| Basic Information | |
|---|---|
| Family ID | F005113 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 411 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 411 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.30 % |
| % of genes near scaffold ends (potentially truncated) | 21.17 % |
| % of genes from short scaffolds (< 2000 bps) | 78.35 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.311 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (23.358 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.934 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (61.314 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.33% β-sheet: 0.00% Coil/Unstructured: 46.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 411 Family Scaffolds |
|---|---|---|
| PF11351 | GTA_holin_3TM | 15.82 |
| PF00535 | Glycos_transf_2 | 1.46 |
| PF13884 | Peptidase_S74 | 0.97 |
| PF07460 | NUMOD3 | 0.49 |
| PF00004 | AAA | 0.49 |
| PF12708 | Pectate_lyase_3 | 0.49 |
| PF02195 | ParBc | 0.49 |
| PF06199 | Phage_tail_2 | 0.49 |
| PF05876 | GpA_ATPase | 0.24 |
| PF03796 | DnaB_C | 0.24 |
| PF03237 | Terminase_6N | 0.24 |
| PF05136 | Phage_portal_2 | 0.24 |
| PF00176 | SNF2-rel_dom | 0.24 |
| PF00210 | Ferritin | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 411 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.24 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.24 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.24 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.31 % |
| All Organisms | root | All Organisms | 47.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000882|FwDRAFT_10245213 | Not Available | 693 | Open in IMG/M |
| 3300002408|B570J29032_109761671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1237 | Open in IMG/M |
| 3300002408|B570J29032_109924402 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300002930|Water_100027 | Not Available | 36571 | Open in IMG/M |
| 3300003277|JGI25908J49247_10049015 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300003413|JGI25922J50271_10007472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3025 | Open in IMG/M |
| 3300004795|Ga0007756_11602302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300005581|Ga0049081_10022227 | Not Available | 2409 | Open in IMG/M |
| 3300005581|Ga0049081_10049370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1594 | Open in IMG/M |
| 3300005581|Ga0049081_10054869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1506 | Open in IMG/M |
| 3300005581|Ga0049081_10072812 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300005581|Ga0049081_10089821 | Not Available | 1149 | Open in IMG/M |
| 3300005581|Ga0049081_10124479 | Not Available | 952 | Open in IMG/M |
| 3300005581|Ga0049081_10131228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
| 3300005581|Ga0049081_10292808 | Not Available | 562 | Open in IMG/M |
| 3300005581|Ga0049081_10325403 | Not Available | 525 | Open in IMG/M |
| 3300005582|Ga0049080_10037844 | Not Available | 1677 | Open in IMG/M |
| 3300005583|Ga0049085_10018735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2632 | Open in IMG/M |
| 3300005583|Ga0049085_10052832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300005584|Ga0049082_10302172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300005805|Ga0079957_1247759 | Not Available | 829 | Open in IMG/M |
| 3300006029|Ga0075466_1104710 | Not Available | 764 | Open in IMG/M |
| 3300006037|Ga0075465_10005682 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028 | 2232 | Open in IMG/M |
| 3300006803|Ga0075467_10519419 | Not Available | 612 | Open in IMG/M |
| 3300006803|Ga0075467_10679217 | Not Available | 525 | Open in IMG/M |
| 3300006805|Ga0075464_10009401 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4777 | Open in IMG/M |
| 3300006805|Ga0075464_10086918 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300006805|Ga0075464_10178991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
| 3300006805|Ga0075464_10303093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300006805|Ga0075464_10342366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300006805|Ga0075464_10357685 | Not Available | 884 | Open in IMG/M |
| 3300006805|Ga0075464_10498813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300006805|Ga0075464_10605935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300006805|Ga0075464_10817375 | Not Available | 580 | Open in IMG/M |
| 3300006875|Ga0075473_10448721 | Not Available | 521 | Open in IMG/M |
| 3300006920|Ga0070748_1182505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300007363|Ga0075458_10129268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300007544|Ga0102861_1010763 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 2182 | Open in IMG/M |
| 3300007544|Ga0102861_1226907 | Not Available | 516 | Open in IMG/M |
| 3300007555|Ga0102817_1055240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300007559|Ga0102828_1002735 | Not Available | 3240 | Open in IMG/M |
| 3300007559|Ga0102828_1154476 | Not Available | 576 | Open in IMG/M |
| 3300007559|Ga0102828_1204125 | Not Available | 507 | Open in IMG/M |
| 3300007670|Ga0102862_1189487 | Not Available | 532 | Open in IMG/M |
| 3300007708|Ga0102859_1097344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300007708|Ga0102859_1106936 | Not Available | 807 | Open in IMG/M |
| 3300007708|Ga0102859_1136046 | Not Available | 717 | Open in IMG/M |
| 3300007708|Ga0102859_1218896 | Not Available | 568 | Open in IMG/M |
| 3300007734|Ga0104986_1578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18202 | Open in IMG/M |
| 3300007992|Ga0105748_10003816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5727 | Open in IMG/M |
| 3300008055|Ga0108970_10009360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300008055|Ga0108970_11007828 | Not Available | 1373 | Open in IMG/M |
| 3300008996|Ga0102831_1081884 | Not Available | 1076 | Open in IMG/M |
| 3300008999|Ga0102816_1264538 | Not Available | 544 | Open in IMG/M |
| 3300009026|Ga0102829_1131230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300009026|Ga0102829_1174058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300009026|Ga0102829_1191513 | Not Available | 663 | Open in IMG/M |
| 3300009039|Ga0105152_10285618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300009059|Ga0102830_1037030 | Not Available | 1500 | Open in IMG/M |
| 3300009068|Ga0114973_10058801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2249 | Open in IMG/M |
| 3300009068|Ga0114973_10099713 | Not Available | 1652 | Open in IMG/M |
| 3300009068|Ga0114973_10124362 | Not Available | 1449 | Open in IMG/M |
| 3300009068|Ga0114973_10154064 | Not Available | 1276 | Open in IMG/M |
| 3300009068|Ga0114973_10181501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
| 3300009068|Ga0114973_10200065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1092 | Open in IMG/M |
| 3300009068|Ga0114973_10207266 | Not Available | 1069 | Open in IMG/M |
| 3300009068|Ga0114973_10273000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
| 3300009068|Ga0114973_10305814 | Not Available | 847 | Open in IMG/M |
| 3300009068|Ga0114973_10527744 | Not Available | 610 | Open in IMG/M |
| 3300009068|Ga0114973_10663949 | Not Available | 532 | Open in IMG/M |
| 3300009068|Ga0114973_10699383 | Not Available | 516 | Open in IMG/M |
| 3300009085|Ga0105103_10593581 | Not Available | 629 | Open in IMG/M |
| 3300009085|Ga0105103_10972886 | Not Available | 501 | Open in IMG/M |
| 3300009086|Ga0102812_10149314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
| 3300009152|Ga0114980_10207724 | Not Available | 1151 | Open in IMG/M |
| 3300009152|Ga0114980_10246031 | Not Available | 1045 | Open in IMG/M |
| 3300009152|Ga0114980_10279122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
| 3300009152|Ga0114980_10560594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300009155|Ga0114968_10002332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14552 | Open in IMG/M |
| 3300009155|Ga0114968_10093529 | Not Available | 1847 | Open in IMG/M |
| 3300009155|Ga0114968_10153378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
| 3300009155|Ga0114968_10378396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → Nostoc sphaeroides | 776 | Open in IMG/M |
| 3300009155|Ga0114968_10733564 | Not Available | 516 | Open in IMG/M |
| 3300009155|Ga0114968_10737561 | Not Available | 514 | Open in IMG/M |
| 3300009158|Ga0114977_10039176 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300009159|Ga0114978_10000282 | Not Available | 42995 | Open in IMG/M |
| 3300009159|Ga0114978_10101696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1897 | Open in IMG/M |
| 3300009159|Ga0114978_10320370 | Not Available | 945 | Open in IMG/M |
| 3300009159|Ga0114978_10448223 | Not Available | 765 | Open in IMG/M |
| 3300009160|Ga0114981_10117911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
| 3300009160|Ga0114981_10644548 | Not Available | 562 | Open in IMG/M |
| 3300009160|Ga0114981_10730526 | Not Available | 523 | Open in IMG/M |
| 3300009161|Ga0114966_10001093 | Not Available | 25295 | Open in IMG/M |
| 3300009161|Ga0114966_10012111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6820 | Open in IMG/M |
| 3300009161|Ga0114966_10205384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
| 3300009161|Ga0114966_10208286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
| 3300009161|Ga0114966_10502992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300009161|Ga0114966_10571598 | Not Available | 634 | Open in IMG/M |
| 3300009163|Ga0114970_10366150 | Not Available | 807 | Open in IMG/M |
| 3300009163|Ga0114970_10412622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300009164|Ga0114975_10188892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1167 | Open in IMG/M |
| 3300009164|Ga0114975_10339232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
| 3300009181|Ga0114969_10243921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300009181|Ga0114969_10314301 | Not Available | 920 | Open in IMG/M |
| 3300009181|Ga0114969_10781108 | Not Available | 508 | Open in IMG/M |
| 3300009183|Ga0114974_10070627 | Not Available | 2290 | Open in IMG/M |
| 3300009183|Ga0114974_10154834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300009183|Ga0114974_10221947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
| 3300009183|Ga0114974_10517924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
| 3300009183|Ga0114974_10585984 | Not Available | 616 | Open in IMG/M |
| 3300009183|Ga0114974_10778917 | Not Available | 514 | Open in IMG/M |
| 3300009185|Ga0114971_10758378 | Not Available | 527 | Open in IMG/M |
| 3300009185|Ga0114971_10779597 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010160|Ga0114967_10146446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
| 3300010160|Ga0114967_10280212 | Not Available | 863 | Open in IMG/M |
| 3300010160|Ga0114967_10444486 | Not Available | 640 | Open in IMG/M |
| 3300010160|Ga0114967_10518201 | Not Available | 581 | Open in IMG/M |
| 3300010885|Ga0133913_11036046 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300010885|Ga0133913_11916610 | Not Available | 1477 | Open in IMG/M |
| 3300010885|Ga0133913_12095926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1400 | Open in IMG/M |
| 3300010885|Ga0133913_12253966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1340 | Open in IMG/M |
| 3300010885|Ga0133913_12510937 | Not Available | 1255 | Open in IMG/M |
| 3300010885|Ga0133913_13325671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1057 | Open in IMG/M |
| 3300010885|Ga0133913_13481851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
| 3300010885|Ga0133913_13532420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
| 3300011010|Ga0139557_1049158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300011114|Ga0151515_10173 | Not Available | 30117 | Open in IMG/M |
| 3300011114|Ga0151515_10780 | Not Available | 13285 | Open in IMG/M |
| 3300011334|Ga0153697_1548 | Not Available | 10898 | Open in IMG/M |
| 3300011335|Ga0153698_1297 | All Organisms → cellular organisms → Bacteria | 21872 | Open in IMG/M |
| 3300011335|Ga0153698_1975 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 10006 | Open in IMG/M |
| 3300012012|Ga0153799_1007479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2553 | Open in IMG/M |
| 3300012013|Ga0153805_1058172 | Not Available | 655 | Open in IMG/M |
| 3300012017|Ga0153801_1000024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 41053 | Open in IMG/M |
| 3300012017|Ga0153801_1015591 | Not Available | 1360 | Open in IMG/M |
| 3300012666|Ga0157498_1006944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1841 | Open in IMG/M |
| 3300012666|Ga0157498_1023808 | Not Available | 952 | Open in IMG/M |
| 3300012769|Ga0138279_1096980 | Not Available | 698 | Open in IMG/M |
| 3300013004|Ga0164293_10005344 | All Organisms → Viruses | 10924 | Open in IMG/M |
| 3300013004|Ga0164293_10248563 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300013295|Ga0170791_12309789 | Not Available | 646 | Open in IMG/M |
| 3300013295|Ga0170791_14238679 | Not Available | 511 | Open in IMG/M |
| 3300013372|Ga0177922_10375644 | Not Available | 1195 | Open in IMG/M |
| 3300013372|Ga0177922_10394297 | Not Available | 725 | Open in IMG/M |
| 3300013372|Ga0177922_10409688 | Not Available | 1248 | Open in IMG/M |
| 3300013372|Ga0177922_10520756 | Not Available | 565 | Open in IMG/M |
| 3300013372|Ga0177922_10672664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
| 3300013372|Ga0177922_10870357 | Not Available | 566 | Open in IMG/M |
| 3300013372|Ga0177922_10973356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300013372|Ga0177922_11273820 | Not Available | 698 | Open in IMG/M |
| 3300015050|Ga0181338_1003919 | Not Available | 2558 | Open in IMG/M |
| 3300015050|Ga0181338_1033913 | Not Available | 772 | Open in IMG/M |
| 3300015050|Ga0181338_1066058 | Not Available | 517 | Open in IMG/M |
| 3300017701|Ga0181364_1013083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
| 3300017701|Ga0181364_1073177 | Not Available | 524 | Open in IMG/M |
| 3300017716|Ga0181350_1120272 | Not Available | 631 | Open in IMG/M |
| 3300017716|Ga0181350_1120698 | Not Available | 629 | Open in IMG/M |
| 3300017722|Ga0181347_1084155 | Not Available | 923 | Open in IMG/M |
| 3300017722|Ga0181347_1164110 | Not Available | 600 | Open in IMG/M |
| 3300017723|Ga0181362_1022349 | Not Available | 1358 | Open in IMG/M |
| 3300017723|Ga0181362_1052355 | Not Available | 847 | Open in IMG/M |
| 3300017723|Ga0181362_1074388 | Not Available | 688 | Open in IMG/M |
| 3300017723|Ga0181362_1088803 | Not Available | 620 | Open in IMG/M |
| 3300017736|Ga0181365_1015461 | Not Available | 1914 | Open in IMG/M |
| 3300017736|Ga0181365_1080337 | Not Available | 799 | Open in IMG/M |
| 3300017736|Ga0181365_1087221 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300017736|Ga0181365_1126651 | Not Available | 611 | Open in IMG/M |
| 3300017754|Ga0181344_1003071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5838 | Open in IMG/M |
| 3300017754|Ga0181344_1024970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1840 | Open in IMG/M |
| 3300017761|Ga0181356_1027857 | Not Available | 2036 | Open in IMG/M |
| 3300017761|Ga0181356_1119597 | Not Available | 842 | Open in IMG/M |
| 3300017766|Ga0181343_1003766 | All Organisms → cellular organisms → Bacteria | 5399 | Open in IMG/M |
| 3300017766|Ga0181343_1017801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2219 | Open in IMG/M |
| 3300017766|Ga0181343_1028420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1698 | Open in IMG/M |
| 3300017774|Ga0181358_1051566 | Not Available | 1556 | Open in IMG/M |
| 3300017774|Ga0181358_1120528 | Not Available | 922 | Open in IMG/M |
| 3300017774|Ga0181358_1157048 | Not Available | 772 | Open in IMG/M |
| 3300017777|Ga0181357_1082482 | Not Available | 1230 | Open in IMG/M |
| 3300017777|Ga0181357_1145309 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria → Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_36_16 | 877 | Open in IMG/M |
| 3300017777|Ga0181357_1150592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
| 3300017777|Ga0181357_1156496 | Not Available | 837 | Open in IMG/M |
| 3300017777|Ga0181357_1174595 | Not Available | 779 | Open in IMG/M |
| 3300017777|Ga0181357_1186493 | Not Available | 748 | Open in IMG/M |
| 3300017777|Ga0181357_1234837 | Not Available | 642 | Open in IMG/M |
| 3300017777|Ga0181357_1240760 | Not Available | 632 | Open in IMG/M |
| 3300017777|Ga0181357_1285055 | Not Available | 565 | Open in IMG/M |
| 3300017777|Ga0181357_1313460 | Not Available | 529 | Open in IMG/M |
| 3300017777|Ga0181357_1314630 | Not Available | 528 | Open in IMG/M |
| 3300017778|Ga0181349_1038460 | Not Available | 1904 | Open in IMG/M |
| 3300017778|Ga0181349_1059599 | Not Available | 1483 | Open in IMG/M |
| 3300017778|Ga0181349_1086628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1186 | Open in IMG/M |
| 3300017778|Ga0181349_1124322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300017778|Ga0181349_1125019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
| 3300017780|Ga0181346_1077648 | Not Available | 1312 | Open in IMG/M |
| 3300017780|Ga0181346_1091622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1187 | Open in IMG/M |
| 3300017780|Ga0181346_1113074 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300017780|Ga0181346_1223138 | Not Available | 670 | Open in IMG/M |
| 3300017780|Ga0181346_1286741 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300017784|Ga0181348_1057655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1578 | Open in IMG/M |
| 3300017784|Ga0181348_1099263 | Not Available | 1138 | Open in IMG/M |
| 3300017784|Ga0181348_1110473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
| 3300017784|Ga0181348_1263810 | Not Available | 590 | Open in IMG/M |
| 3300017784|Ga0181348_1311325 | Not Available | 524 | Open in IMG/M |
| 3300017784|Ga0181348_1313303 | Not Available | 522 | Open in IMG/M |
| 3300017785|Ga0181355_1023915 | Not Available | 2657 | Open in IMG/M |
| 3300017785|Ga0181355_1053278 | All Organisms → Viruses | 1716 | Open in IMG/M |
| 3300017785|Ga0181355_1083988 | Not Available | 1328 | Open in IMG/M |
| 3300017785|Ga0181355_1324110 | Not Available | 572 | Open in IMG/M |
| 3300017785|Ga0181355_1339124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300019784|Ga0181359_1000166 | Not Available | 13385 | Open in IMG/M |
| 3300019784|Ga0181359_1002137 | Not Available | 5642 | Open in IMG/M |
| 3300019784|Ga0181359_1007889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3648 | Open in IMG/M |
| 3300019784|Ga0181359_1016494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria → Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_36_16 | 2744 | Open in IMG/M |
| 3300019784|Ga0181359_1022193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2411 | Open in IMG/M |
| 3300019784|Ga0181359_1023893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2330 | Open in IMG/M |
| 3300019784|Ga0181359_1030854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2069 | Open in IMG/M |
| 3300019784|Ga0181359_1060756 | Not Available | 1447 | Open in IMG/M |
| 3300019784|Ga0181359_1167128 | Not Available | 739 | Open in IMG/M |
| 3300019784|Ga0181359_1189016 | Not Available | 673 | Open in IMG/M |
| 3300020048|Ga0207193_1002881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29531 | Open in IMG/M |
| 3300020151|Ga0211736_10535504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
| 3300020160|Ga0211733_10902839 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300020167|Ga0194035_1236013 | Not Available | 550 | Open in IMG/M |
| 3300020172|Ga0211729_10287350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3087 | Open in IMG/M |
| 3300020172|Ga0211729_10287460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5072 | Open in IMG/M |
| 3300020172|Ga0211729_10298987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1422 | Open in IMG/M |
| 3300020172|Ga0211729_10721232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300020205|Ga0211731_10721597 | Not Available | 501 | Open in IMG/M |
| 3300020205|Ga0211731_11045640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 993 | Open in IMG/M |
| 3300020498|Ga0208050_1023701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300020506|Ga0208091_1004655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1886 | Open in IMG/M |
| 3300020530|Ga0208235_1033171 | Not Available | 617 | Open in IMG/M |
| 3300020551|Ga0208360_1014831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
| 3300020553|Ga0208855_1043697 | Not Available | 596 | Open in IMG/M |
| 3300021961|Ga0222714_10023935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4695 | Open in IMG/M |
| 3300021961|Ga0222714_10093058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1928 | Open in IMG/M |
| 3300021961|Ga0222714_10212607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
| 3300021961|Ga0222714_10490311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300021961|Ga0222714_10629775 | Not Available | 532 | Open in IMG/M |
| 3300021961|Ga0222714_10635651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300021962|Ga0222713_10093374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2172 | Open in IMG/M |
| 3300021962|Ga0222713_10583113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300021963|Ga0222712_10128600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1736 | Open in IMG/M |
| 3300021963|Ga0222712_10221037 | Not Available | 1228 | Open in IMG/M |
| 3300021963|Ga0222712_10379825 | Not Available | 864 | Open in IMG/M |
| 3300022179|Ga0181353_1115544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
| 3300022190|Ga0181354_1037921 | Not Available | 1592 | Open in IMG/M |
| 3300022190|Ga0181354_1082906 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300022190|Ga0181354_1103550 | Not Available | 926 | Open in IMG/M |
| 3300022190|Ga0181354_1159131 | Not Available | 701 | Open in IMG/M |
| 3300022190|Ga0181354_1176958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Sourvirus → Sourvirus sour | 651 | Open in IMG/M |
| 3300022190|Ga0181354_1208670 | Not Available | 578 | Open in IMG/M |
| 3300022190|Ga0181354_1221925 | Not Available | 552 | Open in IMG/M |
| 3300022407|Ga0181351_1087331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
| 3300022407|Ga0181351_1093844 | Not Available | 1172 | Open in IMG/M |
| 3300022407|Ga0181351_1160125 | Not Available | 799 | Open in IMG/M |
| 3300022407|Ga0181351_1223891 | Not Available | 608 | Open in IMG/M |
| 3300022407|Ga0181351_1239142 | Not Available | 575 | Open in IMG/M |
| 3300022407|Ga0181351_1267790 | Not Available | 521 | Open in IMG/M |
| 3300024346|Ga0244775_10013856 | Not Available | 7540 | Open in IMG/M |
| 3300024346|Ga0244775_10039855 | All Organisms → Viruses | 4143 | Open in IMG/M |
| 3300024346|Ga0244775_10980577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300024346|Ga0244775_10998137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → unclassified Tardiphaga → Tardiphaga sp. vice352 | 661 | Open in IMG/M |
| 3300024348|Ga0244776_10404955 | Not Available | 904 | Open in IMG/M |
| 3300025451|Ga0208426_1011883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300025508|Ga0208148_1083419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 716 | Open in IMG/M |
| 3300025887|Ga0208544_10413154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300025896|Ga0208916_10002426 | Not Available | 7628 | Open in IMG/M |
| 3300025896|Ga0208916_10046153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1781 | Open in IMG/M |
| 3300025896|Ga0208916_10420215 | Not Available | 583 | Open in IMG/M |
| 3300027212|Ga0208554_1060827 | Not Available | 590 | Open in IMG/M |
| 3300027418|Ga0208022_1038667 | Not Available | 1076 | Open in IMG/M |
| 3300027608|Ga0208974_1000254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23285 | Open in IMG/M |
| 3300027608|Ga0208974_1014480 | Not Available | 2508 | Open in IMG/M |
| 3300027627|Ga0208942_1008564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3429 | Open in IMG/M |
| 3300027631|Ga0208133_1165643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
| 3300027659|Ga0208975_1016758 | Not Available | 2444 | Open in IMG/M |
| 3300027659|Ga0208975_1039527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300027659|Ga0208975_1056956 | Not Available | 1189 | Open in IMG/M |
| 3300027659|Ga0208975_1064682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300027659|Ga0208975_1126719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300027721|Ga0209492_1003553 | Not Available | 4968 | Open in IMG/M |
| 3300027733|Ga0209297_1017887 | All Organisms → cellular organisms → Bacteria | 3395 | Open in IMG/M |
| 3300027733|Ga0209297_1025845 | Not Available | 2761 | Open in IMG/M |
| 3300027733|Ga0209297_1036179 | All Organisms → cellular organisms → Bacteria | 2282 | Open in IMG/M |
| 3300027733|Ga0209297_1057277 | Not Available | 1747 | Open in IMG/M |
| 3300027736|Ga0209190_1008284 | Not Available | 6385 | Open in IMG/M |
| 3300027736|Ga0209190_1010081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5678 | Open in IMG/M |
| 3300027736|Ga0209190_1038742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2494 | Open in IMG/M |
| 3300027736|Ga0209190_1046313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2229 | Open in IMG/M |
| 3300027736|Ga0209190_1048560 | Not Available | 2160 | Open in IMG/M |
| 3300027736|Ga0209190_1271529 | Not Available | 661 | Open in IMG/M |
| 3300027736|Ga0209190_1286319 | Not Available | 636 | Open in IMG/M |
| 3300027736|Ga0209190_1376430 | Not Available | 517 | Open in IMG/M |
| 3300027746|Ga0209597_1034553 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300027751|Ga0208304_10188318 | Not Available | 747 | Open in IMG/M |
| 3300027754|Ga0209596_1002091 | Not Available | 16651 | Open in IMG/M |
| 3300027754|Ga0209596_1002373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 15544 | Open in IMG/M |
| 3300027754|Ga0209596_1120552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1207 | Open in IMG/M |
| 3300027754|Ga0209596_1159456 | Not Available | 996 | Open in IMG/M |
| 3300027754|Ga0209596_1204594 | Not Available | 839 | Open in IMG/M |
| 3300027759|Ga0209296_1030479 | Not Available | 2976 | Open in IMG/M |
| 3300027759|Ga0209296_1045912 | Not Available | 2310 | Open in IMG/M |
| 3300027759|Ga0209296_1121546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
| 3300027759|Ga0209296_1271585 | Not Available | 687 | Open in IMG/M |
| 3300027759|Ga0209296_1371116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300027763|Ga0209088_10009370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5342 | Open in IMG/M |
| 3300027763|Ga0209088_10049042 | Not Available | 2058 | Open in IMG/M |
| 3300027763|Ga0209088_10052114 | Not Available | 1985 | Open in IMG/M |
| 3300027769|Ga0209770_10052722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1723 | Open in IMG/M |
| 3300027770|Ga0209086_10000884 | Not Available | 24654 | Open in IMG/M |
| 3300027770|Ga0209086_10318031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300027782|Ga0209500_10000357 | Not Available | 39728 | Open in IMG/M |
| 3300027782|Ga0209500_10437276 | Not Available | 518 | Open in IMG/M |
| 3300027785|Ga0209246_10283043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Nomurabacteria → Candidatus Nomurabacteria bacterium RIFCSPLOWO2_01_FULL_36_16 | 638 | Open in IMG/M |
| 3300027798|Ga0209353_10006551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5834 | Open in IMG/M |
| 3300027808|Ga0209354_10224613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
| 3300027808|Ga0209354_10230890 | Not Available | 746 | Open in IMG/M |
| 3300027900|Ga0209253_10573917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
| 3300027969|Ga0209191_1316376 | Not Available | 573 | Open in IMG/M |
| 3300027974|Ga0209299_1203557 | Not Available | 723 | Open in IMG/M |
| 3300031707|Ga0315291_10203401 | Not Available | 2016 | Open in IMG/M |
| 3300031707|Ga0315291_10215859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1944 | Open in IMG/M |
| 3300031707|Ga0315291_10301176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1571 | Open in IMG/M |
| 3300031707|Ga0315291_11037107 | Not Available | 686 | Open in IMG/M |
| 3300031707|Ga0315291_11215890 | Not Available | 615 | Open in IMG/M |
| 3300031707|Ga0315291_11323566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
| 3300031707|Ga0315291_11574625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300031707|Ga0315291_11574746 | Not Available | 513 | Open in IMG/M |
| 3300031746|Ga0315293_10683722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300031746|Ga0315293_10786442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300031746|Ga0315293_10789083 | Not Available | 697 | Open in IMG/M |
| 3300031746|Ga0315293_11017659 | Not Available | 589 | Open in IMG/M |
| 3300031746|Ga0315293_11156592 | Not Available | 540 | Open in IMG/M |
| 3300031746|Ga0315293_11201957 | Not Available | 527 | Open in IMG/M |
| 3300031772|Ga0315288_10168525 | Not Available | 2416 | Open in IMG/M |
| 3300031772|Ga0315288_10226184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2010 | Open in IMG/M |
| 3300031772|Ga0315288_10966031 | Not Available | 763 | Open in IMG/M |
| 3300031834|Ga0315290_11200134 | Not Available | 630 | Open in IMG/M |
| 3300031873|Ga0315297_11483112 | Not Available | 548 | Open in IMG/M |
| 3300031885|Ga0315285_10127719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2157 | Open in IMG/M |
| 3300031885|Ga0315285_10535863 | Not Available | 793 | Open in IMG/M |
| 3300031885|Ga0315285_10800328 | Not Available | 591 | Open in IMG/M |
| 3300031885|Ga0315285_10837617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300031885|Ga0315285_10850414 | Not Available | 565 | Open in IMG/M |
| 3300031885|Ga0315285_10976287 | Not Available | 510 | Open in IMG/M |
| 3300031952|Ga0315294_10348800 | Not Available | 1404 | Open in IMG/M |
| 3300031952|Ga0315294_11125762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300031952|Ga0315294_11133528 | Not Available | 640 | Open in IMG/M |
| 3300031952|Ga0315294_11331831 | Not Available | 573 | Open in IMG/M |
| 3300031997|Ga0315278_10668394 | Not Available | 1059 | Open in IMG/M |
| 3300031997|Ga0315278_10772114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300031997|Ga0315278_11322718 | Not Available | 701 | Open in IMG/M |
| 3300031999|Ga0315274_10189466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2562 | Open in IMG/M |
| 3300031999|Ga0315274_10497330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
| 3300031999|Ga0315274_10558717 | Not Available | 1276 | Open in IMG/M |
| 3300031999|Ga0315274_10806761 | Not Available | 994 | Open in IMG/M |
| 3300031999|Ga0315274_11115220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
| 3300031999|Ga0315274_11508755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Sourvirus → Sourvirus sour | 638 | Open in IMG/M |
| 3300031999|Ga0315274_11763251 | Not Available | 570 | Open in IMG/M |
| 3300031999|Ga0315274_11870168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300031999|Ga0315274_12062314 | Not Available | 509 | Open in IMG/M |
| 3300031999|Ga0315274_12114533 | Not Available | 500 | Open in IMG/M |
| 3300032018|Ga0315272_10000279 | All Organisms → Viruses | 24981 | Open in IMG/M |
| 3300032018|Ga0315272_10008760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4702 | Open in IMG/M |
| 3300032018|Ga0315272_10035507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2254 | Open in IMG/M |
| 3300032018|Ga0315272_10037335 | Not Available | 2196 | Open in IMG/M |
| 3300032018|Ga0315272_10044999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
| 3300032046|Ga0315289_10366134 | Not Available | 1452 | Open in IMG/M |
| 3300032046|Ga0315289_10826106 | Not Available | 811 | Open in IMG/M |
| 3300032046|Ga0315289_10848201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300032053|Ga0315284_10979872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300032053|Ga0315284_11118084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300032053|Ga0315284_11377414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300032053|Ga0315284_11752345 | Not Available | 644 | Open in IMG/M |
| 3300032053|Ga0315284_11797514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300032118|Ga0315277_10770914 | Not Available | 913 | Open in IMG/M |
| 3300032143|Ga0315292_11369244 | Not Available | 577 | Open in IMG/M |
| 3300032156|Ga0315295_10745073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300032164|Ga0315283_10549172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1254 | Open in IMG/M |
| 3300032164|Ga0315283_11094352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
| 3300032173|Ga0315268_10043560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4272 | Open in IMG/M |
| 3300032173|Ga0315268_10079833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3082 | Open in IMG/M |
| 3300032173|Ga0315268_10344516 | Not Available | 1450 | Open in IMG/M |
| 3300032173|Ga0315268_11108806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300032173|Ga0315268_12706983 | Not Available | 509 | Open in IMG/M |
| 3300032177|Ga0315276_11617470 | Not Available | 671 | Open in IMG/M |
| 3300032256|Ga0315271_10669112 | Not Available | 890 | Open in IMG/M |
| 3300032275|Ga0315270_10647287 | Not Available | 689 | Open in IMG/M |
| 3300032342|Ga0315286_11867922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300032397|Ga0315287_10475357 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300032397|Ga0315287_11377025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300032401|Ga0315275_10674755 | Not Available | 1151 | Open in IMG/M |
| 3300032516|Ga0315273_10646015 | Not Available | 1398 | Open in IMG/M |
| 3300032516|Ga0315273_10956772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300032516|Ga0315273_11945295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300033233|Ga0334722_10110516 | Not Available | 2079 | Open in IMG/M |
| 3300033233|Ga0334722_10341755 | Not Available | 1086 | Open in IMG/M |
| 3300033233|Ga0334722_10784972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
| 3300033233|Ga0334722_11054971 | Not Available | 571 | Open in IMG/M |
| 3300033993|Ga0334994_0166311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
| 3300033993|Ga0334994_0315236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
| 3300033996|Ga0334979_0003324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11514 | Open in IMG/M |
| 3300033996|Ga0334979_0122993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1594 | Open in IMG/M |
| 3300034068|Ga0334990_0033136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2760 | Open in IMG/M |
| 3300034068|Ga0334990_0280961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
| 3300034095|Ga0335022_0004010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8959 | Open in IMG/M |
| 3300034106|Ga0335036_0101071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2117 | Open in IMG/M |
| 3300034122|Ga0335060_0433869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.38% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 19.46% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.84% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.35% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.35% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.68% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.68% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.22% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.73% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.49% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.49% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.24% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.24% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.24% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.24% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.24% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.24% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.24% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.24% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.24% |
| Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300004795 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FwDRAFT_102452133 | 3300000882 | Freshwater And Marine | MTKDEHKNAIVQQLQQQSLNLLVESLAAALAEIEQLKAAAADKDKP* |
| B570J29032_1097616712 | 3300002408 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| B570J29032_1099244023 | 3300002408 | Freshwater | MTKEEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP* |
| Water_10002754 | 3300002930 | Estuary Water | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| JGI25908J49247_100490153 | 3300003277 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| JGI25922J50271_100074725 | 3300003413 | Freshwater Lake | MTKEEHKNVIIAQIQQQNLNVLVDSLAAALAEIESLKAKPKTEE* |
| Ga0007756_116023022 | 3300004795 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKANANADKPTP* |
| Ga0049081_100222273 | 3300005581 | Freshwater Lentic | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAGDKPAP* |
| Ga0049081_100493703 | 3300005581 | Freshwater Lentic | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAADADKPAP* |
| Ga0049081_100548693 | 3300005581 | Freshwater Lentic | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTA* |
| Ga0049081_100728123 | 3300005581 | Freshwater Lentic | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0049081_100898211 | 3300005581 | Freshwater Lentic | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0049081_101244792 | 3300005581 | Freshwater Lentic | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPAP* |
| Ga0049081_101312282 | 3300005581 | Freshwater Lentic | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP* |
| Ga0049081_102928083 | 3300005581 | Freshwater Lentic | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0049081_103254032 | 3300005581 | Freshwater Lentic | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADVDKP* |
| Ga0049080_100378442 | 3300005582 | Freshwater Lentic | MTKDDHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0049085_100187355 | 3300005583 | Freshwater Lentic | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALSEIESLKAAAADKP |
| Ga0049085_100528321 | 3300005583 | Freshwater Lentic | EHKSAIVQQLQQQSLNLLVDSLAAALSEIESLKAAAADKPAS* |
| Ga0049082_103021722 | 3300005584 | Freshwater Lentic | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAS* |
| Ga0079957_12477591 | 3300005805 | Lake | MTKDEHKTAIVSQLQQQSLNLLVDSLAAALAEIEQLKAKPKTEE* |
| Ga0075466_11047103 | 3300006029 | Aqueous | MTKDEHKTAVIQQLQQQSLNVLIDSLAAALAEIESLKAKLEPAKE* |
| Ga0075465_100056826 | 3300006037 | Aqueous | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0075467_105194192 | 3300006803 | Aqueous | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKAAAAADKPA* |
| Ga0075467_106792172 | 3300006803 | Aqueous | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0075464_100094017 | 3300006805 | Aqueous | MTKEEHKVTIVQQLQQQSLNVLIDSLAAALAEIEALKAKLEPSKE* |
| Ga0075464_100869185 | 3300006805 | Aqueous | MTKEEHKNAIIAQIQQQNLNVLVDSLAAALAEIESLKAKPKTEE* |
| Ga0075464_101789913 | 3300006805 | Aqueous | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIESLKAKLEPAKE* |
| Ga0075464_103030933 | 3300006805 | Aqueous | MTKDEHKSAIVQQRQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0075464_103423664 | 3300006805 | Aqueous | LQQQSLNLLVDSLAAALAEIEQLKAGNPPDKAAP* |
| Ga0075464_103576852 | 3300006805 | Aqueous | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAS* |
| Ga0075464_104988133 | 3300006805 | Aqueous | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKANANADKPTP* |
| Ga0075464_106059353 | 3300006805 | Aqueous | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPA* |
| Ga0075464_108173752 | 3300006805 | Aqueous | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP* |
| Ga0075473_104487212 | 3300006875 | Aqueous | VVQQLQQQSINVLIDSLAAALAEIESLKAKLEPSKE* |
| Ga0070748_11825052 | 3300006920 | Aqueous | RALSFQRNKPMTKDEHKSAIVTQLQQQSLNLLVDSLAAALSEIESLKAAANADKPTP* |
| Ga0075458_101292683 | 3300007363 | Aqueous | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIETLKAKLEPSKE* |
| Ga0102861_10107634 | 3300007544 | Estuarine | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0102861_12269073 | 3300007544 | Estuarine | MTKEEHKSAIVQQLQQQSLNLLIDSLAAALAEIETLK |
| Ga0102817_10552402 | 3300007555 | Estuarine | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS* |
| Ga0102828_10027355 | 3300007559 | Estuarine | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKANANADKPTP* |
| Ga0102828_11544763 | 3300007559 | Estuarine | MTKEEHKVTIVQQLQQQSLNVLIESLAAALAEIEALKAKLEPAKE* |
| Ga0102828_12041251 | 3300007559 | Estuarine | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAP* |
| Ga0102862_11894872 | 3300007670 | Estuarine | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS* |
| Ga0102859_10973442 | 3300007708 | Estuarine | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPAKE* |
| Ga0102859_11069362 | 3300007708 | Estuarine | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP* |
| Ga0102859_11360462 | 3300007708 | Estuarine | MTKDEHKTAVIQQLQQQSLNVLIDSLAAALAEIEALKAKLEPAKE* |
| Ga0102859_12188961 | 3300007708 | Estuarine | MTKDELPMTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPAKE* |
| Ga0104986_15789 | 3300007734 | Freshwater | MTKDEHKNAVIQQLQQQSLNLLVDSLAAALAEIEALKAKLGPAKE* |
| Ga0105748_100038164 | 3300007992 | Estuary Water | MTKDEHKSAIVQQLQQPSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0108970_100093603 | 3300008055 | Estuary | MTKDEHKNAIVQQLQQQSLNLLVESLAAALAEIEALKAAAADKPTP* |
| Ga0108970_110078283 | 3300008055 | Estuary | TQLQQQSLNLLVDSLAAALAEIEQLKAAAADVDKP* |
| Ga0102831_10818841 | 3300008996 | Estuarine | IVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP* |
| Ga0102816_12645382 | 3300008999 | Estuarine | MTKEEHKSQIGSQLQQQSLNLLVDSLAAALAEIEQLKAAAAAKPTP* |
| Ga0102829_11312302 | 3300009026 | Estuarine | MTKDEHKSQIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS* |
| Ga0102829_11740582 | 3300009026 | Estuarine | MTKDEHKNAIVQQLQQQSLNLLVESLAAALAEIEQLKAAAADKPTP* |
| Ga0102829_11915131 | 3300009026 | Estuarine | MTKYEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAA |
| Ga0105152_102856182 | 3300009039 | Lake Sediment | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAAADKPSP* |
| Ga0102830_10370303 | 3300009059 | Estuarine | IRRIITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP* |
| Ga0114973_100588015 | 3300009068 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTS* |
| Ga0114973_100997132 | 3300009068 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKDKP* |
| Ga0114973_101243623 | 3300009068 | Freshwater Lake | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0114973_101540643 | 3300009068 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS* |
| Ga0114973_101815011 | 3300009068 | Freshwater Lake | MTKNEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAAADKPTP* |
| Ga0114973_102000652 | 3300009068 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| Ga0114973_102072663 | 3300009068 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP* |
| Ga0114973_102730002 | 3300009068 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTA* |
| Ga0114973_103058143 | 3300009068 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAS* |
| Ga0114973_105277443 | 3300009068 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKDKP* |
| Ga0114973_106639491 | 3300009068 | Freshwater Lake | MTKEEHKTAVIQQLQQQSLNVLIDSLAAALAEIEALKAKLEPAKE* |
| Ga0114973_106993832 | 3300009068 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP* |
| Ga0105103_105935812 | 3300009085 | Freshwater Sediment | MTKDEHKNGIVSQLQQQSLNLLIDSLAAALAEIEQLKAENAKLTSG* |
| Ga0105103_109728862 | 3300009085 | Freshwater Sediment | MTKDEHKATIVTQLQQQSLNLLVDSLAAALAEIETLKAAAAAPADKP* |
| Ga0102812_101493143 | 3300009086 | Estuarine | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP* |
| Ga0114980_102077243 | 3300009152 | Freshwater Lake | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP* |
| Ga0114980_102460311 | 3300009152 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| Ga0114980_102791222 | 3300009152 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKANAADKPTP* |
| Ga0114980_105605943 | 3300009152 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTA* |
| Ga0114968_100023323 | 3300009155 | Freshwater Lake | MTKEEHKVTIVQQLQQQSLNVLIDSLAAALAEIEALKAKLEPAKE* |
| Ga0114968_100935293 | 3300009155 | Freshwater Lake | MTKDEHKSQIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0114968_101533783 | 3300009155 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| Ga0114968_103783962 | 3300009155 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS* |
| Ga0114968_107335642 | 3300009155 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIDTLKAAANSDKPTP* |
| Ga0114968_107375612 | 3300009155 | Freshwater Lake | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPSKE* |
| Ga0114977_100391765 | 3300009158 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKAAAAADKPV* |
| Ga0114978_100002821 | 3300009159 | Freshwater Lake | GIITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP* |
| Ga0114978_101016963 | 3300009159 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTP* |
| Ga0114978_103203701 | 3300009159 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAS* |
| Ga0114978_104482232 | 3300009159 | Freshwater Lake | MTKEEHKAAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS* |
| Ga0114981_101179113 | 3300009160 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKATAADKPTP* |
| Ga0114981_106445482 | 3300009160 | Freshwater Lake | MTKEEHKAAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| Ga0114981_107305261 | 3300009160 | Freshwater Lake | TMTKEEHKNAIVQQLQQQSLNLLIDSLAAALAEIEQLKAAANADKPTP* |
| Ga0114966_100010933 | 3300009161 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVELLAAALAEIETLKAAAADKPTP* |
| Ga0114966_100121117 | 3300009161 | Freshwater Lake | MTKDEHKATIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP* |
| Ga0114966_102053843 | 3300009161 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKAAANADKPTP* |
| Ga0114966_102082863 | 3300009161 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS* |
| Ga0114966_105029922 | 3300009161 | Freshwater Lake | MTKDEHKTAVIQQLQQQSLNVLIDSLASALAEIEALKAKLEPAKE* |
| Ga0114966_105715981 | 3300009161 | Freshwater Lake | MTKEEHKVTIVQQLQQQSLNVLIDSLASALAEIEALKAKLEPAKE* |
| Ga0114970_103661502 | 3300009163 | Freshwater Lake | MTKDEHKARIVQQLQQETINLLVEALASAQVDVEQLKAAAADKPSP* |
| Ga0114970_104126223 | 3300009163 | Freshwater Lake | MIKEEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP* |
| Ga0114975_101888924 | 3300009164 | Freshwater Lake | VQQLQQQSLNLLIDSLAAALAEIEQLKAAANADKPTP* |
| Ga0114975_103392322 | 3300009164 | Freshwater Lake | MTKEEHKSAIVQQLQQQNLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0114969_102439212 | 3300009181 | Freshwater Lake | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALSEIEGLKAAAADKPTS* |
| Ga0114969_103143013 | 3300009181 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAS* |
| Ga0114969_107811083 | 3300009181 | Freshwater Lake | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIESLKAKL |
| Ga0114974_100706273 | 3300009183 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALTEIEQLKAAAADKPAS* |
| Ga0114974_101548344 | 3300009183 | Freshwater Lake | MTKEEHKNAIVQQLQQQSLNLLIDSLAAALAEIEQLKAAANADKPTP* |
| Ga0114974_102219472 | 3300009183 | Freshwater Lake | MTKDEHKATIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPSP* |
| Ga0114974_105179242 | 3300009183 | Freshwater Lake | MTKDEHKATIVTQLQQQSLNLLVDSLAAALAEIEALKAAAAADKPTP* |
| Ga0114974_105859842 | 3300009183 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEALKADAADKPTP* |
| Ga0114974_107789172 | 3300009183 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0114971_107583782 | 3300009185 | Freshwater Lake | SAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0114971_107795973 | 3300009185 | Freshwater Lake | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLE |
| Ga0114967_101464461 | 3300010160 | Freshwater Lake | MTKEEHKSAIVQQLKQQSLNLLVDSLAAALAEIEQLKAAAADKPTS* |
| Ga0114967_102802123 | 3300010160 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS* |
| Ga0114967_104444861 | 3300010160 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS* |
| Ga0114967_105182011 | 3300010160 | Freshwater Lake | EHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0133913_110360466 | 3300010885 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0133913_119166103 | 3300010885 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKANDADKPTP* |
| Ga0133913_120959261 | 3300010885 | Freshwater Lake | QLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| Ga0133913_122539661 | 3300010885 | Freshwater Lake | HKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPSKE* |
| Ga0133913_125109372 | 3300010885 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKANANADKPTP* |
| Ga0133913_133256715 | 3300010885 | Freshwater Lake | TQLQQQSLNLLVDSLAAALAEIEALKAAAADKQTP* |
| Ga0133913_134818513 | 3300010885 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLADSLAAALAEIEQLKAAAAADKPA* |
| Ga0133913_135324201 | 3300010885 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP* |
| Ga0139557_10491582 | 3300011010 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP* |
| Ga0151515_101738 | 3300011114 | Freshwater | MTKDEHKTVVVQQLQQQSINVLIDSLAAALAEIESLKAKLEPTKE* |
| Ga0151515_107808 | 3300011114 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAVDKPTP* |
| Ga0153697_15488 | 3300011334 | Freshwater | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAKLGPAKE* |
| Ga0153698_12973 | 3300011335 | Freshwater | MTKDEHKNVVIQQLQQQSIGVLIDSLAAALAEIEALKAKLEPVRDERL* |
| Ga0153698_19753 | 3300011335 | Freshwater | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS* |
| Ga0153799_10074793 | 3300012012 | Freshwater | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIESLKAAAADKPTP* |
| Ga0153805_10581722 | 3300012013 | Surface Ice | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAAAADKPTP* |
| Ga0153801_10000242 | 3300012017 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPAS* |
| Ga0153801_10155911 | 3300012017 | Freshwater | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTP* |
| Ga0157498_10069443 | 3300012666 | Freshwater, Surface Ice | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP* |
| Ga0157498_10238083 | 3300012666 | Freshwater, Surface Ice | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEALKAAANADKPTP* |
| Ga0138279_10969801 | 3300012769 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKDKP* |
| Ga0164293_100053441 | 3300013004 | Freshwater | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALSEIEQLKAAANADKPTP* |
| Ga0164293_102485631 | 3300013004 | Freshwater | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQ |
| Ga0170791_123097891 | 3300013295 | Freshwater | EEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKDKP* |
| Ga0170791_142386792 | 3300013295 | Freshwater | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP* |
| Ga0177922_103756442 | 3300013372 | Freshwater | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAP* |
| Ga0177922_103942972 | 3300013372 | Freshwater | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS* |
| Ga0177922_104096883 | 3300013372 | Freshwater | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP* |
| Ga0177922_105207562 | 3300013372 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS* |
| Ga0177922_106726643 | 3300013372 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP* |
| Ga0177922_108703572 | 3300013372 | Freshwater | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTP* |
| Ga0177922_109733563 | 3300013372 | Freshwater | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAADAADKPSP* |
| Ga0177922_112738203 | 3300013372 | Freshwater | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTS* |
| Ga0181338_10039193 | 3300015050 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAAAAADKPTP* |
| Ga0181338_10339132 | 3300015050 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPAP* |
| Ga0181338_10660582 | 3300015050 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS* |
| Ga0181364_10130836 | 3300017701 | Freshwater Lake | VTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS |
| Ga0181364_10731772 | 3300017701 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAAADKPAS |
| Ga0181350_11202722 | 3300017716 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAAAYKPSP |
| Ga0181350_11206982 | 3300017716 | Freshwater Lake | MSKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP |
| Ga0181347_10841552 | 3300017722 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADVDKP |
| Ga0181347_11641102 | 3300017722 | Freshwater Lake | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0181362_10223493 | 3300017723 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS |
| Ga0181362_10523551 | 3300017723 | Freshwater Lake | LYPRNNHMTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAS |
| Ga0181362_10743882 | 3300017723 | Freshwater Lake | MIKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAP |
| Ga0181362_10888032 | 3300017723 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKP |
| Ga0181365_10154613 | 3300017736 | Freshwater Lake | MTKEEHKSAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADVDKP |
| Ga0181365_10764984 | 3300017736 | Freshwater Lake | VTQLQQQSLNLLGDSLAAALAEIETLKAAAADKPAP |
| Ga0181365_10803371 | 3300017736 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAP |
| Ga0181365_10872213 | 3300017736 | Freshwater Lake | MSKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIFP |
| Ga0181365_11266512 | 3300017736 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTS |
| Ga0181344_10030714 | 3300017754 | Freshwater Lake | MRGLSFQRNKPMTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0181344_10249706 | 3300017754 | Freshwater Lake | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0181356_10278571 | 3300017761 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAATAAAADKPTP |
| Ga0181356_11195972 | 3300017761 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP |
| Ga0181343_10037664 | 3300017766 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKANANADKPTP |
| Ga0181343_10178014 | 3300017766 | Freshwater Lake | MITMTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTA |
| Ga0181343_10284203 | 3300017766 | Freshwater Lake | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0181358_10515661 | 3300017774 | Freshwater Lake | MSKEEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADVDKP |
| Ga0181358_11205283 | 3300017774 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAAAADKPAS |
| Ga0181358_11570483 | 3300017774 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKA |
| Ga0181357_10824821 | 3300017777 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAA |
| Ga0181357_11453091 | 3300017777 | Freshwater Lake | MTKDEHKATIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0181357_11505921 | 3300017777 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAVDKPTP |
| Ga0181357_11564962 | 3300017777 | Freshwater Lake | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0181357_11745952 | 3300017777 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS |
| Ga0181357_11864932 | 3300017777 | Freshwater Lake | MTKDDHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0181357_12348373 | 3300017777 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADQPAP |
| Ga0181357_12407603 | 3300017777 | Freshwater Lake | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0181357_12850552 | 3300017777 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAS |
| Ga0181357_13134602 | 3300017777 | Freshwater Lake | IRRIITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKP |
| Ga0181357_13146302 | 3300017777 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAS |
| Ga0181349_10384605 | 3300017778 | Freshwater Lake | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKA |
| Ga0181349_10595993 | 3300017778 | Freshwater Lake | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADVDKP |
| Ga0181349_10866284 | 3300017778 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAAD |
| Ga0181349_11243224 | 3300017778 | Freshwater Lake | EHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPAP |
| Ga0181349_11250191 | 3300017778 | Freshwater Lake | EHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0181346_10776482 | 3300017780 | Freshwater Lake | MTKEEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADVDKP |
| Ga0181346_10916224 | 3300017780 | Freshwater Lake | CIRRIITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTA |
| Ga0181346_11130743 | 3300017780 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKP |
| Ga0181346_12231381 | 3300017780 | Freshwater Lake | KPMTKDEHTNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0181346_12867411 | 3300017780 | Freshwater Lake | MSKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAA |
| Ga0181348_10576552 | 3300017784 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLWMHSLAAAQAEIEQLKAAAADKPTS |
| Ga0181348_10992633 | 3300017784 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAD |
| Ga0181348_11104733 | 3300017784 | Freshwater Lake | MRGLSFQRNKHMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0181348_12638102 | 3300017784 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTP |
| Ga0181348_13113252 | 3300017784 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTS |
| Ga0181348_13133032 | 3300017784 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPAP |
| Ga0181355_10239153 | 3300017785 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADVDKP |
| Ga0181355_10532783 | 3300017785 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAA |
| Ga0181355_10839881 | 3300017785 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAAADKPT |
| Ga0181355_13241102 | 3300017785 | Freshwater Lake | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTP |
| Ga0181355_13391243 | 3300017785 | Freshwater Lake | FELVSVEAAMTKNKHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0181359_100016616 | 3300019784 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0181359_10021379 | 3300019784 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0181359_10078894 | 3300019784 | Freshwater Lake | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0181359_10164943 | 3300019784 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0181359_10221933 | 3300019784 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAAAADKPTS |
| Ga0181359_10238934 | 3300019784 | Freshwater Lake | MTKEEHKNVIIAQIQQQNLNVLVDSLAAALAEIESLKAKPKTEE |
| Ga0181359_10308543 | 3300019784 | Freshwater Lake | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAVDKPTP |
| Ga0181359_10607564 | 3300019784 | Freshwater Lake | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADK |
| Ga0181359_11671282 | 3300019784 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAAAAADKPTP |
| Ga0181359_11890162 | 3300019784 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTA |
| Ga0207193_100288122 | 3300020048 | Freshwater Lake Sediment | MTKEDHKNAIVSQIQQQNLNVLVDSLAAALAEIEVLKAEVAKLKETPVG |
| Ga0211736_105355042 | 3300020151 | Freshwater | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0211733_109028393 | 3300020160 | Freshwater | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKDKP |
| Ga0194035_12360132 | 3300020167 | Anoxic Zone Freshwater | MTKEEHKVTIVQQLQQQSLNVLIDSLAAALAEIESLKAKLEPAKE |
| Ga0211729_102873502 | 3300020172 | Freshwater | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0211729_102874602 | 3300020172 | Freshwater | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0211729_102989873 | 3300020172 | Freshwater | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALSEIEQLKAAAADKPTP |
| Ga0211729_107212322 | 3300020172 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0211731_107215972 | 3300020205 | Freshwater | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTA |
| Ga0211731_110456402 | 3300020205 | Freshwater | MNDHKATIVQQLQQQSLNLLVDSLAAALAEIETLKAAAAADKPA |
| Ga0208050_10237013 | 3300020498 | Freshwater | CIQIIITMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0208091_10046553 | 3300020506 | Freshwater | MTKEEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0208235_10331713 | 3300020530 | Freshwater | MTKEEHKNAIVQQLQQQSLNLLVDSLAAALAEIATLKAAAADKPAS |
| Ga0208360_10148314 | 3300020551 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0208855_10436973 | 3300020553 | Freshwater | MTKEEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0222714_100239358 | 3300021961 | Estuarine Water | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0222714_100930583 | 3300021961 | Estuarine Water | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0222714_102126072 | 3300021961 | Estuarine Water | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP |
| Ga0222714_104903112 | 3300021961 | Estuarine Water | MTKDEHKSAIVTQLQQQSLNLLIDSLAAALAEIEALKAAAADKPTP |
| Ga0222714_106297752 | 3300021961 | Estuarine Water | MTKDELPMTKDEHKTVVVQQLQQQSINVLIDSLASALAEIESLKAKLEPAKE |
| Ga0222714_106356512 | 3300021961 | Estuarine Water | MTKDDHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAP |
| Ga0222713_100933743 | 3300021962 | Estuarine Water | MTKDEHKARIVQQLQQETINLLVEALASAQVDVEQLKVAAADKPAP |
| Ga0222713_105831133 | 3300021962 | Estuarine Water | MTKDELPMTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPSKE |
| Ga0222712_101286006 | 3300021963 | Estuarine Water | MTKDDHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAADKPAP |
| Ga0222712_102210371 | 3300021963 | Estuarine Water | MTKDDHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0222712_103798252 | 3300021963 | Estuarine Water | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIESLKAKLEPAKE |
| Ga0181353_11155442 | 3300022179 | Freshwater Lake | MTKEEHKNAIIAQIQQQNLNVLVDSLAAALAEIESLKGKPKTEE |
| Ga0181354_10379213 | 3300022190 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0181354_10829063 | 3300022190 | Freshwater Lake | MSKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADVDKP |
| Ga0181354_11035502 | 3300022190 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAVDKPAS |
| Ga0181354_11591312 | 3300022190 | Freshwater Lake | MTKEEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0181354_11769583 | 3300022190 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTA |
| Ga0181354_12086702 | 3300022190 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0181354_12219252 | 3300022190 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP |
| Ga0181351_10873314 | 3300022407 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP |
| Ga0181351_10938442 | 3300022407 | Freshwater Lake | MTKDDHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAS |
| Ga0181351_11601251 | 3300022407 | Freshwater Lake | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQIKAAANADKPTP |
| Ga0181351_12238913 | 3300022407 | Freshwater Lake | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0181351_12391421 | 3300022407 | Freshwater Lake | DDHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0181351_12677901 | 3300022407 | Freshwater Lake | MTKDDHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0244775_100138563 | 3300024346 | Estuarine | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKANANADKPTP |
| Ga0244775_100398553 | 3300024346 | Estuarine | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP |
| Ga0244775_109805773 | 3300024346 | Estuarine | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP |
| Ga0244775_109981372 | 3300024346 | Estuarine | MTKEEHKVTIVQQLQQQSLNVLIESLAAALAEIEALKAKLEPAKE |
| Ga0244776_104049553 | 3300024348 | Estuarine | CIRRIITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP |
| Ga0208426_10118832 | 3300025451 | Aqueous | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0208148_10834191 | 3300025508 | Aqueous | MTKDEHKTAVIQQLQQQSLNVLIDSLAAALAEIESLKAKLEPAKE |
| Ga0208544_104131543 | 3300025887 | Aqueous | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAA |
| Ga0208916_100024269 | 3300025896 | Aqueous | MTKEEHKTAVIQQLQQQSLNVLIDSLAAALAEIEALKAKLEPSKE |
| Ga0208916_100461532 | 3300025896 | Aqueous | MTKEEHKNAIIAQIQQQNLNVLVDSLAAALAEIESLKAKPKTEE |
| Ga0208916_104202153 | 3300025896 | Aqueous | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0208554_10608272 | 3300027212 | Estuarine | MTKDELPMTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPAKE |
| Ga0208022_10386673 | 3300027418 | Estuarine | IVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP |
| Ga0208974_100025410 | 3300027608 | Freshwater Lentic | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAADADKPAP |
| Ga0208974_10144803 | 3300027608 | Freshwater Lentic | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAGDKPAP |
| Ga0208942_10085644 | 3300027627 | Freshwater Lentic | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALSEIESLKAAAADKPAS |
| Ga0208133_11656433 | 3300027631 | Estuarine | LNLYPRNKHMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0208975_10167583 | 3300027659 | Freshwater Lentic | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0208975_10395275 | 3300027659 | Freshwater Lentic | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0208975_10569563 | 3300027659 | Freshwater Lentic | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0208975_10646824 | 3300027659 | Freshwater Lentic | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPAP |
| Ga0208975_11267191 | 3300027659 | Freshwater Lentic | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKA |
| Ga0209492_10035538 | 3300027721 | Freshwater Sediment | MTKDEHKNGIVSQLQQQSLNLLIDSLAAALAEIEQLKAENAKLTSG |
| Ga0209297_10178876 | 3300027733 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTA |
| Ga0209297_10258453 | 3300027733 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0209297_10361793 | 3300027733 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLTLLVDSLAAALAEIEQLKAAAAADKPV |
| Ga0209297_10572773 | 3300027733 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0209190_100828410 | 3300027736 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKDKP |
| Ga0209190_10100816 | 3300027736 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0209190_10387426 | 3300027736 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0209190_10463136 | 3300027736 | Freshwater Lake | MTKDEHKARIVQQLQQETINLLVEALASAQVDVEQLKAAAADKPSP |
| Ga0209190_10485602 | 3300027736 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0209190_12715293 | 3300027736 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKDKP |
| Ga0209190_12863192 | 3300027736 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTS |
| Ga0209190_13764301 | 3300027736 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLK |
| Ga0209597_10345533 | 3300027746 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTA |
| Ga0208304_101883181 | 3300027751 | Estuarine | HKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKDKP |
| Ga0209596_10020914 | 3300027754 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0209596_100237312 | 3300027754 | Freshwater Lake | MTKDEHKSQIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0209596_11205522 | 3300027754 | Freshwater Lake | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALSEIEGLKAAAADKPTS |
| Ga0209596_11594563 | 3300027754 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQ |
| Ga0209596_12045943 | 3300027754 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAS |
| Ga0209296_10304794 | 3300027759 | Freshwater Lake | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALTEIEQLKAAAADKPAS |
| Ga0209296_10459121 | 3300027759 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0209296_11215463 | 3300027759 | Freshwater Lake | MTKEEHKNAIVQQLQQQSLNLLIDSLAAALAEIEQLKAAANADKPTP |
| Ga0209296_12715853 | 3300027759 | Freshwater Lake | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0209296_13711162 | 3300027759 | Freshwater Lake | MTKDEHKATIVTQLQQQSLNLLVDSLAAALAEIEALKAAAAADKPTP |
| Ga0209088_100093709 | 3300027763 | Freshwater Lake | MTKEEHKAAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAS |
| Ga0209088_100490423 | 3300027763 | Freshwater Lake | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0209088_100521143 | 3300027763 | Freshwater Lake | MTKDEHKATIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTP |
| Ga0209770_100527225 | 3300027769 | Freshwater Lake | MTKEEHKNVIIAQIQQQNLNVLVDSLAAALAEIESLKGKPKTEE |
| Ga0209086_100008843 | 3300027770 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVELLAAALAEIETLKAAAADKPTP |
| Ga0209086_103180312 | 3300027770 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS |
| Ga0209500_100003571 | 3300027782 | Freshwater Lake | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP |
| Ga0209500_104372762 | 3300027782 | Freshwater Lake | IITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0209246_102830433 | 3300027785 | Freshwater Lake | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAAD |
| Ga0209353_100065513 | 3300027798 | Freshwater Lake | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0209354_102246133 | 3300027808 | Freshwater Lake | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAAADKPTS |
| Ga0209354_102308903 | 3300027808 | Freshwater Lake | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKA |
| Ga0209253_105739173 | 3300027900 | Freshwater Lake Sediment | IVSQIQQQNLNVLVDSLAAALAEIEVLKAEVAKLKETPVG |
| Ga0209191_13163762 | 3300027969 | Freshwater Lake | TCIRGIITMTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIEALKAAAADKPAP |
| Ga0209299_12035573 | 3300027974 | Freshwater Lake | RIITMTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0315291_102034013 | 3300031707 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAVDKPAP |
| Ga0315291_102158593 | 3300031707 | Sediment | MTKEEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAANADKPTP |
| Ga0315291_103011763 | 3300031707 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEKLKAAAADKPTP |
| Ga0315291_110371073 | 3300031707 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAA |
| Ga0315291_112158902 | 3300031707 | Sediment | MTKDEHKASIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0315291_113235662 | 3300031707 | Sediment | AMTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315291_115746251 | 3300031707 | Sediment | TKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0315291_115747462 | 3300031707 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0315293_106837223 | 3300031746 | Sediment | LSWYPRNKHMTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAVDKPAP |
| Ga0315293_107864422 | 3300031746 | Sediment | MTKDEHKSTIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315293_107890832 | 3300031746 | Sediment | MTKDEHKTAVIQQLQQQSLNVLIDSLAAALAEIEALKAKLEPAKE |
| Ga0315293_110176591 | 3300031746 | Sediment | HKNAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315293_111565921 | 3300031746 | Sediment | KNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315293_112019573 | 3300031746 | Sediment | MTKEEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAVDKPAP |
| Ga0315288_101685254 | 3300031772 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAANADKPTP |
| Ga0315288_102261843 | 3300031772 | Sediment | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0315288_109660311 | 3300031772 | Sediment | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315290_112001342 | 3300031834 | Sediment | MTKDEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315297_114831122 | 3300031873 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315285_101277193 | 3300031885 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKAAANADKPAP |
| Ga0315285_105358633 | 3300031885 | Sediment | KSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0315285_108003282 | 3300031885 | Sediment | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTT |
| Ga0315285_108376172 | 3300031885 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAANADKPTP |
| Ga0315285_108504142 | 3300031885 | Sediment | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315285_109762872 | 3300031885 | Sediment | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIESLKAAANADKPAP |
| Ga0315294_103488001 | 3300031952 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVESLAAALAEIETLKAAAVDKPAP |
| Ga0315294_111257623 | 3300031952 | Sediment | NKHMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315294_111335282 | 3300031952 | Sediment | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIETLKAAANADKPTP |
| Ga0315294_113318312 | 3300031952 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEKLKAAAADKPTP |
| Ga0315278_106683941 | 3300031997 | Sediment | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAA |
| Ga0315278_107721143 | 3300031997 | Sediment | KNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315278_113227181 | 3300031997 | Sediment | MTKDEHKNAIVSKLQQQSLNLLVESLAAALAEIETLKAAAVDKPAP |
| Ga0315274_101894665 | 3300031999 | Sediment | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIETLKAAAADKPAP |
| Ga0315274_104973301 | 3300031999 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315274_105587173 | 3300031999 | Sediment | MTKDEHKSTIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0315274_108067611 | 3300031999 | Sediment | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKQTP |
| Ga0315274_111152203 | 3300031999 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKA |
| Ga0315274_115087552 | 3300031999 | Sediment | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315274_117632512 | 3300031999 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTA |
| Ga0315274_118701681 | 3300031999 | Sediment | EHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAANADKPTP |
| Ga0315274_120623143 | 3300031999 | Sediment | MTKEEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAANADKPT |
| Ga0315274_121145331 | 3300031999 | Sediment | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAVDKPAP |
| Ga0315272_1000027910 | 3300032018 | Sediment | MTKDEHKHAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0315272_100087603 | 3300032018 | Sediment | MTKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAAADKPTS |
| Ga0315272_100355075 | 3300032018 | Sediment | MTKEEHKSAIVTQLQQQSLNLLVDSLAAALAEIEQLKAAAVDKPAS |
| Ga0315272_100373356 | 3300032018 | Sediment | MSKDEHKSAIVSQLQQQSLNLLVDSLAAALAEIETLKANANADKPTP |
| Ga0315272_100449993 | 3300032018 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTS |
| Ga0315289_103661343 | 3300032046 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVESLATALAEIEALKAAANADKPTP |
| Ga0315289_108261061 | 3300032046 | Sediment | NAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315289_108482013 | 3300032046 | Sediment | MTKEEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAVDKPAP |
| Ga0315284_109798723 | 3300032053 | Sediment | LYPRNNYMTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIESLKAAANADKPAP |
| Ga0315284_111180843 | 3300032053 | Sediment | HKNAIVSQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0315284_113774143 | 3300032053 | Sediment | HMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTS |
| Ga0315284_117523451 | 3300032053 | Sediment | MTKEEHKTAVIQQLQQQSLNVLIDSLAAALAEIEALKAKLEPAKE |
| Ga0315284_117975141 | 3300032053 | Sediment | IIPMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0315277_107709143 | 3300032118 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0315292_111867641 | 3300032143 | Sediment | SQLQQQSLNLLVESLAAALAEIEALKAAANADKPTP |
| Ga0315292_113692441 | 3300032143 | Sediment | IRRIITMTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAADKPTS |
| Ga0315295_107450731 | 3300032156 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVESLAAALAEIETLKAAAADKPTP |
| Ga0315283_105491723 | 3300032164 | Sediment | MTKDEHKSTIVQQLQQQSLNLLVDSLAAALAEIESLKAAAAADKPTP |
| Ga0315283_110943521 | 3300032164 | Sediment | PRNKHMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315268_100435606 | 3300032173 | Sediment | KDEHKSAIVSQLQQQSLNLLVESLAAALAEIEALKAAANADKPTP |
| Ga0315268_100798333 | 3300032173 | Sediment | MTKDEHKAAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0315268_103445163 | 3300032173 | Sediment | MTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAKHAAEHAGDKATP |
| Ga0315268_111088062 | 3300032173 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0315268_127069833 | 3300032173 | Sediment | MTKDEHKSAIVSQLQQQSLNLLVESLAAALAEIEALKAAANADKPTP |
| Ga0315276_116174702 | 3300032177 | Sediment | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIESLKAAAADKPAP |
| Ga0315271_106691123 | 3300032256 | Sediment | MTKEEHKNAIVQQLQQQSLNLLVESLAAALAEIEQLKAAANADKPTP |
| Ga0315270_106472872 | 3300032275 | Sediment | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0315286_118679221 | 3300032342 | Sediment | RGIITMTKDEHKNAIVTQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTP |
| Ga0315287_104753575 | 3300032397 | Sediment | KHMTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAANADKPTP |
| Ga0315287_113770253 | 3300032397 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTP |
| Ga0315275_106747553 | 3300032401 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEQLK |
| Ga0315273_106460153 | 3300032516 | Sediment | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIEALKAAAVDKPTP |
| Ga0315273_109567723 | 3300032516 | Sediment | MCRRLLPSNKHMTKDEHKNAIVTQLQQQSLNLLIDSLAAALAEIEQLKAAAAADKPTP |
| Ga0315273_119452953 | 3300032516 | Sediment | MTKDEHKAAIVSQLQQQSLNLLVDSLAAALAEIEQLKAAAAADKPTP |
| Ga0334722_101105161 | 3300033233 | Sediment | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAA |
| Ga0334722_103417552 | 3300033233 | Sediment | MTKDEHKSTIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPAP |
| Ga0334722_107849723 | 3300033233 | Sediment | HMTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAADKPTS |
| Ga0334722_110549711 | 3300033233 | Sediment | MTKDEHKTVVVQQLQQQSINVLIDSLASALAEIEALKAKLEPAK |
| Ga0334994_0166311_852_992 | 3300033993 | Freshwater | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALAEIATLKAAAADKPAS |
| Ga0334994_0315236_346_489 | 3300033993 | Freshwater | MTKDEHKNAIVSQLQQQSLNLLVDSLAAALAEIETLKANANAGKPTP |
| Ga0334979_0003324_10736_10879 | 3300033996 | Freshwater | MTKDEHKNAIVQQLQQQSLNLLVDSLAAALSEIEQLKAAANADKPTP |
| Ga0334979_0122993_172_312 | 3300033996 | Freshwater | MTKDEHKSAIVQQLQQQSLNLLVDSLAAALAEIETLKAAAADKPTS |
| Ga0334990_0033136_358_501 | 3300034068 | Freshwater | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEALKAAANADKPTP |
| Ga0334990_0280961_527_667 | 3300034068 | Freshwater | MTKEEHKSAIVQQLQQQSLNLLVDSLAAALAEIEQLKAAAVDKPAP |
| Ga0335022_0004010_2834_2983 | 3300034095 | Freshwater | MTKEDHKNAMVSQIQQQNLNVLVDSLAAALAEIEVLKAEVAKLKETPVG |
| Ga0335036_0101071_882_1031 | 3300034106 | Freshwater | MTKEDHKNAIVSQIQQQNLNVLVDSFAAALAEIEALKAEVAKLKETPVG |
| Ga0335060_0433869_452_595 | 3300034122 | Freshwater | MTKDEHKSTIVTQLQQQSLNLLVDSLAAALAEIETLKAAAAAPADKP |
| ⦗Top⦘ |