| Basic Information | |
|---|---|
| Family ID | F005014 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 415 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MGKLGERLSVFAVAAVVVLAIVGLAFAAGYLVGKLLL |
| Number of Associated Samples | 275 |
| Number of Associated Scaffolds | 415 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.34 % |
| % of genes near scaffold ends (potentially truncated) | 18.55 % |
| % of genes from short scaffolds (< 2000 bps) | 77.35 % |
| Associated GOLD sequencing projects | 257 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.566 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.699 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.651 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.976 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 415 Family Scaffolds |
|---|---|---|
| PF12773 | DZR | 22.65 |
| PF00334 | NDK | 10.60 |
| PF08245 | Mur_ligase_M | 10.12 |
| PF10458 | Val_tRNA-synt_C | 4.10 |
| PF08241 | Methyltransf_11 | 3.86 |
| PF02545 | Maf | 1.45 |
| PF06723 | MreB_Mbl | 1.45 |
| PF13649 | Methyltransf_25 | 0.72 |
| PF04093 | MreD | 0.48 |
| PF10576 | EndIII_4Fe-2S | 0.24 |
| PF03717 | PBP_dimer | 0.24 |
| PF02518 | HATPase_c | 0.24 |
| PF01016 | Ribosomal_L27 | 0.24 |
| PF10150 | RNase_E_G | 0.24 |
| PF03352 | Adenine_glyco | 0.24 |
| PF11511 | RhodobacterPufX | 0.24 |
| PF13400 | Tad | 0.24 |
| PF14264 | Glucos_trans_II | 0.24 |
| PF09397 | FtsK_gamma | 0.24 |
| PF09084 | NMT1 | 0.24 |
| PF01243 | Putative_PNPOx | 0.24 |
| PF12802 | MarR_2 | 0.24 |
| PF00746 | Gram_pos_anchor | 0.24 |
| PF00496 | SBP_bac_5 | 0.24 |
| PF05943 | VipB | 0.24 |
| PF12847 | Methyltransf_18 | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 415 Family Scaffolds |
|---|---|---|---|
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 10.60 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.45 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 1.45 |
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.48 |
| COG0211 | Ribosomal protein L27 | Translation, ribosomal structure and biogenesis [J] | 0.24 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.24 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.24 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.24 |
| COG3517 | Predicted component TssB of the type VI protein secretion system, VipA/VipB/TssB family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.24 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.57 % |
| Unclassified | root | N/A | 8.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2067725001|GPWNP_F5MPXY301C9YJJ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig506155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6190 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig861580 | Not Available | 519 | Open in IMG/M |
| 2170459016|G1P06HT01CKXK7 | Not Available | 651 | Open in IMG/M |
| 3300000156|NODE_c0644115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2154 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101116271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300000550|F24TB_10347152 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300000550|F24TB_10531993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300000550|F24TB_10989427 | Not Available | 511 | Open in IMG/M |
| 3300000886|AL3A1W_1500181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300000956|JGI10216J12902_102085845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1260 | Open in IMG/M |
| 3300000956|JGI10216J12902_103046868 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300000956|JGI10216J12902_105457294 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300000956|JGI10216J12902_109385465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 833 | Open in IMG/M |
| 3300001305|C688J14111_10008405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2904 | Open in IMG/M |
| 3300001380|JGI1356J14229_10011893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5815 | Open in IMG/M |
| 3300001380|JGI1356J14229_10049117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2148 | Open in IMG/M |
| 3300001537|A2065W1_10306363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
| 3300001686|C688J18823_10349126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 964 | Open in IMG/M |
| 3300001686|C688J18823_10377817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 919 | Open in IMG/M |
| 3300002120|C687J26616_10131363 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300002568|C688J35102_120922109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2370 | Open in IMG/M |
| 3300004114|Ga0062593_100784444 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300004114|Ga0062593_100935359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
| 3300004114|Ga0062593_102319380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300005104|Ga0066818_1019429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300005332|Ga0066388_100356061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2110 | Open in IMG/M |
| 3300005332|Ga0066388_106875349 | Not Available | 573 | Open in IMG/M |
| 3300005458|Ga0070681_11913044 | Not Available | 521 | Open in IMG/M |
| 3300005526|Ga0073909_10007931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3173 | Open in IMG/M |
| 3300005526|Ga0073909_10009504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2927 | Open in IMG/M |
| 3300005526|Ga0073909_10094419 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005529|Ga0070741_10002010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 57135 | Open in IMG/M |
| 3300005529|Ga0070741_11316968 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005540|Ga0066697_10041119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2595 | Open in IMG/M |
| 3300005540|Ga0066697_10315824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 916 | Open in IMG/M |
| 3300005540|Ga0066697_10387807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 812 | Open in IMG/M |
| 3300005543|Ga0070672_101082122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300005545|Ga0070695_100255484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| 3300005548|Ga0070665_101827043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 614 | Open in IMG/M |
| 3300005553|Ga0066695_10607175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300005554|Ga0066661_10048984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2412 | Open in IMG/M |
| 3300005554|Ga0066661_10398228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300005556|Ga0066707_10238365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
| 3300005558|Ga0066698_10324809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1065 | Open in IMG/M |
| 3300005558|Ga0066698_10656326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 699 | Open in IMG/M |
| 3300005559|Ga0066700_10054259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2477 | Open in IMG/M |
| 3300005560|Ga0066670_10002970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6282 | Open in IMG/M |
| 3300005560|Ga0066670_10021358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3016 | Open in IMG/M |
| 3300005561|Ga0066699_10341116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1070 | Open in IMG/M |
| 3300005561|Ga0066699_10530798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 842 | Open in IMG/M |
| 3300005563|Ga0068855_100043139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5344 | Open in IMG/M |
| 3300005563|Ga0068855_100715384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1070 | Open in IMG/M |
| 3300005564|Ga0070664_100811279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300005564|Ga0070664_101986210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300005566|Ga0066693_10171562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
| 3300005566|Ga0066693_10189474 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005569|Ga0066705_10186651 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300005576|Ga0066708_10021907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3283 | Open in IMG/M |
| 3300005576|Ga0066708_10874735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300005578|Ga0068854_101166714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
| 3300005587|Ga0066654_10151932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
| 3300005587|Ga0066654_10922859 | Not Available | 503 | Open in IMG/M |
| 3300005614|Ga0068856_100037962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4727 | Open in IMG/M |
| 3300005614|Ga0068856_100854700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300005618|Ga0068864_101194931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300005713|Ga0066905_100078918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2154 | Open in IMG/M |
| 3300005713|Ga0066905_100371476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1150 | Open in IMG/M |
| 3300005713|Ga0066905_101423138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 628 | Open in IMG/M |
| 3300005719|Ga0068861_100069882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2718 | Open in IMG/M |
| 3300005764|Ga0066903_100029643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6148 | Open in IMG/M |
| 3300005764|Ga0066903_100040763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5472 | Open in IMG/M |
| 3300005764|Ga0066903_100061293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4704 | Open in IMG/M |
| 3300005764|Ga0066903_100099461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3921 | Open in IMG/M |
| 3300005764|Ga0066903_100405755 | All Organisms → cellular organisms → Bacteria | 2245 | Open in IMG/M |
| 3300005764|Ga0066903_103326982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
| 3300005764|Ga0066903_105017873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300005844|Ga0068862_100576524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1077 | Open in IMG/M |
| 3300005887|Ga0075292_1066115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300005937|Ga0081455_10170065 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300005981|Ga0081538_10000857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 32766 | Open in IMG/M |
| 3300005981|Ga0081538_10026155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4090 | Open in IMG/M |
| 3300005981|Ga0081538_10172146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 942 | Open in IMG/M |
| 3300005983|Ga0081540_1019918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4055 | Open in IMG/M |
| 3300006031|Ga0066651_10382169 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006034|Ga0066656_10596539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 715 | Open in IMG/M |
| 3300006034|Ga0066656_10725461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300006034|Ga0066656_11037373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300006038|Ga0075365_10248328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1250 | Open in IMG/M |
| 3300006046|Ga0066652_100212620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1671 | Open in IMG/M |
| 3300006046|Ga0066652_101851019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300006047|Ga0075024_100611006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300006163|Ga0070715_10294642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300006173|Ga0070716_100312906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1097 | Open in IMG/M |
| 3300006358|Ga0068871_100105345 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300006572|Ga0074051_11606619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 962 | Open in IMG/M |
| 3300006618|Ga0101566_10809601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300006755|Ga0079222_10747428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300006755|Ga0079222_11755170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 598 | Open in IMG/M |
| 3300006755|Ga0079222_11779586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300006791|Ga0066653_10226474 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300006797|Ga0066659_11520439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 561 | Open in IMG/M |
| 3300006800|Ga0066660_10682451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 847 | Open in IMG/M |
| 3300006806|Ga0079220_10651379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300006806|Ga0079220_11198198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 626 | Open in IMG/M |
| 3300006806|Ga0079220_12054033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300006844|Ga0075428_102666721 | Not Available | 510 | Open in IMG/M |
| 3300006847|Ga0075431_102243549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300006852|Ga0075433_10624676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300006865|Ga0073934_10038159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4416 | Open in IMG/M |
| 3300006865|Ga0073934_10616305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300006876|Ga0079217_10434895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300006881|Ga0068865_101667730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 574 | Open in IMG/M |
| 3300006894|Ga0079215_10392413 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006894|Ga0079215_10706466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter | 683 | Open in IMG/M |
| 3300006904|Ga0075424_102116345 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300006918|Ga0079216_11232162 | Not Available | 604 | Open in IMG/M |
| 3300006954|Ga0079219_10295856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 999 | Open in IMG/M |
| 3300007004|Ga0079218_10604725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300007004|Ga0079218_11249103 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300009012|Ga0066710_100258149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2526 | Open in IMG/M |
| 3300009038|Ga0099829_10308138 | Not Available | 1299 | Open in IMG/M |
| 3300009090|Ga0099827_10315317 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300009090|Ga0099827_11214896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300009098|Ga0105245_10032130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4647 | Open in IMG/M |
| 3300009137|Ga0066709_100709541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1447 | Open in IMG/M |
| 3300009147|Ga0114129_10657048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1352 | Open in IMG/M |
| 3300009156|Ga0111538_11836359 | Not Available | 763 | Open in IMG/M |
| 3300009162|Ga0075423_10270750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1779 | Open in IMG/M |
| 3300009162|Ga0075423_11216721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300009162|Ga0075423_11617613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 696 | Open in IMG/M |
| 3300009162|Ga0075423_13173856 | Not Available | 504 | Open in IMG/M |
| 3300009610|Ga0105340_1157736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
| 3300009789|Ga0126307_10000345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 29802 | Open in IMG/M |
| 3300009789|Ga0126307_10138764 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
| 3300009789|Ga0126307_10602667 | Not Available | 887 | Open in IMG/M |
| 3300009792|Ga0126374_11727739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300009817|Ga0105062_1102446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300009823|Ga0105078_1029599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300009840|Ga0126313_10000570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 17805 | Open in IMG/M |
| 3300009840|Ga0126313_10018752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4562 | Open in IMG/M |
| 3300009840|Ga0126313_10043165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3150 | Open in IMG/M |
| 3300009840|Ga0126313_10269181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1325 | Open in IMG/M |
| 3300009840|Ga0126313_10835519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300009840|Ga0126313_11392592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300009840|Ga0126313_11493947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300010037|Ga0126304_10531609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300010039|Ga0126309_10000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 14462 | Open in IMG/M |
| 3300010039|Ga0126309_10000443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13857 | Open in IMG/M |
| 3300010039|Ga0126309_10028668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2512 | Open in IMG/M |
| 3300010039|Ga0126309_10040617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2176 | Open in IMG/M |
| 3300010039|Ga0126309_10053437 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300010039|Ga0126309_10090020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1559 | Open in IMG/M |
| 3300010039|Ga0126309_10253681 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300010039|Ga0126309_10518635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300010039|Ga0126309_10561780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300010039|Ga0126309_11236148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300010040|Ga0126308_10021675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3473 | Open in IMG/M |
| 3300010041|Ga0126312_10001971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 13588 | Open in IMG/M |
| 3300010041|Ga0126312_10137780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1689 | Open in IMG/M |
| 3300010041|Ga0126312_10438688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300010043|Ga0126380_10125924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1593 | Open in IMG/M |
| 3300010044|Ga0126310_10018140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 3461 | Open in IMG/M |
| 3300010044|Ga0126310_10215321 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300010044|Ga0126310_10868653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300010044|Ga0126310_11120790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300010154|Ga0127503_11100537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300010303|Ga0134082_10448850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300010320|Ga0134109_10501507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300010323|Ga0134086_10131552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300010323|Ga0134086_10466677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300010326|Ga0134065_10193416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300010326|Ga0134065_10266545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300010329|Ga0134111_10529556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300010333|Ga0134080_10615719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300010358|Ga0126370_11246696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 694 | Open in IMG/M |
| 3300010359|Ga0126376_12855305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300010362|Ga0126377_10069216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3134 | Open in IMG/M |
| 3300010371|Ga0134125_12052446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300010373|Ga0134128_10551789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1284 | Open in IMG/M |
| 3300010373|Ga0134128_12905933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 527 | Open in IMG/M |
| 3300010396|Ga0134126_13091813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300010396|Ga0134126_13101543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300010399|Ga0134127_12957331 | Not Available | 554 | Open in IMG/M |
| 3300011000|Ga0138513_100008361 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300011003|Ga0138514_100003912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2101 | Open in IMG/M |
| 3300011991|Ga0120153_1080389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300012045|Ga0136623_10309311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300012091|Ga0136625_1058655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
| 3300012093|Ga0136632_10024844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2692 | Open in IMG/M |
| 3300012093|Ga0136632_10524497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300012187|Ga0136622_10449636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300012198|Ga0137364_10699202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300012200|Ga0137382_10678354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300012200|Ga0137382_10981877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 607 | Open in IMG/M |
| 3300012201|Ga0137365_10624749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 789 | Open in IMG/M |
| 3300012204|Ga0137374_10001938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 24121 | Open in IMG/M |
| 3300012204|Ga0137374_10013671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 9430 | Open in IMG/M |
| 3300012204|Ga0137374_10361301 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300012208|Ga0137376_10044546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3602 | Open in IMG/M |
| 3300012208|Ga0137376_10386088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1216 | Open in IMG/M |
| 3300012208|Ga0137376_10726787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300012208|Ga0137376_11110461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300012210|Ga0137378_10458134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1180 | Open in IMG/M |
| 3300012210|Ga0137378_11192725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300012212|Ga0150985_115239430 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300012212|Ga0150985_121065607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300012285|Ga0137370_10042064 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300012354|Ga0137366_10253216 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300012356|Ga0137371_10203090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1552 | Open in IMG/M |
| 3300012356|Ga0137371_10570631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300012363|Ga0137390_10221870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1877 | Open in IMG/M |
| 3300012391|Ga0134035_1242936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300012407|Ga0134050_1252759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300012469|Ga0150984_102345097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
| 3300012469|Ga0150984_108607622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300012469|Ga0150984_115299167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300012469|Ga0150984_116692058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
| 3300012469|Ga0150984_117183815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300012530|Ga0136635_10001038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8413 | Open in IMG/M |
| 3300012892|Ga0157294_10217443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300012900|Ga0157292_10098829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 866 | Open in IMG/M |
| 3300012901|Ga0157288_10065974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 892 | Open in IMG/M |
| 3300012902|Ga0157291_10334308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300012914|Ga0157297_10445703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 531 | Open in IMG/M |
| 3300012937|Ga0162653_100037972 | Not Available | 717 | Open in IMG/M |
| 3300012939|Ga0162650_100072846 | Not Available | 587 | Open in IMG/M |
| 3300012948|Ga0126375_12074960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300012960|Ga0164301_10503088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
| 3300012961|Ga0164302_10835917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300012984|Ga0164309_11261839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300012984|Ga0164309_11290780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 617 | Open in IMG/M |
| 3300012985|Ga0164308_11134039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300012986|Ga0164304_10615402 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012986|Ga0164304_11712376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012987|Ga0164307_10855838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300013026|Ga0170681_1124137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300013105|Ga0157369_10341353 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300013760|Ga0120188_1062624 | Not Available | 501 | Open in IMG/M |
| 3300013770|Ga0120123_1005827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2305 | Open in IMG/M |
| 3300014166|Ga0134079_10012292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2628 | Open in IMG/M |
| 3300014487|Ga0182000_10420639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 598 | Open in IMG/M |
| 3300014488|Ga0182001_10041377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300014488|Ga0182001_10252037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300014488|Ga0182001_10328831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300014497|Ga0182008_10308135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300014745|Ga0157377_10722741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
| 3300014884|Ga0180104_1200713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300015200|Ga0173480_10772685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300015251|Ga0180070_1057125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300015261|Ga0182006_1302440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300015371|Ga0132258_13004633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
| 3300015372|Ga0132256_100574479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300017695|Ga0180121_10000322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 19630 | Open in IMG/M |
| 3300017695|Ga0180121_10025444 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300017695|Ga0180121_10310588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300017787|Ga0183260_10032562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3929 | Open in IMG/M |
| 3300017792|Ga0163161_10036580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3516 | Open in IMG/M |
| 3300017939|Ga0187775_10008376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2573 | Open in IMG/M |
| 3300017947|Ga0187785_10786122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300017965|Ga0190266_10048868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300017997|Ga0184610_1176715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300018027|Ga0184605_10017277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2850 | Open in IMG/M |
| 3300018027|Ga0184605_10057399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
| 3300018027|Ga0184605_10134680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1105 | Open in IMG/M |
| 3300018027|Ga0184605_10157518 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300018027|Ga0184605_10525726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300018028|Ga0184608_10227015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300018031|Ga0184634_10259094 | Not Available | 797 | Open in IMG/M |
| 3300018031|Ga0184634_10287570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300018052|Ga0184638_1100303 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300018056|Ga0184623_10267616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300018061|Ga0184619_10001280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8848 | Open in IMG/M |
| 3300018061|Ga0184619_10005292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4825 | Open in IMG/M |
| 3300018061|Ga0184619_10091364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1361 | Open in IMG/M |
| 3300018061|Ga0184619_10175145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
| 3300018061|Ga0184619_10212281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 890 | Open in IMG/M |
| 3300018071|Ga0184618_10006697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3296 | Open in IMG/M |
| 3300018071|Ga0184618_10075617 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300018072|Ga0184635_10005161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4211 | Open in IMG/M |
| 3300018072|Ga0184635_10011873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3058 | Open in IMG/M |
| 3300018073|Ga0184624_10034674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1970 | Open in IMG/M |
| 3300018078|Ga0184612_10048687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2206 | Open in IMG/M |
| 3300018431|Ga0066655_10470720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300018431|Ga0066655_10962336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300018433|Ga0066667_10230611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1387 | Open in IMG/M |
| 3300018433|Ga0066667_10279690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1284 | Open in IMG/M |
| 3300018433|Ga0066667_11276022 | Not Available | 641 | Open in IMG/M |
| 3300018433|Ga0066667_11290406 | Not Available | 638 | Open in IMG/M |
| 3300018469|Ga0190270_10227274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1602 | Open in IMG/M |
| 3300018469|Ga0190270_10700486 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300018469|Ga0190270_11724185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300018482|Ga0066669_10062139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2423 | Open in IMG/M |
| 3300018482|Ga0066669_11795837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300019356|Ga0173481_10018061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2107 | Open in IMG/M |
| 3300019356|Ga0173481_10150189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300019361|Ga0173482_10090472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1091 | Open in IMG/M |
| 3300019361|Ga0173482_10437456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300019377|Ga0190264_10783749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| 3300019767|Ga0190267_10227106 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300019867|Ga0193704_1000450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7442 | Open in IMG/M |
| 3300019869|Ga0193705_1004242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3154 | Open in IMG/M |
| 3300019877|Ga0193722_1148332 | Not Available | 514 | Open in IMG/M |
| 3300019878|Ga0193715_1069773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 739 | Open in IMG/M |
| 3300019883|Ga0193725_1011792 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300019884|Ga0193741_1014219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2059 | Open in IMG/M |
| 3300019885|Ga0193747_1053407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1003 | Open in IMG/M |
| 3300019887|Ga0193729_1005662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5948 | Open in IMG/M |
| 3300019890|Ga0193728_1115839 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300020002|Ga0193730_1160982 | Not Available | 584 | Open in IMG/M |
| 3300020202|Ga0196964_10325931 | Not Available | 731 | Open in IMG/M |
| 3300020202|Ga0196964_10535456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300021073|Ga0210378_10026097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2344 | Open in IMG/M |
| 3300021415|Ga0193694_1055536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300021445|Ga0182009_10001535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6177 | Open in IMG/M |
| 3300021445|Ga0182009_10078870 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300021445|Ga0182009_10140420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1140 | Open in IMG/M |
| 3300021445|Ga0182009_10395955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300021445|Ga0182009_10458024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300022195|Ga0222625_1124782 | Not Available | 657 | Open in IMG/M |
| 3300022756|Ga0222622_10055215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2264 | Open in IMG/M |
| 3300023072|Ga0247799_1009890 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300024181|Ga0247693_1057906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300024288|Ga0179589_10559791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300025310|Ga0209172_10024171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4244 | Open in IMG/M |
| 3300025313|Ga0209431_10590770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300025552|Ga0210142_1001438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4772 | Open in IMG/M |
| 3300025885|Ga0207653_10006243 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
| 3300025901|Ga0207688_10014063 | All Organisms → cellular organisms → Bacteria | 4351 | Open in IMG/M |
| 3300025905|Ga0207685_10039726 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300025910|Ga0207684_10127272 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300025910|Ga0207684_10276856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
| 3300025913|Ga0207695_10623149 | Not Available | 960 | Open in IMG/M |
| 3300025914|Ga0207671_11355131 | Not Available | 553 | Open in IMG/M |
| 3300025915|Ga0207693_10111329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2147 | Open in IMG/M |
| 3300025915|Ga0207693_11051701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300025922|Ga0207646_10252546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1593 | Open in IMG/M |
| 3300025930|Ga0207701_10231423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1617 | Open in IMG/M |
| 3300025932|Ga0207690_10090639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2159 | Open in IMG/M |
| 3300025942|Ga0207689_10202270 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300025944|Ga0207661_10219152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
| 3300026078|Ga0207702_11998263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300026118|Ga0207675_101926874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300026295|Ga0209234_1008413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3923 | Open in IMG/M |
| 3300026300|Ga0209027_1141380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300026306|Ga0209468_1038795 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300026342|Ga0209057_1092767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300026343|Ga0209159_1192191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300026542|Ga0209805_1036719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2489 | Open in IMG/M |
| 3300026550|Ga0209474_10083519 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300026550|Ga0209474_10284762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 990 | Open in IMG/M |
| 3300026552|Ga0209577_10414075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
| 3300026861|Ga0207503_1012980 | Not Available | 533 | Open in IMG/M |
| 3300027379|Ga0209842_1073974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300027401|Ga0208637_1011517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 904 | Open in IMG/M |
| 3300027577|Ga0209874_1090386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300027691|Ga0209485_1214066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300027725|Ga0209178_1132167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
| 3300027775|Ga0209177_10245938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300027775|Ga0209177_10249137 | Not Available | 655 | Open in IMG/M |
| 3300027819|Ga0209514_10018703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6350 | Open in IMG/M |
| 3300027821|Ga0209811_10005688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4001 | Open in IMG/M |
| 3300027907|Ga0207428_10341335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1103 | Open in IMG/M |
| 3300027915|Ga0209069_10312534 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027915|Ga0209069_10927078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 529 | Open in IMG/M |
| 3300028104|Ga0247713_1030174 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300028379|Ga0268266_12209571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300028592|Ga0247822_11792950 | Not Available | 524 | Open in IMG/M |
| 3300028705|Ga0307276_10084811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300028705|Ga0307276_10211254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300028711|Ga0307293_10052349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1269 | Open in IMG/M |
| 3300028711|Ga0307293_10157322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 723 | Open in IMG/M |
| 3300028711|Ga0307293_10190056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
| 3300028714|Ga0307309_10001109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3714 | Open in IMG/M |
| 3300028716|Ga0307311_10046912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1142 | Open in IMG/M |
| 3300028716|Ga0307311_10152852 | Not Available | 664 | Open in IMG/M |
| 3300028716|Ga0307311_10159379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
| 3300028718|Ga0307307_10216262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300028719|Ga0307301_10251957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300028722|Ga0307319_10011902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2653 | Open in IMG/M |
| 3300028722|Ga0307319_10089712 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300028778|Ga0307288_10094700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
| 3300028784|Ga0307282_10281922 | Not Available | 800 | Open in IMG/M |
| 3300028814|Ga0307302_10060367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1772 | Open in IMG/M |
| 3300028819|Ga0307296_10004232 | All Organisms → cellular organisms → Bacteria | 7468 | Open in IMG/M |
| 3300028872|Ga0307314_10083658 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300028881|Ga0307277_10001846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8229 | Open in IMG/M |
| 3300028881|Ga0307277_10043042 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300028881|Ga0307277_10373287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300028881|Ga0307277_10560380 | Not Available | 513 | Open in IMG/M |
| 3300030511|Ga0268241_10011035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1693 | Open in IMG/M |
| 3300031231|Ga0170824_125394144 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300031421|Ga0308194_10198524 | Not Available | 648 | Open in IMG/M |
| 3300031548|Ga0307408_100506405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1058 | Open in IMG/M |
| 3300031548|Ga0307408_101342213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 671 | Open in IMG/M |
| 3300031716|Ga0310813_10598635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300031740|Ga0307468_100634308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 880 | Open in IMG/M |
| 3300031740|Ga0307468_101976805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300031938|Ga0308175_100052507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3532 | Open in IMG/M |
| 3300031938|Ga0308175_100223211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1872 | Open in IMG/M |
| 3300031938|Ga0308175_100280523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1688 | Open in IMG/M |
| 3300031938|Ga0308175_102149529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300031995|Ga0307409_101967678 | Not Available | 614 | Open in IMG/M |
| 3300032002|Ga0307416_101730774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300032009|Ga0318563_10325418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
| 3300032126|Ga0307415_100210166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1552 | Open in IMG/M |
| 3300032163|Ga0315281_10002111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 29518 | Open in IMG/M |
| 3300032180|Ga0307471_102259151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300032205|Ga0307472_100889818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300032770|Ga0335085_12031059 | Not Available | 582 | Open in IMG/M |
| 3300034143|Ga0334961_026680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300034172|Ga0334913_034531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1091 | Open in IMG/M |
| 3300034176|Ga0364931_0318364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300034268|Ga0372943_0332596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.84% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.30% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.13% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.65% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.65% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.41% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.20% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.20% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.96% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.72% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.72% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.48% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.48% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.48% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.24% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.24% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.24% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.24% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.24% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Rock | 0.24% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.24% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.24% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.24% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.24% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006618 | Soil microbial communities from the Leymus chinensis steppe, China - without N addition | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012091 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013026 | Gypsum rock hypoendolithic microbial communities from the Atacama Desert, Chile - Cordon de Lila | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026861 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028104 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_N | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| 3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPWNP_02105680 | 2067725001 | Soil | PKLVERLSVFAFAAAVLLTIVGLAFAAGYVVGQLLL |
| KansclcFeb2_00822560 | 2124908045 | Soil | MTGLGERLSVFAVALIVIVMVMGLAFGAGYLVGKLLL |
| KansclcFeb2_08735170 | 2124908045 | Soil | VQKLGERLSVFAFVALVVLAFVALAFAAGYTVGKLLL |
| 2ZMR_04381260 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MGKLGERLSVFAVAAIVVLTIIGLAFAAGYIVGKILL |
| NODE_06441152 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MGKFGERLSVFAVAVIVVLAIVGLAFGAGYLVGKLLL* |
| INPhiseqgaiiFebDRAFT_1011162712 | 3300000364 | Soil | MGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKLLL* |
| F24TB_103471523 | 3300000550 | Soil | MTKLGERLSVFAFVAAVVLTIVGLAFAAGYVVGQLLL* |
| F24TB_105319932 | 3300000550 | Soil | MTGLGERLSVFAVALIVIVMVMGLAFGAGYLVGKLLL* |
| F24TB_109894272 | 3300000550 | Soil | MRKLGERLSVFAFAAFVLGAIVGLAFAAGYVVGQLLL* |
| AL3A1W_15001811 | 3300000886 | Permafrost | MGQFGERLSVFAVAVIVVLTIVGLAFGVGYLVGKLLL* |
| JGI10216J12902_1020858452 | 3300000956 | Soil | MRKLGEKLSVFAVAALVVLTIVGLAFAAGYLVGKILL* |
| JGI10216J12902_1030468682 | 3300000956 | Soil | MKKLGEKLSVFAVAALVVLMIVGLAFAAGYLVGKVLL* |
| JGI10216J12902_1054572942 | 3300000956 | Soil | MRRRTMSKTGERLSVFAVAGIVVVAIVGLAFAAGYVVGKILL* |
| JGI10216J12902_1093854652 | 3300000956 | Soil | MGKLGERLSVFAFAAVVVLAIVGLAFAAGYLVGRLLL* |
| C688J14111_100084056 | 3300001305 | Soil | MGQFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL* |
| JGI1356J14229_100118933 | 3300001380 | Groundwater | VAKVGERLSVFAFAAIVLAAIVGSAFAIGYIVGKLLL* |
| JGI1356J14229_100491172 | 3300001380 | Groundwater | MAKVGERLSVFAFAAIVLAAIVGSAFAIGYIVGKLLL* |
| A2065W1_103063632 | 3300001537 | Permafrost | LVERLTVFAFAAFVILAIVGLAFGAGYLIGKMLL* |
| C688J18823_103491263 | 3300001686 | Soil | MGQFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| C688J18823_103778172 | 3300001686 | Soil | MTGFGERLSVFAVALIVVVAIVGLAFGAGYLVGKLLL* |
| C687J26616_101313632 | 3300002120 | Soil | VARLGERLSVFAFAAFVLAAIVGSAFALGYIVGKLLL* |
| C688J35102_1209221092 | 3300002568 | Soil | MPSRRPRSMRPLAERLSVFVFAVVAVLAIVGLAFAAGYLVGQLLL* |
| Ga0062593_1007844443 | 3300004114 | Soil | RPTPARTMGQFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0062593_1009353591 | 3300004114 | Soil | MRRRTMGKTGERLSVFAVAVVVVVAIVGLAFAAGYVVGKILL* |
| Ga0062593_1023193802 | 3300004114 | Soil | LQPIGTRTMTKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL* |
| Ga0066818_10194291 | 3300005104 | Soil | ANTMGKLGERLSVFAVAAIVVLAIIGLAFAAGYLVGRILL* |
| Ga0066388_1003560611 | 3300005332 | Tropical Forest Soil | MPSRRPRSIRPLAERLSVFVFAVVAVLAIVGLAFAAGYLVGQLLL* |
| Ga0066388_1068753492 | 3300005332 | Tropical Forest Soil | ARTMGQFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0070681_119130441 | 3300005458 | Corn Rhizosphere | ARTMGKFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKLLL* |
| Ga0073909_100079315 | 3300005526 | Surface Soil | MGKFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKLLL* |
| Ga0073909_100095045 | 3300005526 | Surface Soil | MGKFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL* |
| Ga0073909_100944192 | 3300005526 | Surface Soil | MGQFRERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0070741_100020108 | 3300005529 | Surface Soil | MRQSTPRLSVFAFAAFALLAFVGLAFAAGYIVGKLLL* |
| Ga0070741_113169682 | 3300005529 | Surface Soil | MGKFGEKLSVFAVAAIVVLTIVGLAFAAGYLVGRVLL* |
| Ga0066697_100411193 | 3300005540 | Soil | MGKLGERLSVFAVAALVVLTIVGLAFAAGYLVGKVLL* |
| Ga0066697_103158242 | 3300005540 | Soil | MGKLGERLSVFAVAAIVVFMIIGLAFAAGYIVGKILL* |
| Ga0066697_103878072 | 3300005540 | Soil | MTGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0070672_1010821222 | 3300005543 | Miscanthus Rhizosphere | MTGLGERLSVFAVALIVIVMVVGLAFGAGYLLGKLLL* |
| Ga0070695_1002554841 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ARTMGKFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0070665_1018270432 | 3300005548 | Switchgrass Rhizosphere | MRPLVERLSVFVFAAVVILAIVGIAFAAGYLVGQLLL* |
| Ga0066695_106071752 | 3300005553 | Soil | MTGFGERLSVFAVALVVIVLVVGLAFGAGYLVGKLLL* |
| Ga0066661_100489844 | 3300005554 | Soil | MSKLGEKLSVFAVAAIVVLAVVGLAFGAGYLVGKLLL* |
| Ga0066661_103982281 | 3300005554 | Soil | MTKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL* |
| Ga0066707_102383652 | 3300005556 | Soil | MGKLGERLSVFAVAALVVLTIVGLAFAAGYIVGKILL* |
| Ga0066698_103248092 | 3300005558 | Soil | MRTLGERLSVFAVAALVVLTIVGLAFAAGYLVGKVLL* |
| Ga0066698_106563262 | 3300005558 | Soil | MRKLGERLSVFAVAAVVVLAIVGLAFAAGYLVGRLLL* |
| Ga0066700_100542595 | 3300005559 | Soil | MSKLGERLSVFAVAVVVVLTIVGLAFAAGYLVGKLLL* |
| Ga0066670_100029707 | 3300005560 | Soil | MGKLGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL* |
| Ga0066670_100213583 | 3300005560 | Soil | MTGFGERLSLFAVALLVIVLVVGLAFGAGYLVGKLLL* |
| Ga0066699_103411162 | 3300005561 | Soil | MGKLGERLSVFAVAAIVVLTIIGLAFAAGYIVGKILL* |
| Ga0066699_105307982 | 3300005561 | Soil | MSGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0068855_1000431392 | 3300005563 | Corn Rhizosphere | MSKLGERLSVFAVAMIVVVTIVGLAFGAGYLVGKLLL* |
| Ga0068855_1007153842 | 3300005563 | Corn Rhizosphere | MTGFGERLSVFAVALIVIVMIVGLAFGAGYLVGKLLL* |
| Ga0070664_1008112792 | 3300005564 | Corn Rhizosphere | MTGLGERLSVFAVALIVIVTVVGLAFGAGYLLGKLLL* |
| Ga0070664_1019862102 | 3300005564 | Corn Rhizosphere | MGKFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0066693_101715622 | 3300005566 | Soil | MGKLGERLSVFAVAAIVVLTIIGFAFAAGYIVGKILL* |
| Ga0066693_101894741 | 3300005566 | Soil | LGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL* |
| Ga0066705_101866514 | 3300005569 | Soil | RTMTGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0066708_100219072 | 3300005576 | Soil | MGKLGERLSVFAVAAVVVLTIVGLAFAAGYLLGKLLL* |
| Ga0066708_108747352 | 3300005576 | Soil | MGKLGERLSVFAVAAIVVFTIIGLAFAAGYIVGKILL* |
| Ga0068854_1011667142 | 3300005578 | Corn Rhizosphere | MGKFSERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0066654_101519322 | 3300005587 | Soil | MRGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0066654_109228591 | 3300005587 | Soil | TMGKLGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL* |
| Ga0068856_1000379622 | 3300005614 | Corn Rhizosphere | MGQLGERLSVFAVAVVVFLAIVGLAFGAGYLVGKLLL* |
| Ga0068856_1008547002 | 3300005614 | Corn Rhizosphere | MGKLGERLSVFAVAAVVVLAIVGLAFAAGYLVGKLLL* |
| Ga0068864_1011949312 | 3300005618 | Switchgrass Rhizosphere | TMGKFSERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0066905_1000789182 | 3300005713 | Tropical Forest Soil | MQKLAERVSVFAFAAAVLLAIIGLAFAAGYVVGQLLL* |
| Ga0066905_1003714761 | 3300005713 | Tropical Forest Soil | MKKLGEKLSVFAVAALVVLTIVGLAFAAGYLVGKVLL* |
| Ga0066905_1014231382 | 3300005713 | Tropical Forest Soil | MGQFGERLSVFAVAVVFVLAIVGLAFGAGYLVGKLLL* |
| Ga0068861_1000698823 | 3300005719 | Switchgrass Rhizosphere | MTGFGERLSVFAVALIVIVMVVGLAFAAGYLVGKLLL* |
| Ga0066903_1000296433 | 3300005764 | Tropical Forest Soil | MTGIGERLSVFAVALLVVVLVVGLAFGAGYLVGKLLL* |
| Ga0066903_1000407634 | 3300005764 | Tropical Forest Soil | MPSRRPRSMRPPAEKLGVFVFAVVAVLAIVGLAFAAGYLVGQLLL* |
| Ga0066903_1000612935 | 3300005764 | Tropical Forest Soil | MGQFGERLSVFAVAVIVVLAIVGLAFGVGYLVGKLLL* |
| Ga0066903_1000994613 | 3300005764 | Tropical Forest Soil | MTGFGERLSVFAVALLVIVLVVGLAFGAGYLVGKLLL* |
| Ga0066903_1004057554 | 3300005764 | Tropical Forest Soil | MTGIGERLSVFAVALVVVVLVVGLAFGAGYLVGKLLL* |
| Ga0066903_1033269822 | 3300005764 | Tropical Forest Soil | MKPFAERLSVFVFAVVAVLEIVGLAFAAGYLVGQLLL* |
| Ga0066903_1050178732 | 3300005764 | Tropical Forest Soil | MPKLGERLSVFAFAAVVVAAFAGVAFAAGYFVGKLIF* |
| Ga0068862_1005765242 | 3300005844 | Switchgrass Rhizosphere | MKPLVERLSVFVFAAVVILAIVGIAFAAGYLVGQLLL* |
| Ga0075292_10661152 | 3300005887 | Rice Paddy Soil | FGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0081455_101700654 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MGKLVERLSVFAFAAVVLGAIVGLAFAAGYLVGQLLL* |
| Ga0081538_100008574 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTKVGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL* |
| Ga0081538_100261556 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MPKLAERLSVFAFAAAVVLMIVGLAFAAGYVVGQLLL* |
| Ga0081538_101721462 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MRKLGERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL* |
| Ga0081540_10199182 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MGRLGERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0066651_103821691 | 3300006031 | Soil | GFGERLSVFAVALIVIVLVVGLAFGAGYLVGKLLL* |
| Ga0066656_105965392 | 3300006034 | Soil | MGKLGERLSVFAVAAIVVLMIVGLAFAAGFLIGRILL* |
| Ga0066656_107254612 | 3300006034 | Soil | MGKLGERLSVFAVAAIVVLMIVGLAFAAGYIVGKVLL* |
| Ga0066656_110373731 | 3300006034 | Soil | GLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0075365_102483282 | 3300006038 | Populus Endosphere | MRKLFERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL* |
| Ga0066652_1002126202 | 3300006046 | Soil | MTGFGDRLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0066652_1018510191 | 3300006046 | Soil | TMGKLGERLSVFAVAAVVVLTIVGLAFAAGYLLGKLLL* |
| Ga0075024_1006110062 | 3300006047 | Watersheds | MSESGPRLSVFAFAAFALLAFVGLAFAAGYLVGKILL* |
| Ga0070715_102946422 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKLL |
| Ga0070716_1003129062 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRLGERLSVFAVALIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0068871_1001053455 | 3300006358 | Miscanthus Rhizosphere | GNRTMTGLGERLSVFAVALIVIVMVVGLAFGAGYLLGKLLL* |
| Ga0074051_116066192 | 3300006572 | Soil | MGKLGERLSVFAVAAIVVLAIIGLAFAAGYLVGRILL* |
| Ga0101566_108096012 | 3300006618 | Soil | MAKLAERLSVFAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0079222_107474282 | 3300006755 | Agricultural Soil | MGQFGEKLSVFAVAVVVVLMIVGLAFGAGYLVGKLLL* |
| Ga0079222_117551702 | 3300006755 | Agricultural Soil | MGQLGERLSVFAVAVIVVLAIVGLAFGAGYLVGKLLL* |
| Ga0079222_117795862 | 3300006755 | Agricultural Soil | MRKLGEKLSVFAVAAVVVLMIVGLAFGAGYLVGKVLL* |
| Ga0066653_102264742 | 3300006791 | Soil | MSKLGEKLSVFAVAVIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0066659_115204392 | 3300006797 | Soil | MGKLGERLSVFAVAAIVVLTIVGLAFAAGYLVGKILL* |
| Ga0066660_106824512 | 3300006800 | Soil | MTRLGERLSVFAVALIVIMMVVGLAFGAGYLVGKLLL* |
| Ga0079220_106513791 | 3300006806 | Agricultural Soil | LVRGLSGRTMTGFGERLSVFAVALLVIVLVVGLAFGAGYLVGKLLL* |
| Ga0079220_111981982 | 3300006806 | Agricultural Soil | MRPLTERLSVFVFAVVAVLAIVGLAFAAGYLVGQLLL* |
| Ga0079220_120540332 | 3300006806 | Agricultural Soil | MTKLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0075428_1026667212 | 3300006844 | Populus Rhizosphere | MSQLGERASVFAFAAFVVAAVVGLGFLAGYVVGKLLL* |
| Ga0075431_1022435492 | 3300006847 | Populus Rhizosphere | MTKLAERLSVFAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0075433_106246762 | 3300006852 | Populus Rhizosphere | MGQFGEKLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL* |
| Ga0073934_100381594 | 3300006865 | Hot Spring Sediment | MPQPGARLSVYAFAVAALLAFLGIAFGAGYLVGKLLL* |
| Ga0073934_106163052 | 3300006865 | Hot Spring Sediment | MTKLGERLSVFAVAAALLLTIVGLAFAAGYVVGQLLL* |
| Ga0079217_104348953 | 3300006876 | Agricultural Soil | MGRLVETLSVVAFALVVVLAIVGLAFAAGYLVGQLLL* |
| Ga0068865_1016677302 | 3300006881 | Miscanthus Rhizosphere | MSQLGERLSVFAVAMIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0079215_103924132 | 3300006894 | Agricultural Soil | MRRLAETLSVVVFALVAVLAIVGLAFAAGYFVGQLLL* |
| Ga0079215_107064662 | 3300006894 | Agricultural Soil | MTKVADRLSVFAFAAIVVLAIVGLAFAAGYLVGQLLL* |
| Ga0075424_1021163452 | 3300006904 | Populus Rhizosphere | MRKLGEKLSVFGVAALVVLTIVGLAFAAGYLVGKVLL* |
| Ga0079216_112321621 | 3300006918 | Agricultural Soil | MRKLGERLSVFAFAAIVLGTIVGVAFAAGYIVGQLLL* |
| Ga0079219_102958562 | 3300006954 | Agricultural Soil | MRPLAERLSVFVFAVVAVLAIVGLAFAAGYLVGQLLL* |
| Ga0079218_106047252 | 3300007004 | Agricultural Soil | MRRLVETLSVVVFALVAVLAIVGLAFAAGYFVGQLLL* |
| Ga0079218_112491032 | 3300007004 | Agricultural Soil | MPKLAERLSVFAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0066710_1002581492 | 3300009012 | Grasslands Soil | MGKLGERLSVFAVAAIVVLTIIGLAFGVGYIVGKILL |
| Ga0099829_103081384 | 3300009038 | Vadose Zone Soil | MEKPGARLSVFAFAAIIVLAFVGLAFAAGYVVGKLFL* |
| Ga0099827_103153171 | 3300009090 | Vadose Zone Soil | MGQLGERLSVFAFATSVVLAIVALAFAAGYVIGKLLL* |
| Ga0099827_112148962 | 3300009090 | Vadose Zone Soil | ANTMSKLGEKLSVIALAAIVVVTIVGLAFAAGYLVGKVLL* |
| Ga0105245_100321303 | 3300009098 | Miscanthus Rhizosphere | MGKLGERLSVFAVAAVVVLAIVGFAFAAGYLVGKLLL* |
| Ga0066709_1007095412 | 3300009137 | Grasslands Soil | MGKLGERLSVFAVAAIVVLTIIGLAFGVGYIVGKILL* |
| Ga0114129_106570481 | 3300009147 | Populus Rhizosphere | VQKLGERLSVFAFVALVVLAFVALAFAAGYTVGKLLL* |
| Ga0111538_118363591 | 3300009156 | Populus Rhizosphere | RPAATRTMGQFGEKLSVFAVAVVVVLMIVGLAFGAGYLVGKLLL* |
| Ga0075423_102707502 | 3300009162 | Populus Rhizosphere | MTGLSERLSVFAVALIVIVMVVGLAFGAGYLLGKLLL* |
| Ga0075423_112167212 | 3300009162 | Populus Rhizosphere | MRKLGEKLSVFAVAALVVLTIVGLAFAAGYLVGKVLL* |
| Ga0075423_116176132 | 3300009162 | Populus Rhizosphere | MGKFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKLLV* |
| Ga0075423_131738562 | 3300009162 | Populus Rhizosphere | ARTMGKFSERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0105340_11577362 | 3300009610 | Soil | VTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL* |
| Ga0126307_1000034524 | 3300009789 | Serpentine Soil | MEKFGERLSVFAVAVIVVVTIVGLAFGVGYLVGKLLL* |
| Ga0126307_101387642 | 3300009789 | Serpentine Soil | MRRLGEKLSVFAFAAVVLGTIVGLAFAAGYIVGQLLL* |
| Ga0126307_106026672 | 3300009789 | Serpentine Soil | MRKLVERLSVFAFAAFVLGSIVGLAFAAGYIVGQLLL* |
| Ga0126374_117277391 | 3300009792 | Tropical Forest Soil | MGQFGERLSVFAVAVVFVLTIIGLAFGAGYLVGKLL |
| Ga0105062_11024462 | 3300009817 | Groundwater Sand | MEKAAEKLSVFAFAALALLVIVGLAFAAGYVVGQLLL* |
| Ga0105078_10295992 | 3300009823 | Groundwater Sand | VTKLGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL* |
| Ga0126313_100005703 | 3300009840 | Serpentine Soil | MRRLGERLSVFAFAAFVLGTIVGLAFAAGYIVGQLLL* |
| Ga0126313_100187523 | 3300009840 | Serpentine Soil | MQKLAERLSVFAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0126313_100431653 | 3300009840 | Serpentine Soil | MGPLGERLSVFAVAAVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0126313_102691813 | 3300009840 | Serpentine Soil | MRRLGEKLSVFAFAAVVLGAIVGLAFAAGYIVGQLLL* |
| Ga0126313_108355192 | 3300009840 | Serpentine Soil | MGQLGERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0126313_113925922 | 3300009840 | Serpentine Soil | RTMTKVGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL* |
| Ga0126313_114939472 | 3300009840 | Serpentine Soil | MGQLGERLSVFALAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0126304_105316092 | 3300010037 | Serpentine Soil | MRKLGERLSVFAFAAFVLGSIVGLAFAAGYIVGQLLL* |
| Ga0126309_1000040714 | 3300010039 | Serpentine Soil | MRRLGEKLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL* |
| Ga0126309_1000044313 | 3300010039 | Serpentine Soil | MTKLGERLSVFAVAAAVLLAIVGLAFAAGYIIGQLLL* |
| Ga0126309_100286682 | 3300010039 | Serpentine Soil | MPKLAERLTVFAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0126309_100406174 | 3300010039 | Serpentine Soil | MGSFGERLSVFALAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0126309_100534372 | 3300010039 | Serpentine Soil | MGHLGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0126309_100900202 | 3300010039 | Serpentine Soil | MGKFGERLSVFAVAVIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0126309_102536812 | 3300010039 | Serpentine Soil | VTKLGERLSVFAVAAAVLLAIVGLAFAAGYVIGQLLL* |
| Ga0126309_105186352 | 3300010039 | Serpentine Soil | MGPLGERLSVFAVAVIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0126309_105617801 | 3300010039 | Serpentine Soil | MAKLAERLSVFAFAAAVVLTIVGLAFAAGYIVGQLLL* |
| Ga0126309_112361481 | 3300010039 | Serpentine Soil | MGKLGERLSVFAVAGIVVLTIVGLAFAAGYLVGKLLL* |
| Ga0126308_100216753 | 3300010040 | Serpentine Soil | MGKFGERLSVFAVALIVVVTIVGLAFGVGYLVGKLLL* |
| Ga0126312_100019712 | 3300010041 | Serpentine Soil | MPKLAERLSVFAFAAAVVLTIVGLAFAAGYAVGQLLL* |
| Ga0126312_101377802 | 3300010041 | Serpentine Soil | MGKLGERLSVFALAVVVVLTIVGLAFGAGYLVGKLLL* |
| Ga0126312_104386882 | 3300010041 | Serpentine Soil | MRKLVERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL* |
| Ga0126380_101259242 | 3300010043 | Tropical Forest Soil | MTGIGERLSVFAVALLVIVLVVGLAFGAGYLVGKLLL* |
| Ga0126310_100181407 | 3300010044 | Serpentine Soil | LGEKLSVFAFAAVVLGTIVGLAFAAGYIVGQLLL* |
| Ga0126310_102153214 | 3300010044 | Serpentine Soil | MRRLGEKLSVFAFAAFVLGTIVGLAFAAGYIVGQLLL* |
| Ga0126310_108686532 | 3300010044 | Serpentine Soil | MGKFGERLSVFALAVVVVVTIVGLAFGAGYLVGKLLL* |
| Ga0126310_111207902 | 3300010044 | Serpentine Soil | MGQFGERLSVFAVAVVFVLAIVGLAFGPGYLVGKLLL* |
| Ga0127503_111005372 | 3300010154 | Soil | MSKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL* |
| Ga0134082_104488502 | 3300010303 | Grasslands Soil | GKLGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL* |
| Ga0134109_105015072 | 3300010320 | Grasslands Soil | MTGFGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0134086_101315522 | 3300010323 | Grasslands Soil | MTGLGERLSVFAVALIVIVKVVGLAFGAGYLVGKLLL* |
| Ga0134086_104666772 | 3300010323 | Grasslands Soil | LGEMLSLFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0134065_101934161 | 3300010326 | Grasslands Soil | GFGERLSVFAVALLVIVLVVGLAFGAGYLVGKLLL* |
| Ga0134065_102665452 | 3300010326 | Grasslands Soil | MGKLGERLSVFAVAAVVVLTIVGLAFAAGYLVGKVLL* |
| Ga0134111_105295561 | 3300010329 | Grasslands Soil | MGKLGERLSVFAVAAVVVLAIVGLAFAAGYLVGRLLL* |
| Ga0134080_106157192 | 3300010333 | Grasslands Soil | MEKLGERLSVFAVAAIVVFMIIGLAFAAGYIVGKILL* |
| Ga0126370_112466962 | 3300010358 | Tropical Forest Soil | MGQFGERLSVFAVAVVVVLTIVGLAFGVGYLVGKLLL* |
| Ga0126376_128553052 | 3300010359 | Tropical Forest Soil | MGQFGERLSVFAVAVVFVLTIIGLAFGAGYLVGKLLL* |
| Ga0126377_100692163 | 3300010362 | Tropical Forest Soil | MGQLTERLSVFALAVVVVVTIVGLAFAAGYVVGKLLL* |
| Ga0134125_120524461 | 3300010371 | Terrestrial Soil | STVQKLGERLSVFAFVALVVLAFVALAFAAGYTVGKLLL* |
| Ga0134128_105517892 | 3300010373 | Terrestrial Soil | MGKLGEKLSVFAVAAIVVLTIVGLAFAAGYLVGKLLL* |
| Ga0134128_129059332 | 3300010373 | Terrestrial Soil | MGKLGERLSVFAVAAVVVLTIVGLAFAAGYLVGKLLL* |
| Ga0134126_130918131 | 3300010396 | Terrestrial Soil | MRKLGEKLSVFAVAAIVVLTIVGLAFGAGYLVGKVLL* |
| Ga0134126_131015432 | 3300010396 | Terrestrial Soil | MRRRTMSKTGERLSVFAVAGVVVVAIVGLAFAAGYVVGKILL* |
| Ga0134127_129573312 | 3300010399 | Terrestrial Soil | PPTTRTMSQLGERLSVFAVAMIVVLTIVGLAFGAGYLVGKLLL* |
| Ga0138513_1000083613 | 3300011000 | Soil | MGQFGERLSVFALAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0138514_1000039122 | 3300011003 | Soil | MSKLGEKLSVIALAAIVVVTIVGLAFAAGYLVGKVLL* |
| Ga0120153_10803892 | 3300011991 | Permafrost | LVERLTVFAFAALVILAIVGLAFGAGYLIGKMLL* |
| Ga0136623_103093112 | 3300012045 | Polar Desert Sand | MPKLGERLSVFAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0136625_10586553 | 3300012091 | Polar Desert Sand | MQNLAERLSVFAFAAVALLAFVGLAFAAGYMIGKMLL* |
| Ga0136632_100248442 | 3300012093 | Polar Desert Sand | MTQFGERLSVFAFAAFVVAAVVGLAFAAGYMIGKLLL* |
| Ga0136632_105244971 | 3300012093 | Polar Desert Sand | MQNLGERLSVFVFAAVAVLAFVGLAFAVGYMIGKVLL* |
| Ga0136622_104496361 | 3300012187 | Polar Desert Sand | RGRIRTMQNLGERLSVFVFAAVAVLAFVGAAFAVGYMIGKVLL* |
| Ga0137364_106992022 | 3300012198 | Vadose Zone Soil | MSKLGERLSVFAVALIVVLAIVGLAFGAGYLIGKILL* |
| Ga0137382_106783542 | 3300012200 | Vadose Zone Soil | PIGTRTMSKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL* |
| Ga0137382_109818772 | 3300012200 | Vadose Zone Soil | MGKLGEKLSVFAVAALVVLTIVGLAFAAGYLVGKVLL* |
| Ga0137365_106247492 | 3300012201 | Vadose Zone Soil | MGKLGERLSVFAVAVIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0137374_100019386 | 3300012204 | Vadose Zone Soil | MGQLGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL* |
| Ga0137374_100136718 | 3300012204 | Vadose Zone Soil | MRKLGERLSVFAVAAVVVLTIVGLAFAAGYLVGRLLL* |
| Ga0137374_103613013 | 3300012204 | Vadose Zone Soil | MSKLGEKLSVFAVALIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0137376_100445461 | 3300012208 | Vadose Zone Soil | MGQLGERLRVFAVAAIVVLLIVGLAFAAGYIVGKILL* |
| Ga0137376_103860882 | 3300012208 | Vadose Zone Soil | MGKFGERLSVFAVAVIVVVTIVGLAFGVGYLVGKLLL* |
| Ga0137376_107267872 | 3300012208 | Vadose Zone Soil | MGQFGERLSVFALAVVVVLAIVGFAFGAGYLVGKLLL* |
| Ga0137376_111104612 | 3300012208 | Vadose Zone Soil | MGKIGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL* |
| Ga0137378_104581343 | 3300012210 | Vadose Zone Soil | MGKLGERLSVFAVAALVVLTIVGLAFAAGYLVGKSLL* |
| Ga0137378_111927252 | 3300012210 | Vadose Zone Soil | MTKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLL |
| Ga0150985_1152394301 | 3300012212 | Avena Fatua Rhizosphere | PTPARTMGHLGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0150985_1210656071 | 3300012212 | Avena Fatua Rhizosphere | MGKTGERLSVFAVAVVVVVAIVGLAFAAGYVVGKILL* |
| Ga0137370_100420643 | 3300012285 | Vadose Zone Soil | MTGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLVL* |
| Ga0137366_102532162 | 3300012354 | Vadose Zone Soil | MGQLGERLSVFAVAVVVVVTIVGLAFAAGYLVGRLLL* |
| Ga0137371_102030904 | 3300012356 | Vadose Zone Soil | MGKLGERLSVFAVAAIVVLTIIGLAFGAGYIVGKILL* |
| Ga0137371_105706312 | 3300012356 | Vadose Zone Soil | MGQLGERLSVFAVAVVVVVTIVGLAFAAGYLVGKLLL* |
| Ga0137390_102218702 | 3300012363 | Vadose Zone Soil | MKKPGARLSVFAFAAIIVLAFVGLAFAAGYVVGKLFL* |
| Ga0134035_12429362 | 3300012391 | Grasslands Soil | MTGLGERLSVFAVAAIVVLMIVGLAFAAGYIVGKILL* |
| Ga0134050_12527592 | 3300012407 | Grasslands Soil | MRQSTPRLSVFAFATFALLAFVGLAFAAGYIIGKVLL* |
| Ga0150984_1023450972 | 3300012469 | Avena Fatua Rhizosphere | LRPPEPNTMGKLGERLSVFAVAAVVVLAIVGFAFAAGYLLGKLLL* |
| Ga0150984_1086076222 | 3300012469 | Avena Fatua Rhizosphere | PLVERLSVFVFAAVVILAIVGIAFAAGYLVGQLLL* |
| Ga0150984_1152991672 | 3300012469 | Avena Fatua Rhizosphere | MTRLGERLSVFAVALIVVVAIVGVAFGAGYLVGKLLL* |
| Ga0150984_1166920582 | 3300012469 | Avena Fatua Rhizosphere | LRPPEPNTMGKLGERLSVFAFAAVVVLAIVGFAFAAGYLVGKLLL* |
| Ga0150984_1171838152 | 3300012469 | Avena Fatua Rhizosphere | MRPLVERLSVFFFAAVVILAIVGIAFAAGYLVGQLLL* |
| Ga0136635_100010389 | 3300012530 | Polar Desert Sand | MTKPLERLSVFAVAAAVLLTIVGLAFAVGYVVGQLLL* |
| Ga0157294_102174431 | 3300012892 | Soil | MGQFGERLSVFAVAVIVVLAIVGLAFGAGYLVGKLLL* |
| Ga0157292_100988292 | 3300012900 | Soil | MGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKFLL* |
| Ga0157288_100659742 | 3300012901 | Soil | MGKLGERLSVFAVAALVVLTIVGLAFAAGYLVGKLLL* |
| Ga0157291_103343081 | 3300012902 | Soil | PTTARTMGQFGERLSVFAVAVIVVLAIVGLAFGAGYLVGKLLL* |
| Ga0157297_104457032 | 3300012914 | Soil | MGRFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0162653_1000379722 | 3300012937 | Soil | MSQLGERLSVFAVAMIVVLAIVGLAFGAGYLVGKLLL* |
| Ga0162650_1000728462 | 3300012939 | Soil | MPKLAERLSVFAFAAAVLLAIVGLAFAAGYVVGQLLL* |
| Ga0126375_120749602 | 3300012948 | Tropical Forest Soil | MGKLGEKLSVFAVAAVVVLAIVGLAFAAGYLVGRLLL* |
| Ga0164301_105030881 | 3300012960 | Soil | LGERLSVFAVALIVVVAIVGLAFGAGYLVGKLLL* |
| Ga0164302_108359172 | 3300012961 | Soil | MTGFGERLSVFAVALIVIVMVVGLAFGVGYLVGKLLL* |
| Ga0164309_112618391 | 3300012984 | Soil | FGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL* |
| Ga0164309_112907802 | 3300012984 | Soil | MGQFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKLLL* |
| Ga0164308_111340391 | 3300012985 | Soil | MGKTGERLSVFAVAVVVVVAIVGLAFGAGYVVGKILL* |
| Ga0164304_106154021 | 3300012986 | Soil | KFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL* |
| Ga0164304_117123762 | 3300012986 | Soil | MGKLGERLSVFAVALIVIVMIVGLAFGAGYLVGKLLL* |
| Ga0164307_108558382 | 3300012987 | Soil | MRPLAERLSVFVFAVLAVLAIVGLAFAAGYLVGQLLL* |
| Ga0170681_11241372 | 3300013026 | Rock | MGERLSVFALAAAVVAGVVGGAFAVGYLVGKVLL* |
| Ga0157369_103413534 | 3300013105 | Corn Rhizosphere | PAGNRTLTGFGERLSVFAVALIVIVMVVGLTFAAGYLVGKLLL* |
| Ga0120188_10626241 | 3300013760 | Terrestrial | MTKLAERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL* |
| Ga0120123_10058272 | 3300013770 | Permafrost | MTRLGERLSVFAVALIVVVMVVGLAFGAGYLVGKLLL* |
| Ga0134079_100122922 | 3300014166 | Grasslands Soil | MGKLGERLSVFAVAAIVVFTIIGLAFAAGYIFGKILL* |
| Ga0182000_104206392 | 3300014487 | Soil | MGQLGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL* |
| Ga0182001_100413772 | 3300014488 | Soil | MTRLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL* |
| Ga0182001_102520372 | 3300014488 | Soil | MTRLGERLSVFAVALIVIVTVVGLAFGAGYLVGKLLL* |
| Ga0182001_103288312 | 3300014488 | Soil | MPKLAERLSVLAFAAAVVLTIVGLAFAAGYVVGQLLL* |
| Ga0182008_103081352 | 3300014497 | Rhizosphere | MGKFGEKLSVFAVAAVVVLMIVGLAFGAGYLVGKVLL* |
| Ga0157377_107227412 | 3300014745 | Miscanthus Rhizosphere | VQNLGDRLSVFAFAVGVILAFVGLAFAAGYMIGKLLL* |
| Ga0180104_12007132 | 3300014884 | Soil | MTKLGERLSVFAVAAAVLLTIVGLAFAAGYVVGKLLL* |
| Ga0173480_107726852 | 3300015200 | Soil | MGQFGEKLSVFAVAVVIVLMIVGLAFGAGYLVGKLLL* |
| Ga0180070_10571252 | 3300015251 | Soil | TGGRLSVFAFAAFMVLAIVGSAFALGYIVGKLLL* |
| Ga0182006_13024402 | 3300015261 | Rhizosphere | MGKLGEKLSVFAVAAIVVLTIVGLAFAAGYLVGKVLL* |
| Ga0132258_130046333 | 3300015371 | Arabidopsis Rhizosphere | MGKTRERLSVFALAAVVLVAFVGLAFAAGYIVGKILL* |
| Ga0132256_1005744794 | 3300015372 | Arabidopsis Rhizosphere | FGERLSVFAVAVVVVLAIVGLAFGVGYLVGKLLL* |
| Ga0180121_1000032214 | 3300017695 | Polar Desert Sand | MTKPLERLSVFAVAAAVLLTIVGLAFAVGYVVGQLLL |
| Ga0180121_100254443 | 3300017695 | Polar Desert Sand | MRWAKKRRMTQFGERLSVFAFAAFVVAAVVGLAFAAGYMIGKLLL |
| Ga0180121_103105882 | 3300017695 | Polar Desert Sand | MQNLAERLSVFAFAAVALLAFVGLAFAAGYMIGKMLL |
| Ga0183260_100325623 | 3300017787 | Polar Desert Sand | MRRAKKRRMTQFGERLSVFAFAAFVVAAVVGLAFAAGYMIGKLLL |
| Ga0163161_100365804 | 3300017792 | Switchgrass Rhizosphere | MSRLGERLSVFAVAMIVVVTIVGLAFGAGYLVGKLLL |
| Ga0187775_100083764 | 3300017939 | Tropical Peatland | MEKLGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL |
| Ga0187785_107861222 | 3300017947 | Tropical Peatland | MRPLAERLSVFVFAVVAVLAIVGIAFAAGYLVGQLLL |
| Ga0190266_100488682 | 3300017965 | Soil | MTGFGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0184610_11767152 | 3300017997 | Groundwater Sediment | MTKLGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL |
| Ga0184605_100172773 | 3300018027 | Groundwater Sediment | MGKFGERLSVFAVAVIVVVTIVGLAFGVGYLVGKLLL |
| Ga0184605_100573994 | 3300018027 | Groundwater Sediment | MRRLGERLSVFAVALIVVAMVVGLAFGAGYLVGKLLL |
| Ga0184605_101346802 | 3300018027 | Groundwater Sediment | MSKLGERLSVFAVALIVVLAVIGLAFGAGYLIGKILL |
| Ga0184605_101575182 | 3300018027 | Groundwater Sediment | MTGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0184605_105257262 | 3300018027 | Groundwater Sediment | MGQLGERLSVFAVAAIVVLMIVGLAFAAGYIVGRLLL |
| Ga0184608_102270152 | 3300018028 | Groundwater Sediment | MTKVAERLSVFAFAAAVVLAIIGLAFAVGYLVGQLLL |
| Ga0184634_102590942 | 3300018031 | Groundwater Sediment | MSQLGERLSVFAVAMIVVLTIVGLAFGAGYLVGKLLL |
| Ga0184634_102875702 | 3300018031 | Groundwater Sediment | VTKVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
| Ga0184638_11003032 | 3300018052 | Groundwater Sediment | MRKLGERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL |
| Ga0184623_102676162 | 3300018056 | Groundwater Sediment | MGRLVETLSVVAFALVVVLAIIGLAFAAGYLVGQLLL |
| Ga0184619_1000128011 | 3300018061 | Groundwater Sediment | MGQFGERLSVFALAVVVVLAIVGFAFGAGYLVGKLLL |
| Ga0184619_100052922 | 3300018061 | Groundwater Sediment | MGKLAEKLSVFAVAAIVVVTIVGLAFAAGYLVGKVLL |
| Ga0184619_100913642 | 3300018061 | Groundwater Sediment | MTRLGERLSVFAVALIVVVMVVGLAFGAGYLVGKLLL |
| Ga0184619_101751452 | 3300018061 | Groundwater Sediment | MGKLGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL |
| Ga0184619_102122812 | 3300018061 | Groundwater Sediment | MQLGERLSVFAVAAVVVLMIVGLAFAAGYLVGKLLL |
| Ga0184618_100066974 | 3300018071 | Groundwater Sediment | MGQFGERLSVFAVAVIVVLTIVGLAFGVGYLVGKLLL |
| Ga0184618_100756173 | 3300018071 | Groundwater Sediment | MRKLGERLSVFAVAAVVVLTIVGLAFAAGYLVGRLLL |
| Ga0184635_100051612 | 3300018072 | Groundwater Sediment | MTKLGERLSVFAFVAAVVLTIVGLAFAAGYVVGQLLL |
| Ga0184635_100118732 | 3300018072 | Groundwater Sediment | MSQLGERLSVFAVAMIVVLAIVGLAFGAGYLVGKLLL |
| Ga0184624_100346744 | 3300018073 | Groundwater Sediment | MGQFGERLSVFAVAVIVVLAIVGLAFGAGYLVGKLLL |
| Ga0184612_100486873 | 3300018078 | Groundwater Sediment | MRKLGERLSVFAFAAFVLGTIVGLAFAAGYIVGQLLL |
| Ga0066655_104707202 | 3300018431 | Grasslands Soil | MGKLGERLSVFVVAALVVLTIVGLAFAAGYLVGKVLL |
| Ga0066655_109623361 | 3300018431 | Grasslands Soil | ARTMGQFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0066667_102306113 | 3300018433 | Grasslands Soil | MTRLGERLSVFAVALIVVVTVVGLAFGVGYLVGKLLL |
| Ga0066667_102796902 | 3300018433 | Grasslands Soil | MGKLGERLSVFAVAAVVVLTIVGLAFAAGYLLGKLLL |
| Ga0066667_112760222 | 3300018433 | Grasslands Soil | MGKLGERLSVFAVAAIVVLMIVGLAFAAGYIVGKVLL |
| Ga0066667_112904062 | 3300018433 | Grasslands Soil | MGKLGERLSVFAVAAIVVFTIIGLAFAAGYIVGKILL |
| Ga0190270_102272743 | 3300018469 | Soil | MPKLAERLSVFAFAAAVVLTIVGLAFAAGYVVGQLLL |
| Ga0190270_107004863 | 3300018469 | Soil | MTKVGERLSVFAVAAAVLLTIVGLAFAVGYVVGQLLL |
| Ga0190270_117241852 | 3300018469 | Soil | VTKVTDRLSVFVFAAVVVLAIVGLAFAAGYLVGQLLL |
| Ga0066669_100621392 | 3300018482 | Grasslands Soil | MTGFGERLSVFAVALIVIVLVVGLAFGAGYLVGKLLL |
| Ga0066669_117958371 | 3300018482 | Grasslands Soil | TMGKLGERLSVFAVAAVVVLTIVGLAFAAGYLLGKLLL |
| Ga0173481_100180613 | 3300019356 | Soil | MGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKFLL |
| Ga0173481_101501893 | 3300019356 | Soil | MTGLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL |
| Ga0173482_100904722 | 3300019361 | Soil | MGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKLLL |
| Ga0173482_104374562 | 3300019361 | Soil | MTKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL |
| Ga0190264_107837492 | 3300019377 | Soil | MTKAADRLSVFAFAAVALLAIVGLAFAAGYLVGQLLL |
| Ga0190267_102271063 | 3300019767 | Soil | MGQLGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0193704_10004507 | 3300019867 | Soil | MGQFGERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL |
| Ga0193705_10042423 | 3300019869 | Soil | MGQFGERLSVFVVAVIVVLTIVGLAFGAGYLVGKLLL |
| Ga0193722_11483321 | 3300019877 | Soil | KFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL |
| Ga0193715_10697732 | 3300019878 | Soil | MSKLGEKLSVIALAAIVVVTIVGLAFAAGYLVGKVLL |
| Ga0193725_10117923 | 3300019883 | Soil | MGKFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL |
| Ga0193741_10142192 | 3300019884 | Soil | MTKVGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL |
| Ga0193747_10534072 | 3300019885 | Soil | MSKLGERLSVFAVAAVVVLTIVGLAFAAGYLVGKLLL |
| Ga0193729_10056624 | 3300019887 | Soil | MTKLGERLSVFAVASIVIVAVVGLAFGAGYLVGKLLL |
| Ga0193728_11158392 | 3300019890 | Soil | MGKLGEKLSVCAVAAIVVLTIVGLAFAAGYLVGKVLL |
| Ga0193730_11609821 | 3300020002 | Soil | RPTSARTMGQFGERLSVFVVAVIVVLTIVGLAFGAGYLVGKLLL |
| Ga0196964_103259312 | 3300020202 | Soil | MTFIGDRLSVFAFAAFVLLAIVGLAFAAGYLLGKLLV |
| Ga0196964_105354562 | 3300020202 | Soil | MPKLAERLSVFAVAAAVVLAVVGLAFAVGYVVGHLLFQV |
| Ga0210378_100260976 | 3300021073 | Groundwater Sediment | TKVADRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
| Ga0193694_10555361 | 3300021415 | Soil | MTRLGERLSVFAVALIVLVTIVGLAFGAGYLVGKLLL |
| Ga0182009_100015353 | 3300021445 | Soil | MTGFGERLSVFAVALLVIVLVVGLAFGAGYLVGKLLL |
| Ga0182009_100788703 | 3300021445 | Soil | MGQLGERLSVFAVAVVVFLAIVGLAFGAGYLVGKLLL |
| Ga0182009_101404202 | 3300021445 | Soil | MKFRERLSVFAVALIVLVMVVGLAFGAGYLVGKLLL |
| Ga0182009_103959552 | 3300021445 | Soil | MGKLGERLSVFAVAAVVVLAIVGLAFAAGYLLGKLLL |
| Ga0182009_104580242 | 3300021445 | Soil | MTRLGERLSVFAVALIVIVMVVGVAFGAGYLVGKLLL |
| Ga0222625_11247821 | 3300022195 | Groundwater Sediment | GTRDTMTKLGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL |
| Ga0222622_100552154 | 3300022756 | Groundwater Sediment | MTRLGERLSVFAVALIVVVTIVGLAFGAGYLVGKLLL |
| Ga0247799_10098901 | 3300023072 | Soil | PTPARTMGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKFLL |
| Ga0247693_10579062 | 3300024181 | Soil | HRPTPARTMGQLGERLSVFAVAVIVVLAIVGLAFGAGYLVGKLLL |
| Ga0179589_105597912 | 3300024288 | Vadose Zone Soil | MTKLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0209172_100241713 | 3300025310 | Hot Spring Sediment | MPQPGARLSVYAFAVAALLAFLGIAFGAGYLVGKLLL |
| Ga0209431_105907702 | 3300025313 | Soil | VARLGERLSVFAFAAFVLAAIVGSAFALGYIVGKLLL |
| Ga0209342_105097032 | 3300025326 | Soil | MAKLGERIAVLAFAAGLVGAIVGLAFAAGYAIGKLLL |
| Ga0210142_10014384 | 3300025552 | Natural And Restored Wetlands | MGKLGEKLSVFAVAGLVVLTIVGLAFAAGYLLGKLLL |
| Ga0207653_100062433 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGLGERLSVFAVALIVIVMVVGLAFGAGYLLGKLLL |
| Ga0207688_100140633 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGFGERLSVFAVALIVIVMVVGLAFAAGYLVGKLLL |
| Ga0207685_100397261 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL |
| Ga0207684_101272722 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKLGEKLSVFAVAAIVVLTIVGLAFGAGYLVGKVLL |
| Ga0207684_102768562 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKLGEKLSVFAVAAIVVLMIVGIAFAAGYLVGKVLL |
| Ga0207695_106231493 | 3300025913 | Corn Rhizosphere | MSKLGERLSVFAVAMIVVVTIVGLAFGAGYLVGKLLL |
| Ga0207671_113551312 | 3300025914 | Corn Rhizosphere | MGKFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLI |
| Ga0207693_101113293 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKL |
| Ga0207693_110517011 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFGERLSVFAVAVVVVLAIVGLAFGVGYLVGKL |
| Ga0207646_102525463 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELGEKLSVFAVALFVIVMVVGLAFGAGYLVGKLLL |
| Ga0207701_102314234 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PLRSAGNRTMTGFGERLSVFAVALIVIVMIVGLAFGAGYLVGKLLL |
| Ga0207690_100906393 | 3300025932 | Corn Rhizosphere | MGKLGERLSVFAVAAVVVLAIVGFAFAAGYLLGKLLL |
| Ga0207689_102022703 | 3300025942 | Miscanthus Rhizosphere | MTGLGERLSVFAVALIVIVTVVGLAFGAGYLVGKLLL |
| Ga0207661_102191523 | 3300025944 | Corn Rhizosphere | MGKFGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0207702_119982632 | 3300026078 | Corn Rhizosphere | MGKLGERLSVFAVAAVVVLAIVGLAFAAGYLVGKLLL |
| Ga0207675_1019268742 | 3300026118 | Switchgrass Rhizosphere | RRARTMRPLVERLSVFVFAAVVILAIVGIAFAAGYLVGQLLL |
| Ga0209234_10084132 | 3300026295 | Grasslands Soil | MGKLGERLSVFAVAAIVVFMIIGLAFAAGYIVGKILL |
| Ga0209027_11413802 | 3300026300 | Grasslands Soil | MTRLGERLSVFAVAALVVLTIVGLAFAAGYLVGKVLL |
| Ga0209468_10387954 | 3300026306 | Soil | MGKLGERLSVFAVAAIVVLTIIGFAFAAGYIVGKILL |
| Ga0209057_10927672 | 3300026342 | Soil | MGKLGERLSVFAVAALVVLTIVGLAFAAGYLVGKVLL |
| Ga0209159_11921911 | 3300026343 | Soil | NRTMTGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0209805_10367193 | 3300026542 | Soil | MSKLGERLSVFAVAVVVVLTIVGLAFAAGYLVGKLLL |
| Ga0209474_100835192 | 3300026550 | Soil | MTGFGERLSLFAVALLVIVLVVGLAFGAGYLVGKLLL |
| Ga0209474_102847622 | 3300026550 | Soil | MTGFGERLSVFAVALVVIVLVVGLAFGAGYLVGKLLL |
| Ga0209577_104140751 | 3300026552 | Soil | MSKLGEKLSVFAVAAIVVLAVVGLAFGAGYLVGKLLL |
| Ga0207503_10129802 | 3300026861 | Soil | SHRPTPARTMGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKLLL |
| Ga0209842_10739742 | 3300027379 | Groundwater Sand | MEKAAEKLSVFAFAALALLVIVGLAFAAGYVVGQLLL |
| Ga0208637_10115172 | 3300027401 | Soil | MGKLGERLSVFAVAAIVVLAIIGLAFAAGYLVGRILL |
| Ga0209874_10903862 | 3300027577 | Groundwater Sand | MPKLGERLSVFAVAAAVLLTIVGLAFAAGYVVGQLLL |
| Ga0209485_12140662 | 3300027691 | Agricultural Soil | MRRLAETLSVVVFALVAVLAIVGLAFAAGYFVGQLLL |
| Ga0209178_11321672 | 3300027725 | Agricultural Soil | MGKFSERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL |
| Ga0209177_102459382 | 3300027775 | Agricultural Soil | MRKLGEKLSVFAVAAVVVLMIVGLAFGAGYLVGKVLL |
| Ga0209177_102491371 | 3300027775 | Agricultural Soil | MPSRRPRTMRPLAERLSVFVFAVVAVLAIVGLAFAAGYLVGQLLL |
| Ga0209514_100187034 | 3300027819 | Groundwater | MAKVGERLSVFAFAAIVLAAIVGSAFAIGYIVGKLLL |
| Ga0209811_100056881 | 3300027821 | Surface Soil | MGQFRERLSVFAVAVIVVLTIVGLAFGAGYLVGKLLL |
| Ga0207428_103413352 | 3300027907 | Populus Rhizosphere | MRKLFERLSVFAFAAFVLGAIVGLAFAAGYIVGQLLL |
| Ga0209069_103125342 | 3300027915 | Watersheds | MSESGPRLSVFAFAAFALLAFVGLAFAAGYLVGKILL |
| Ga0209069_109270781 | 3300027915 | Watersheds | ANTMGKLGERLSVFAVAAIVVLAIIGLAFAAGYLVGRILL |
| Ga0247713_10301742 | 3300028104 | Soil | MAKLGERLSVLAFAAFAVAAIAGLAFAAGYLIGKLLL |
| Ga0268266_122095712 | 3300028379 | Switchgrass Rhizosphere | MRPLVERLSVFVFAAVVILAIVGIAFAAGYLVGQLLL |
| Ga0247822_117929501 | 3300028592 | Soil | RTMGQFGERLSVFAVAVVFVLAIIGLAFGAGYLVGKLLL |
| Ga0307276_100848111 | 3300028705 | Soil | TGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0307276_102112541 | 3300028705 | Soil | PLRPIGNRTMTGLGERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0307293_100523492 | 3300028711 | Soil | MGKLGEKLSVFAVAAIVVLTIVGLAFAAGYLVGKVLL |
| Ga0307293_101573222 | 3300028711 | Soil | MTRLGERLSVFAVALIVLVAIVGLAFGAGYLVGKLLL |
| Ga0307293_101900562 | 3300028711 | Soil | HRPTPARTMGQFGERLSVFALAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0307309_100011093 | 3300028714 | Soil | MGQFRERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL |
| Ga0307311_100469121 | 3300028716 | Soil | MGKFGERLSVFAVAVIVVVAIVGLAFGVGYLVGKLLL |
| Ga0307311_101528522 | 3300028716 | Soil | TMGKFGERLSVFAVAVIVVVAIVGLAFGVGYLVGKLLL |
| Ga0307311_101593791 | 3300028716 | Soil | MGQFGERLSVFVVAVIVVLTIVGLAFGACYLVGKLLL |
| Ga0307307_102162622 | 3300028718 | Soil | MTGLVERLSVFAVALIVIVTVVGLAFGAGYLVGKLLL |
| Ga0307301_102519571 | 3300028719 | Soil | KVTDRLSVFAFAAVVVLAIVGLAFAAGYLVGQLLL |
| Ga0307319_100119023 | 3300028722 | Soil | MGQFGERLSVFALAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0307319_100897121 | 3300028722 | Soil | QFGERLSVFVVAVIVVLTIVGLAFGAGYLVGKLLL |
| Ga0307288_100947002 | 3300028778 | Soil | MGQFGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL |
| Ga0307282_102819223 | 3300028784 | Soil | LRPPTTRTMSQLGERLSVFAVAMIVVLTIVGLAFGAGYLVGKLLL |
| Ga0307302_100603673 | 3300028814 | Soil | MGKLGEGLSVFAVAAIVVLMIVGLAFAAGYIVGKVLL |
| Ga0307296_100042325 | 3300028819 | Soil | MGKLGERLSVFAVAVVVVLTIVGLAFGAGYLVGKLLL |
| Ga0307314_100836583 | 3300028872 | Soil | PPEPHTMGKLGERLSVFAVAAVVVLAIVGFAFAAGYLVGKLLL |
| Ga0307277_100018468 | 3300028881 | Soil | MTGLGERLSVFAVALIVIMTVVGLAFGAGYLVGKLLL |
| Ga0307277_100430421 | 3300028881 | Soil | TMSKLGEKLSVFAVAVIVVVAIVGLAFGAGYLVGKLLL |
| Ga0307277_103732871 | 3300028881 | Soil | MSKLGEKLSVFAVAVIVVVAIVGLAFGAGYLVGKLLL |
| Ga0307277_105603801 | 3300028881 | Soil | TMGQFGERLSVFALAVVVVLAIVGFAFGAGYLVGKLLL |
| Ga0268241_100110354 | 3300030511 | Soil | MGTLGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0170824_1253941442 | 3300031231 | Forest Soil | MNKLGERLSVFAVALIVIVAVVGLAFGAGYLVGKLLL |
| Ga0308194_101985241 | 3300031421 | Soil | TRTMGKFGERLSVFAVAVIVVVTIVGLAFGVGYLVGKLLL |
| Ga0307408_1005064052 | 3300031548 | Rhizosphere | MTKVGERLSVFALATFVVLGIVALSYAAGYLIGKLLL |
| Ga0307408_1013422132 | 3300031548 | Rhizosphere | MGQLGERLSVFAVALVVVLAIVGLAFGAGYLVGKLLL |
| Ga0310813_105986352 | 3300031716 | Soil | MRKLGEKLSVFGVAALVVLTIVGLAFAAGYLVGKVLL |
| Ga0307468_1006343082 | 3300031740 | Hardwood Forest Soil | MTRLGERLCVFAVALIVVVTIVGLAFGAGYLVGKLLL |
| Ga0307468_1019768052 | 3300031740 | Hardwood Forest Soil | MRKLGEKLSVFAVAALVVLTIVGLAFAAGYLVGKVLL |
| Ga0308175_1000525073 | 3300031938 | Soil | MGKLGERLSVFAVAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0308175_1002232111 | 3300031938 | Soil | MSQLGERLSVFAVATIVVLAIVGLAFGAGYLVGKLLL |
| Ga0308175_1002805232 | 3300031938 | Soil | MSGLAERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| Ga0308175_1021495292 | 3300031938 | Soil | MGQFGERLSVFAVAVVFVLAIVGLAFGAGYLVGKLLL |
| Ga0307409_1019676781 | 3300031995 | Rhizosphere | MRKLGERLSVFAFAAVVLGTIVGLAFAAGYIVGQLLL |
| Ga0307416_1017307742 | 3300032002 | Rhizosphere | MRRLGEKLSVFAFAAFVLGTIVGLAFAAGYIVGQLLL |
| Ga0318563_103254182 | 3300032009 | Soil | MEHFGERLSVFAFAAVVVLTIVGIAFGAGYLIGKLFL |
| Ga0307415_1002101662 | 3300032126 | Rhizosphere | MGQLGERLSVLAVAVVVVLAIVGLAFGAGYLVGKLLL |
| Ga0315281_1000211112 | 3300032163 | Sediment | MAKLGERLSVFAFAAIVLAAIVGTAFALGYIVGKLIL |
| Ga0307471_1022591512 | 3300032180 | Hardwood Forest Soil | MTKLGEKLSVFAVAALVVLTIVGLAFAAGYLVGKVLL |
| Ga0307472_1008898182 | 3300032205 | Hardwood Forest Soil | MPKLAERLSVFAFAAAVVLAIIGLAFAAGYVVGQLLL |
| Ga0335085_120310591 | 3300032770 | Soil | PQRPTLARTMEKLGERLSVFAVAAIVVLMIVGLAFAAGFLVGRILL |
| Ga0334961_026680_73_192 | 3300034143 | Sub-Biocrust Soil | MPKLAERLSVFAVAAAVVLTVVGLAFAVGYVVGHLLFQV |
| Ga0334913_034531_41_154 | 3300034172 | Sub-Biocrust Soil | MGQLGERLSVFALALVVVLAIVGLAFGAGYLVGKLLL |
| Ga0364931_0318364_269_382 | 3300034176 | Sediment | MRKLGERLSVFAFAAVVLGAIVGLAFAAGYIVGQLLL |
| Ga0372943_0332596_821_934 | 3300034268 | Soil | MTRLVERLSVFAVALIVIVMVVGLAFGAGYLVGKLLL |
| ⦗Top⦘ |