Vadose Zone Soil | MVMKAAEDGRRYDAAHVLDRAIYRSVLVERPMSPQLIIIGGILRQNP |
Ga0134035_12974732 | 3300012391 | Grasslands Soil | MKAAEDGRRYDAAHVLDSAMDRSVLVERPMSSQLIIIGGILPQNPA* |
Ga0137358_102404971 | 3300012582 | Vadose Zone Soil | VVIKAAEDGRGSDGAHALDGAMDRSVFVERPMSPQLIIVGGILR |
Ga0157286_102328642 | 3300012908 | Soil | TIMVVKATDDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGSILR* |
Ga0137396_108192442 | 3300012918 | Vadose Zone Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIIGGILRQNS |
Ga0137359_102222351 | 3300012923 | Vadose Zone Soil | MKAAEDGRRYDSTDVLDGAMDRSVFVERPMSPQLIIIGGVLRQNPA* |
Ga0137359_105821082 | 3300012923 | Vadose Zone Soil | MKAAEGGRRYDAAHVLDRATDRSVFVETPMGPQLIIIGGVLRQ |
Ga0137359_110754921 | 3300012923 | Vadose Zone Soil | MKAAEDGCRYDAAHVLDGAMDRSVFVERPMSPQLIIIGGVVCTEN* |
Ga0137413_112512992 | 3300012924 | Vadose Zone Soil | MVMKSAEDRHRCDAAYVLNGAMDRSVFAKRPMSPQLIIISGILRQDPT* |
Ga0137419_109587363 | 3300012925 | Vadose Zone Soil | MVMKSAEDRHRCDAAYVLNGAMDRSVFAKRPMSPQLI |
Ga0137416_120202861 | 3300012927 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLI |
Ga0137407_100704943 | 3300012930 | Vadose Zone Soil | MKAAEDGCRYDSTDVLDGAMDRSVLVERPMSPQLIIIGSI |
Ga0126375_116981861 | 3300012948 | Tropical Forest Soil | MKAAKDRRRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0164298_110093232 | 3300012955 | Soil | MKSAEDRRRYNTAHVLDGAMDRSVFVEKPMSPQLVVVGGIPR |
Ga0164298_115296542 | 3300012955 | Soil | MMVMKSAEDGRRYDAAYVPDGAMDRSVFAKRPMIPQLVIIKG* |
Ga0164303_1000013918 | 3300012957 | Soil | MMMKSAEDRHRCDAAYVLDGAMDRSVFAKRPMSSQLVIISGILRQDPA* |
Ga0164299_109560681 | 3300012958 | Soil | MVMKSAKDRPRYDAAYVLNSAGDRSVFAKRSMGPQ |
Ga0164301_100082674 | 3300012960 | Soil | MVVKATDDRLRCDATYVLDSARDGGVFGKRLMSPQLVIISGIFRQ |
Ga0164301_103544783 | 3300012960 | Soil | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVG |
Ga0164301_106897421 | 3300012960 | Soil | VVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGS |
Ga0164301_108726181 | 3300012960 | Soil | MKAAEEGRRYDAACVLDYAMDRSVLVERPMSPQLIIIASILR* |
Ga0126369_130823171 | 3300012971 | Tropical Forest Soil | LCVLNSAIVVMKAAEERRGSDRAHARDGTMDRSVFVERPMSPQPFIVGGILRQNPA* |
Ga0126369_132049622 | 3300012971 | Tropical Forest Soil | MVMKSAEDGRRYDAASVVDGAMDRSVLVEGSMSPQLVIIGGILRQNPA* |
Ga0134110_101300701 | 3300012975 | Grasslands Soil | MKAAEDGCRYDAAHVLDGATDRSVFVKRPMSPQLIIIG |
Ga0134110_102045072 | 3300012975 | Grasslands Soil | MKAAETGCRYDAAHVLDGATDRSVFVERPMSPQLIIIDGV |
Ga0134110_102624882 | 3300012975 | Grasslands Soil | MKAAEDRRRYDAAHVLDGATDRSVFVERPMSPQLIIIDG |
Ga0134110_104561281 | 3300012975 | Grasslands Soil | MKAAEDGHRYDAAHVLDGATDWGVFVERPMSPQLIIIGGVLRQ |
Ga0134087_102668071 | 3300012977 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDGAINRSVLVERPMGPQLIIISGILRQYPAQ |
Ga0134087_104690803 | 3300012977 | Grasslands Soil | KSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIVGGILRQNPA* |
Ga0164307_105165622 | 3300012987 | Soil | MVVKATDDRLRCDAAYVLDGTMDWSVFAKRPMGPQLVIISAILRQDLA* |
Ga0164305_109203611 | 3300012989 | Soil | MVVEAPNDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGSILRQDPAQVRFAQDN |
Ga0157378_103967331 | 3300013297 | Miscanthus Rhizosphere | MVVKATDDRLRCDATYVLDSARDGGVFGKRLMSPQLVIISGIFR* |
Ga0134078_101821393 | 3300014157 | Grasslands Soil | MKAAEDGRRDDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQ |
Ga0180076_10531691 | 3300014867 | Soil | IMVMKSAEDRHGCDAAYVLNGAMDRSVFAKRPMSPQLIIISGITAVRQF* |
Ga0134072_101557871 | 3300015357 | Grasslands Soil | MKPAEDGRRYDAAHVLDGATDRSVFIEGPMSPQLIII |
Ga0134085_102154532 | 3300015359 | Grasslands Soil | MKAAEDGRRYDAAHVLDGATDRSVFVERPMSPQLIIIGGILRQN |
Ga0134085_102193641 | 3300015359 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDGDRSVLVERPMSPQLIIISGILRQYPAQVRFAQ |
Ga0132256_1000885523 | 3300015372 | Arabidopsis Rhizosphere | MVVKSAEDRYRCDAAYVLDDAMDRSVFAKRPMSPQLVIISGILRQDPA* |
Ga0132257_1015468551 | 3300015373 | Arabidopsis Rhizosphere | MVVKATDDRLRCDATYVLDSARDGGVFAKRLMSPQLVIISGIFRQDPA* |
Ga0132255_1054461471 | 3300015374 | Arabidopsis Rhizosphere | MVVKAHDRLRCDAAYLLEGTMDWSVFAKRPMSSQLVVVVSILRQDPAQVHFA |
Ga0182033_114952452 | 3300016319 | Soil | MKAAKDGRRYDAAHLLDGAMDRSVFVERPMSPQLV |
Ga0182035_100077947 | 3300016341 | Soil | MVMKSAEDGRRYDAASVVDGAMDRSALVEGSMSPQLVIIDGILRQNPAYVPFA |
Ga0134069_12041033 | 3300017654 | Grasslands Soil | MVMKSAEDGRRYNVAHVLNGAMDRSVLVERPMSPQLIIVG |
Ga0134074_10299231 | 3300017657 | Grasslands Soil | MKAAENGCRYDAAHVLDGAIDRSVFVERPMSPQLIIIGGVLRQNPA |
Ga0134083_101453021 | 3300017659 | Grasslands Soil | MKAAETGCRYDAAHVLDGATDRSVFVERPMSPQLIIIDG |
Ga0190266_100929951 | 3300017965 | Soil | MVVKPPDDRLRCDAAYVLDGTMDWSVFAKRSMSPQLVVVGSILCQDPA |
Ga0184604_102077331 | 3300018000 | Groundwater Sediment | MMMKSAEDRHSCDGAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0184605_100125085 | 3300018027 | Groundwater Sediment | MVMKSADDRHRYDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0187867_103533991 | 3300018033 | Peatland | MVMKAAEDKRRYDAVHVLVRAIDRSIFIERPMGSQFAIEDGIPA |
Ga0184621_100067995 | 3300018054 | Groundwater Sediment | MVMKSAEDRHRCDAADVLDGAMDRSVFAKRPMSPRLIIISGILRQNPA |
Ga0184621_100429211 | 3300018054 | Groundwater Sediment | MMMKCAEDRHRCDAAYVLDGAIDRSVFAKRPMSPQ |
Ga0184621_100643733 | 3300018054 | Groundwater Sediment | MVVKATDDRLGCDAAYVLAGTMDWSVFAKRPMSPQLVIISGISCQDSA |
Ga0184619_100268305 | 3300018061 | Groundwater Sediment | MMKSAEDRHRCDAADVLDGAMDRSVFAKRPMSPQL |
Ga0184619_100568141 | 3300018061 | Groundwater Sediment | MVMKSAEDRHRCDAAYVLNGAMDRSVFAKRPMSPQLIIISGILRQ |
Ga0184618_100512342 | 3300018071 | Groundwater Sediment | MMKSAEDRHSCDAAYVLGGTMDRSVFAKRPMSPRLIIISGILRQ |
Ga0184635_100186062 | 3300018072 | Groundwater Sediment | MKSAEDRHGCDAAYVLDGAMDRSVFAKSPQLTIISIISGILRQSPA |
Ga0184624_100481371 | 3300018073 | Groundwater Sediment | VVKATDDRLRCDTALVLDGTMDWSVFAKRPMSPQLVVVGS |
Ga0184633_105613642 | 3300018077 | Groundwater Sediment | MKSAEDRHGCDAAYVLDGAMDRSVFAKSPQLTIISIISGIL |
Ga0184625_100826683 | 3300018081 | Groundwater Sediment | MMMKSAEARHSCDAAYVLDGAMDRSVFAKRPMSPQLVIISGIRRQN |
Ga0066655_100814373 | 3300018431 | Grasslands Soil | MKAAEDRRRYDAAHVLDGATDPSVLVERSMGPQLIIIGGVLRQDPA |
Ga0066655_102243182 | 3300018431 | Grasslands Soil | MKAAKDGRRYDAAHLLDGAMDRSVFVERPMSPQLVIV |
Ga0066655_107237921 | 3300018431 | Grasslands Soil | MKAAENGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQN |
Ga0066667_105207063 | 3300018433 | Grasslands Soil | MKGAENGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGILRQ |
Ga0066667_105488441 | 3300018433 | Grasslands Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIIGG |
Ga0066667_105960104 | 3300018433 | Grasslands Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQNPA |
Ga0066667_110758151 | 3300018433 | Grasslands Soil | AAIIVMKAAEDGRRYDAAYVLDGAVDRSVFVERPMSPQLVIMGSILRTGGERRRRAK |
Ga0066667_117162201 | 3300018433 | Grasslands Soil | GRYDVAQLLDGAMDRSVFVKRPMGPQLIIIGGILRQNPA |
Ga0066667_121797861 | 3300018433 | Grasslands Soil | MKAAENGCRYDAAHVLDGATDRSVFVERPMSPQLIII |
Ga0066662_107709642 | 3300018468 | Grasslands Soil | MAMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIVG |
Ga0066662_118283452 | 3300018468 | Grasslands Soil | MKAAEDGRRYDAAHLLDGAMNRGVLVERPMSPQPIII |
Ga0066662_127436071 | 3300018468 | Grasslands Soil | MMMKSTEDGRTYDAARVLDGARDRSVLVERPIGSQLIVIGGIF |
Ga0190270_128673171 | 3300018469 | Soil | MMMKSAEARHSCDAAYVLDGAMDRSVFAKRPMSPQLVII |
Ga0190271_119956813 | 3300018481 | Soil | MVVKAIHDRHRCDAAFVLDGTMDWDVFAKRPMSPQLVVVSSILRKD |
Ga0066669_106670851 | 3300018482 | Grasslands Soil | MMMKSTEDGRTYDAARVLDGARDRSVLVERPMGSQLIIIGGIF |
Ga0066669_113656841 | 3300018482 | Grasslands Soil | MKAAQDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQNP |
Ga0066669_115260892 | 3300018482 | Grasslands Soil | MKAAEDGCRYDAAHVLDGATDRSVFVKRPMSPQLII |
Ga0066669_120587561 | 3300018482 | Grasslands Soil | MVMKAAEDGRRYDAAHVLDGAINRSVLVERPMSPQ |
Ga0066669_123764922 | 3300018482 | Grasslands Soil | MKSAEDGRRYDVARMLDGAMDRSVLVERPMSPQLIIIDG |
Ga0180115_10412301 | 3300019257 | Groundwater Sediment | MKSAEDGRRYDAAHVLDGAMDRSIFAKRSMSPQLVIIG |
Ga0193729_10327154 | 3300019887 | Soil | MMMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0193729_10680352 | 3300019887 | Soil | MVMKSAEDRHRCDAAYVLDGAMDRSVFAKRPMSPQ |
Ga0193731_10119513 | 3300020001 | Soil | MKSAEDRHRCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0179594_100373402 | 3300020170 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPQLIIIGGVVCTEN |
Ga0179592_104993411 | 3300020199 | Vadose Zone Soil | MVMKSAEDGRRYDAADVLDGAMDRSVLVERPMSSQLIIIGGILRQNPT |
Ga0210404_107557331 | 3300021088 | Soil | MKAAEDGRRCDAAHVLDGAADRGVLVERSMSPQLIII |
Ga0210406_109651572 | 3300021168 | Soil | MKAAEDGRMYDAAHVLDGAMDRSVLLERSMSPQLVIVGGIPR |
Ga0193699_100061151 | 3300021363 | Soil | MMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPRLIIISGILRQNPA |
Ga0193699_103850722 | 3300021363 | Soil | MVMKSAEDRHSRDAAHVLDGAMDRSIFAKRPMSPQL |
Ga0193699_104909711 | 3300021363 | Soil | MVVKATDDRLGCDAAYVLAGTMDWSVFAKRPMSPQLVII |
Ga0210397_112935461 | 3300021403 | Soil | MKAAEDGRRYDAAHVLDGAMDRSVLVERPMSPRLIIIDSILRQNP |
Ga0193694_10281192 | 3300021415 | Soil | MVMKSAEDRHRCDAAYVLDGAMDRSVFAKRPMSPQLIIISGILRQNP |
Ga0210392_107487071 | 3300021475 | Soil | MKTAEDGRGSYRTHALDGAMDWSVFVERPMSPQSVI |
Ga0222625_18218322 | 3300022195 | Groundwater Sediment | LYRKSDFAIMVMKSAQERPRCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0247788_11101242 | 3300022901 | Soil | MVVKATDDRLRCDAAYVLDGTMDWSAFVKRPMSPQLVIINGILRQDPA |
Ga0247661_10092773 | 3300024254 | Soil | MVVKATDDRLRCDATYVLDGTMDRSVFAKRPMGPQLVI |
Ga0207682_101194452 | 3300025893 | Miscanthus Rhizosphere | MVVKATDDRLRCDAAYVLDGTMDWSVFDKRPMGPQLVIISAILRQDSA |
Ga0207647_100978912 | 3300025904 | Corn Rhizosphere | MVVKATDDRLRCDATYVLDGTMDRSVFAKRPMGPQLVIISAILRQDSA |
Ga0207685_104654121 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDGRRCDAAHLLDGAMDRSVLVERPMRPQLVIIGR |
Ga0207643_104406711 | 3300025908 | Miscanthus Rhizosphere | MTCLYQKLNSTIMVVKATDDRLRCDAAYVLDGTMDWSAFVKRPMSPQLVIINGILRQDPA |
Ga0207662_108034382 | 3300025918 | Switchgrass Rhizosphere | MVVKATDDRLRCDATYVLDGTMDWSVFAKRPMGPQLVIISAILRQDSA |
Ga0207646_101536333 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVMKSAEDRDRCDAAYVLDGAMDRSVFAKRPMSPRLIIIGGILPKDPAQVCLPRT |
Ga0207700_104146031 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSPT |
Ga0207686_101549862 | 3300025934 | Miscanthus Rhizosphere | MVVKATDDRLRCDAAYVLDGTMDWSVFAKRPMSPQ |
Ga0207651_110181051 | 3300025960 | Switchgrass Rhizosphere | MTCLYQKLNSTIMVVKATDDRLRCDATYVLDGTMDRSVFAKRPMGPQLVIISAILRQDSA |
Ga0207677_109213341 | 3300026023 | Miscanthus Rhizosphere | MVMKSAEDRPRCDAAYVLDGAMDRSVFAKRPMSPQLVIIIGILRQDPA |
Ga0207678_100041941 | 3300026067 | Corn Rhizosphere | MVVKATDDRLRCDATYVLDSARDGGVFGKRLMSPQLVIISGIFRQD |
Ga0207676_121547251 | 3300026095 | Switchgrass Rhizosphere | MVMKSAEDRPRCDAAYVLDGAMDRSVFAKRPMSPQLVIII |
Ga0207675_1011511733 | 3300026118 | Switchgrass Rhizosphere | MVMKAAEDGRRYDAAHVLDRAIYRSVLVERPMSPQLIIIG |
Ga0209238_11248902 | 3300026301 | Grasslands Soil | MKAAEDGCRYDAAHVLDGAMDRSVFVERPMSPQLVIVGGILRQNPA |
Ga0209240_11351121 | 3300026304 | Grasslands Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLI |
Ga0209240_11814001 | 3300026304 | Grasslands Soil | MVMKSAEDGRRYDSAHVLDGAMDRSVFVERPMSPQLIIIGGVLCQNPVQ |
Ga0209265_10603132 | 3300026308 | Soil | MKAAEDGCRYDAAHVLDGATDRSVFVKRPMSPQLIIIGGVLRQN |
Ga0209647_10662842 | 3300026319 | Grasslands Soil | MKAAEDGCRYDAAHVLDGAMDRIVFVERPMGPQLVIVGGILRQNSA |
Ga0209131_10241182 | 3300026320 | Grasslands Soil | MKAAEDGCRYDAAHVLDGAMDRSVFVERPMGPQLVIVGGILRQNSA |
Ga0209470_13342572 | 3300026324 | Soil | MAMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLIIVGSILR |
Ga0209473_11207011 | 3300026330 | Soil | MKAAEDRRRYDAAHVLDGATDPSVLVERSMGPQLI |
Ga0209057_11276401 | 3300026342 | Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLR |
Ga0209159_11631742 | 3300026343 | Soil | MKAAEDGRRYDAAHVLDGAIDRSVLVERPMSPQLIIIGGILRQNP |
Ga0257173_10036542 | 3300026360 | Soil | MKAAEDGCRYDAAHVLDGATDRSVLVERPMSPQLIIIG |
Ga0257157_10364112 | 3300026496 | Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVLVERPVCPQLVVIGGILRQNPA |
Ga0257156_10291461 | 3300026498 | Soil | SAIVVMKAAEDGCRYDAAHVLDGAMDRSVFVERPMGPQLVIVGGILRQNSA |
Ga0257165_10590121 | 3300026507 | Soil | MKAAEDGRRYDATHVLNCAIDRSVLVERPMSPQLIIIGGILRQNPAQVRFAQDNYV |
Ga0209690_11051131 | 3300026524 | Soil | MKAAEDGRRYDAAHMLDGATDRSVFVEGPMSLIIIG |
Ga0209378_10612883 | 3300026528 | Soil | MKAAEDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGGVLRQ |
Ga0209806_10175024 | 3300026529 | Soil | SAIMVMKSAEDGRRYNVAHVLDGATDWSVFVEGPMSAQLIIIGGVLRQNQA |
Ga0209056_100774344 | 3300026538 | Soil | MAMKSAEDGHRYNVAHVLDGAMDRSVLVERPMSPQLIIVGSILRQNPA |
Ga0209056_102986441 | 3300026538 | Soil | MKAAEDGRRYDAAHVLDGATDQSVFVERPISPQLI |
Ga0209056_104093652 | 3300026538 | Soil | MVMKSAEDGRRYNVAHVLDGAMDRSVLVERPMSPQLI |
Ga0209376_12154271 | 3300026540 | Soil | IMVMKSAEDGRRYNVAHVLDGATDWSVFVEGPMSAQLIIIGGVLRQNQA |
Ga0209156_103955361 | 3300026547 | Soil | MKAAEDGHRYDAAHVLDGATDWGVFVERPMSPQLIIIGGVLR |
Ga0209161_101990751 | 3300026548 | Soil | MVMKSAEDGRRYNVAHVLDGATDWSVFVEGPMSAQLI |
Ga0209161_104508671 | 3300026548 | Soil | MKAAEDRRRYDAAHVLDGATDPSVLVERSMGPQLIIIGG |
Ga0209474_100515451 | 3300026550 | Soil | MVMNSAEDGRRYDAAHVLDGTTDRSVLIERPMSSQLIIIGCILHQNP |
Ga0209648_100455861 | 3300026551 | Grasslands Soil | MKAAKDGCRYDAAHVLDGATDRSVFVERPMSPQLIIIGSILRQ |
Ga0209648_107234641 | 3300026551 | Grasslands Soil | MKAAEDGRRYDATHVLNCAIDRSVLVERPMSPQLII |
Ga0209648_107728641 | 3300026551 | Grasslands Soil | MMMKSAEDGRRYDAARMLDGAMDRSIFAERPMSPQL |
Ga0209577_108662832 | 3300026552 | Soil | MVVKSAEDRRRYDAADVLDGAMDRSVLIERPMSSQLII |
Ga0209213_10598543 | 3300027383 | Forest Soil | MVMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0208637_10060621 | 3300027401 | Soil | LYRKSDSGIMVMKSAEDGRRYDAAHVLDGAMDRSIFAKRSMSPQLVIIGGIFRQNPA |
Ga0208984_10303211 | 3300027546 | Forest Soil | MVMKSAEDRHRYDATYVLDGAMDRSVFAKRPMSPQLVVISGILRQNPA |
Ga0208990_10212544 | 3300027663 | Forest Soil | MVVKATHDRLRCDAAFVLDGTMDRCVFAKRPVSSQLVVVGGIFRQ |
Ga0209283_101012791 | 3300027875 | Vadose Zone Soil | MVMKAAEDGRRYDATSALDGAMDRRILVEGPMSPQLVIVGSILPQNPAQMGLCLPQTIS |
Ga0209488_107554372 | 3300027903 | Vadose Zone Soil | MKAAEDGHRYDAALVLDGATDRSVFVERPMSPPLIIIG |
Ga0307295_100250271 | 3300028708 | Soil | MVIKSAEDRPRCDAADVLDGAMDLSVFAKRPMSPQLVIISGILR |
Ga0307293_101516142 | 3300028711 | Soil | MVIKSAEDRPRCDAADVLDGATDLSVFAKRPMSPQLVIISGILRQDPA |
Ga0307285_100086651 | 3300028712 | Soil | MMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPRLII |
Ga0307285_102537411 | 3300028712 | Soil | DSCLYRKLNSTIMVVKATDDRLGCDAAYVLAGTMDWSVFAKRPMSPQLVIISGISCQDSA |
Ga0307316_100376461 | 3300028755 | Soil | MVMKSAEDRPRCDAAYVLDGAMDRSVFAKRPMSPQLVIISG |
Ga0307316_103076782 | 3300028755 | Soil | IHDRHRCDAAFVLDGTMDWSVLAKKAMSPQLVVVSSILRKDPA |
Ga0307280_102645991 | 3300028768 | Soil | MVMKPAEDGHRYDAARVLDGAMDRSVFVDIPMSPHLVVVGGIPRQNPAQAGFAQDNQ |
Ga0307323_100219272 | 3300028787 | Soil | MVMKAAEDGRRCDATHMLDGAMDRMSPQLIIIGGILRQNPA |
Ga0307323_100858213 | 3300028787 | Soil | MMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPQLIIISGILRQNPA |
Ga0307323_102037642 | 3300028787 | Soil | RKLNSTIMVVKATDDRLRCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDLA |
Ga0307290_100299572 | 3300028791 | Soil | MVMKAAEDGRRCDATHMLDGAMDRMTPQLIIIGGILRQNPA |
Ga0307299_103663092 | 3300028793 | Soil | MMMKSAEDRHSCDAAYVLDGAMDRSVVAKRPMSSRAILTIEVSLL |
Ga0307287_100330201 | 3300028796 | Soil | MMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPQLIIISG |
Ga0307287_101482921 | 3300028796 | Soil | STIMVVKATDDRLRCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDLA |
Ga0307305_100055941 | 3300028807 | Soil | MVMKSADDRHRYDAAYVLDGAMDRSVFAKRPMSPQLVIISGILR |
Ga0307294_102493232 | 3300028810 | Soil | LSVPKIRFYIMVIKSAEDRPRCDAADVLDGATDLSVFAKRPMSPQLVI |
Ga0307292_102925821 | 3300028811 | Soil | MVMKPAENRHRYDAARVLDGAMDRSVFVERPMSPQLVVVGGIPRQNPAQ |
Ga0307292_103752902 | 3300028811 | Soil | MVMKSADDRHRYDAAYVLDGAMDRSVFAKRLMSPQLVIISGILRQDPA |
Ga0307302_100019441 | 3300028814 | Soil | MMKSAEDRHSCDAAYVLDGTMDRSVFAKRPMSPRLIIISGILCQNPA |
Ga0307302_100066721 | 3300028814 | Soil | MVMKSADDRHRYDAAYVLDGAMDRSVFAKRPMSPQLVILSGILR |
Ga0307302_105601942 | 3300028814 | Soil | MVVKAIHDRHRCDAGFVLDGTMDWSVLAKKAMSPQLVVVSSILRNDPA |
Ga0307296_101085041 | 3300028819 | Soil | MVVKATEDRLRCDATYVLDSARDRSVFAKRPMSPQLVIISGI |
Ga0307296_103436522 | 3300028819 | Soil | SAEDRHRCDAAYVLDGAMDRSVFAKRPMSPQLVMISGILRQDPA |
Ga0307296_108408681 | 3300028819 | Soil | MVVKATDDRLRCDAAYVLDGTMDWSVFAKRPMGPQLVIISAILRQDSA |
Ga0307289_100795241 | 3300028875 | Soil | MVMKSAEDRHRCDAAYVLDGAIDRSVFAKRPMSPQLIIISGILRQNPCA |
Ga0307286_100474941 | 3300028876 | Soil | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGSILRQDPAQVRFAQDNH |
Ga0307278_102736821 | 3300028878 | Soil | MKAAEDGRRYDAAHVLDGAMDRSVLVERPMSPEFIIIGCILRQNPA |
Ga0307300_101829722 | 3300028880 | Soil | MVMKSADDRHRYDAAYVLDGAMDRSVFAKRPMSPQLVIISG |
Ga0307308_100019082 | 3300028884 | Soil | MMKSAEDRHRCDAADVLDGAMDRSVFAKRPMSPRLIIISGILRQNPA |
Ga0307308_100415302 | 3300028884 | Soil | MVMKSADDRHRYDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQ |
Ga0307308_100835921 | 3300028884 | Soil | MVMKSAEDRHRCDAAYVLDGAIDRSVFAKRPMSPKL |
Ga0308203_10632661 | 3300030829 | Soil | MVVKAPDDRLRCNAPYVLDSARDGGVFAKRPMSPQLVIISGIFRQDCCKRPEGEY |
Ga0308196_10698182 | 3300030989 | Soil | MVVKATDDRLGRNAAYVLAGTMDWSVFAKRPMSPQLVIISGI |
Ga0308190_11648342 | 3300030993 | Soil | MVMKSAEDRPRCDAACVLNGAMDRSVFAKRPMSPQLVI |
Ga0308187_103688201 | 3300031114 | Soil | MKSAEDRHRCDAAYVLDGAMDRSVFAKRPMSPQLVIIS |
Ga0307501_100016991 | 3300031152 | Soil | MMKSAEDRHSCDAAYVLDGAMDRSVFAKRPMSPRLI |
Ga0307500_101048771 | 3300031198 | Soil | MLVEATHDRLRCDATLVLDSTMDWSVFAKRSMSPQLVVVG |
Ga0307497_100192352 | 3300031226 | Soil | MVMKSAEDRHGCDAAYVLDGAMDRSVFAKRPMSPQLIIISGILRQNPA |
Ga0170824_1134333472 | 3300031231 | Forest Soil | MVMKSAEDRHGCDAAYVLDGAMDRSVFAKRPMSPQLIIIGGILRQNPA |
Ga0318541_106579102 | 3300031545 | Soil | EKSDSAVVVMKPAEDGRRYDAAHVLDGAMDRSVFVERPMIPQLVIVGGVFRQNPA |
Ga0318515_105553141 | 3300031572 | Soil | DSTIMVMKSAEDGRGCDAAHVLDGAMDWSVLVERPTH |
Ga0318555_101187114 | 3300031640 | Soil | MVMKSAEDRYRCDAAHVLDRAMDRSVFAKRPMSPQLVIIG |
Ga0318542_100288451 | 3300031668 | Soil | MVMKSAEDGRRYDAASVVDGAMDRSVLVEGSMSPQLVIIGGILHQ |
Ga0318572_109341181 | 3300031681 | Soil | MVMKSAEDGRRYDAASVVDGAMDRSALVEGSMSPQLVIIDGILRQNPA |
Ga0307468_1016567102 | 3300031740 | Hardwood Forest Soil | MVMKSPEDRNRCDAAYVLDRAMDRSVFAKRPMGPLLVIIGGISHQDAK |
Ga0318537_101338511 | 3300031763 | Soil | MVMKSAEDGLRYDAAHVLDGAMDRSVLVERPMRPQLVI |
Ga0318546_105844912 | 3300031771 | Soil | AILVMKAAEDGRMYDAAHVLDGAMDRSVLLERSMSPQLVIVGGIPR |
Ga0318529_100326651 | 3300031792 | Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVLVERPMRPQLVIIGGNLRQDSA |
Ga0318529_103161932 | 3300031792 | Soil | MKAAEDGRMYDAAHVLDGAMDRSVLLERSMSPQLV |
Ga0318557_104326891 | 3300031795 | Soil | LCRKSDSVIMVMKSAEYGRRYNAAHVLDGAMDRSVFVERPMIPQLVIVGGVFRQNPA |
Ga0318499_102944872 | 3300031832 | Soil | MVMKSAEYGRRYNAAHVLDGAMDRSVFVERPMSPQLVVIGGILRQHPA |
Ga0318511_102198872 | 3300031845 | Soil | MKAAEDGRMYDAAHVLDGAMDRSVLLERSMGPQLVIVGGIPR |
Ga0306921_111882901 | 3300031912 | Soil | MKAAEDGRMYDAAHVLDGAMDRSVLLERSMGPQLVIVGGIP |
Ga0306922_115439462 | 3300032001 | Soil | MSSSRREAGQRYDAASVADGAMDRSVLVEGSMSPQLVIIDG |
Ga0310906_107190192 | 3300032013 | Soil | MVVKAPDDRLPCDAAYVLDGTMDWSVFAKRPMSSQLVVVGSILRQDPAQVRF |
Ga0318549_100229555 | 3300032041 | Soil | MVMKSAEDGRRYDAAHVLDGAMDRSVLVERPMRPQLVI |
Ga0318575_100847805 | 3300032055 | Soil | MKPAEDGRRYDAAHVLDGAMDRSVFVERPMIPQLVIVG |
Ga0307471_1001060772 | 3300032180 | Hardwood Forest Soil | MKAAEDGRRYDAAHVLDGAMDRSVFVERPMSPQLIIIGDVLRQNPA |
Ga0315273_132512381 | 3300032516 | Sediment | MAMKPAEDGYRYNAVPVLDGAMDRGILAERPMSPQLVIVSSILRQNSAQMRLPQDD |
Ga0310810_103575363 | 3300033412 | Soil | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQ |
Ga0310811_106284903 | 3300033475 | Soil | MVVKAPDDRLRCDAAYVLDGTMDWSVFAKRPMSSQLVVVGS |
Ga0364929_0025539_220_366 | 3300034149 | Sediment | MMMKSAEARHSCDAAYVLDGAMDRSVFAKRPMSPQLVIISGILRQDPA |
Ga0372946_0216736_570_716 | 3300034384 | Soil | MVMKAAEDGRRYDATHMLDGAMDRCVLVKRPMSPQLIIIGGILRQNPA |
Ga0370546_070166_22_162 | 3300034681 | Soil | MKFAEDGRRYDAAHVLDGAMDRRVLVERPMSPQLVIVGGILRQNPA |
⦗Top⦘ |