Basic Information | |
---|---|
Family ID | F004964 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 417 |
Average Sequence Length | 44 residues |
Representative Sequence | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSDSKEKE |
Number of Associated Samples | 222 |
Number of Associated Scaffolds | 417 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 78.74 % |
% of genes near scaffold ends (potentially truncated) | 17.27 % |
% of genes from short scaffolds (< 2000 bps) | 65.71 % |
Associated GOLD sequencing projects | 199 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.974 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (11.511 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.022 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.717 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 417 Family Scaffolds |
---|---|---|
PF05988 | DUF899 | 43.88 |
PF08327 | AHSA1 | 24.46 |
PF05163 | DinB | 5.28 |
PF01022 | HTH_5 | 4.32 |
PF12840 | HTH_20 | 3.36 |
PF09723 | Zn-ribbon_8 | 1.68 |
PF12706 | Lactamase_B_2 | 1.44 |
PF05096 | Glu_cyclase_2 | 1.20 |
PF13505 | OMP_b-brl | 0.72 |
PF12697 | Abhydrolase_6 | 0.48 |
PF00561 | Abhydrolase_1 | 0.48 |
PF12867 | DinB_2 | 0.48 |
PF07690 | MFS_1 | 0.48 |
PF00990 | GGDEF | 0.48 |
PF03070 | TENA_THI-4 | 0.48 |
PF06271 | RDD | 0.48 |
PF06224 | HTH_42 | 0.48 |
PF14279 | HNH_5 | 0.24 |
PF03447 | NAD_binding_3 | 0.24 |
PF00144 | Beta-lactamase | 0.24 |
PF01933 | CofD | 0.24 |
PF01011 | PQQ | 0.24 |
PF03721 | UDPG_MGDP_dh_N | 0.24 |
PF00313 | CSD | 0.24 |
PF16640 | Big_3_5 | 0.24 |
PF13563 | 2_5_RNA_ligase2 | 0.24 |
PF13304 | AAA_21 | 0.24 |
PF07676 | PD40 | 0.24 |
PF12704 | MacB_PCD | 0.24 |
PF06386 | GvpL_GvpF | 0.24 |
PF00483 | NTP_transferase | 0.24 |
PF03720 | UDPG_MGDP_dh_C | 0.24 |
PF02873 | MurB_C | 0.24 |
PF14310 | Fn3-like | 0.24 |
PF00155 | Aminotran_1_2 | 0.24 |
PF13727 | CoA_binding_3 | 0.24 |
PF13561 | adh_short_C2 | 0.24 |
PF00873 | ACR_tran | 0.24 |
PF13432 | TPR_16 | 0.24 |
PF00847 | AP2 | 0.24 |
PF03551 | PadR | 0.24 |
PF13345 | Obsolete Pfam Family | 0.24 |
PF08281 | Sigma70_r4_2 | 0.24 |
PF13620 | CarboxypepD_reg | 0.24 |
PF00903 | Glyoxalase | 0.24 |
PF12732 | YtxH | 0.24 |
PF13589 | HATPase_c_3 | 0.24 |
PF13186 | SPASM | 0.24 |
PF10978 | DUF2785 | 0.24 |
PF12796 | Ank_2 | 0.24 |
PF16363 | GDP_Man_Dehyd | 0.24 |
COG ID | Name | Functional Category | % Frequency in 417 Family Scaffolds |
---|---|---|---|
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 43.88 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 5.28 |
COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.20 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.48 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.48 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.24 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.24 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.24 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.24 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.24 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.24 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.24 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.24 |
COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
COG0391 | Archaeal 2-phospho-L-lactate transferase/Bacterial gluconeogenesis factor, CofD/UPF0052 family | Carbohydrate transport and metabolism [G] | 0.24 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.45 % |
Unclassified | root | N/A | 16.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035918004|FACENC_F56XM5W01DSYA2 | Not Available | 533 | Open in IMG/M |
2162886011|MRS1b_contig_2837798 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
2199352024|deeps_contig64284.39326 | Not Available | 734 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101119833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101280429 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300000567|JGI12270J11330_10168162 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 793 | Open in IMG/M |
3300000579|AP72_2010_repI_A01DRAFT_1002029 | All Organisms → cellular organisms → Bacteria | 4091 | Open in IMG/M |
3300000955|JGI1027J12803_100383277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1202 | Open in IMG/M |
3300000955|JGI1027J12803_100398709 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
3300000955|JGI1027J12803_101184804 | Not Available | 864 | Open in IMG/M |
3300001661|JGI12053J15887_10007628 | All Organisms → cellular organisms → Bacteria | 5820 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100005035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10035 | Open in IMG/M |
3300002568|C688J35102_120004081 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300002568|C688J35102_120542999 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
3300002568|C688J35102_120989081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 10045 | Open in IMG/M |
3300002917|JGI25616J43925_10072119 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300004091|Ga0062387_101445648 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300004152|Ga0062386_100218903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1501 | Open in IMG/M |
3300004152|Ga0062386_101870057 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300004479|Ga0062595_101723691 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300004633|Ga0066395_10075355 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
3300004633|Ga0066395_10340291 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300005167|Ga0066672_10071184 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
3300005172|Ga0066683_10744072 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005176|Ga0066679_10155389 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
3300005329|Ga0070683_100420785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1274 | Open in IMG/M |
3300005332|Ga0066388_100307875 | All Organisms → cellular organisms → Bacteria | 2230 | Open in IMG/M |
3300005332|Ga0066388_101472367 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300005332|Ga0066388_105882619 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300005353|Ga0070669_100224190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1487 | Open in IMG/M |
3300005366|Ga0070659_100041870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3581 | Open in IMG/M |
3300005434|Ga0070709_10027447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3385 | Open in IMG/M |
3300005434|Ga0070709_11648671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
3300005435|Ga0070714_100556005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1099 | Open in IMG/M |
3300005435|Ga0070714_100961623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300005435|Ga0070714_101666910 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005436|Ga0070713_100087680 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
3300005436|Ga0070713_100791596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
3300005436|Ga0070713_101027046 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300005439|Ga0070711_100929721 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005445|Ga0070708_100702233 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300005529|Ga0070741_10188621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2020 | Open in IMG/M |
3300005529|Ga0070741_10828470 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005531|Ga0070738_10000432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 121053 | Open in IMG/M |
3300005533|Ga0070734_10000497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 80555 | Open in IMG/M |
3300005533|Ga0070734_10036410 | All Organisms → cellular organisms → Bacteria | 3073 | Open in IMG/M |
3300005533|Ga0070734_10106884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1640 | Open in IMG/M |
3300005533|Ga0070734_10120427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1533 | Open in IMG/M |
3300005533|Ga0070734_10747366 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300005534|Ga0070735_10000646 | All Organisms → cellular organisms → Bacteria | 36383 | Open in IMG/M |
3300005534|Ga0070735_10001248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25100 | Open in IMG/M |
3300005534|Ga0070735_10048138 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
3300005537|Ga0070730_10000284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 64337 | Open in IMG/M |
3300005537|Ga0070730_10000341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 57129 | Open in IMG/M |
3300005538|Ga0070731_10000074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 202490 | Open in IMG/M |
3300005538|Ga0070731_10015233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5461 | Open in IMG/M |
3300005538|Ga0070731_10464719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
3300005541|Ga0070733_10067730 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
3300005541|Ga0070733_10556690 | Not Available | 768 | Open in IMG/M |
3300005542|Ga0070732_10000223 | All Organisms → cellular organisms → Bacteria | 41941 | Open in IMG/M |
3300005542|Ga0070732_10014074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4437 | Open in IMG/M |
3300005542|Ga0070732_10158813 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300005542|Ga0070732_10201981 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300005542|Ga0070732_10550766 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005542|Ga0070732_10562661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
3300005542|Ga0070732_10973912 | Not Available | 519 | Open in IMG/M |
3300005543|Ga0070672_102163342 | Not Available | 501 | Open in IMG/M |
3300005566|Ga0066693_10170124 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300005569|Ga0066705_10131132 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
3300005607|Ga0070740_10381580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300005764|Ga0066903_100274983 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
3300005764|Ga0066903_100455803 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300005764|Ga0066903_101056325 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
3300005764|Ga0066903_102698117 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300005764|Ga0066903_104273295 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300005764|Ga0066903_106172228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
3300005842|Ga0068858_101435455 | Not Available | 680 | Open in IMG/M |
3300006028|Ga0070717_10011793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6648 | Open in IMG/M |
3300006028|Ga0070717_10401666 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300006028|Ga0070717_11590514 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300006041|Ga0075023_100313337 | Not Available | 651 | Open in IMG/M |
3300006050|Ga0075028_100221295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1029 | Open in IMG/M |
3300006052|Ga0075029_100071216 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
3300006052|Ga0075029_100082303 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
3300006052|Ga0075029_100151178 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300006052|Ga0075029_100158736 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300006052|Ga0075029_100762783 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300006052|Ga0075029_101274475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
3300006059|Ga0075017_100027669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3721 | Open in IMG/M |
3300006059|Ga0075017_100034127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3361 | Open in IMG/M |
3300006059|Ga0075017_100108073 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
3300006059|Ga0075017_101200549 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006086|Ga0075019_10467463 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300006102|Ga0075015_100700189 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300006162|Ga0075030_100005598 | All Organisms → cellular organisms → Bacteria | 11316 | Open in IMG/M |
3300006162|Ga0075030_100019977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5770 | Open in IMG/M |
3300006162|Ga0075030_100061956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3099 | Open in IMG/M |
3300006162|Ga0075030_100483087 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 985 | Open in IMG/M |
3300006162|Ga0075030_100527261 | Not Available | 939 | Open in IMG/M |
3300006162|Ga0075030_101243115 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300006162|Ga0075030_101328441 | Not Available | 564 | Open in IMG/M |
3300006173|Ga0070716_101369660 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300006174|Ga0075014_100656030 | Not Available | 606 | Open in IMG/M |
3300006174|Ga0075014_100877017 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300006175|Ga0070712_101365190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300006755|Ga0079222_12359017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 532 | Open in IMG/M |
3300006797|Ga0066659_10692604 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300006800|Ga0066660_10817180 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300006804|Ga0079221_10919749 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300006854|Ga0075425_101960701 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300006903|Ga0075426_10608768 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300007258|Ga0099793_10003562 | All Organisms → cellular organisms → Bacteria | 5420 | Open in IMG/M |
3300007982|Ga0102924_1003184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 17320 | Open in IMG/M |
3300007982|Ga0102924_1106876 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
3300009012|Ga0066710_100695819 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300009143|Ga0099792_10690575 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300009148|Ga0105243_12105401 | Not Available | 600 | Open in IMG/M |
3300009520|Ga0116214_1130178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 932 | Open in IMG/M |
3300009553|Ga0105249_11406844 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300009623|Ga0116133_1202572 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010043|Ga0126380_10664307 | Not Available | 832 | Open in IMG/M |
3300010047|Ga0126382_10622773 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300010048|Ga0126373_10149747 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
3300010048|Ga0126373_10365043 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300010048|Ga0126373_10837907 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300010048|Ga0126373_10864159 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300010048|Ga0126373_10879673 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300010048|Ga0126373_12434692 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300010048|Ga0126373_12470523 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300010341|Ga0074045_10050958 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
3300010343|Ga0074044_10035948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3458 | Open in IMG/M |
3300010358|Ga0126370_11613925 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300010358|Ga0126370_11761613 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300010358|Ga0126370_11764718 | Not Available | 598 | Open in IMG/M |
3300010359|Ga0126376_12983773 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 523 | Open in IMG/M |
3300010360|Ga0126372_10002460 | All Organisms → cellular organisms → Bacteria | 8102 | Open in IMG/M |
3300010361|Ga0126378_10574560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1242 | Open in IMG/M |
3300010361|Ga0126378_10707337 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300010361|Ga0126378_10739885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1094 | Open in IMG/M |
3300010361|Ga0126378_11557116 | Not Available | 750 | Open in IMG/M |
3300010361|Ga0126378_13409049 | Not Available | 504 | Open in IMG/M |
3300010366|Ga0126379_10223543 | Not Available | 1831 | Open in IMG/M |
3300010376|Ga0126381_100052038 | All Organisms → cellular organisms → Bacteria | 5019 | Open in IMG/M |
3300010376|Ga0126381_100127319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3308 | Open in IMG/M |
3300010376|Ga0126381_100728280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
3300010376|Ga0126381_101275873 | Not Available | 1061 | Open in IMG/M |
3300010379|Ga0136449_101471554 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300010398|Ga0126383_10172901 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
3300010398|Ga0126383_10186626 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
3300010398|Ga0126383_10455308 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300010398|Ga0126383_10701365 | Not Available | 1090 | Open in IMG/M |
3300011120|Ga0150983_12151989 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300011120|Ga0150983_14056194 | Not Available | 663 | Open in IMG/M |
3300011271|Ga0137393_10235540 | Not Available | 1551 | Open in IMG/M |
3300012201|Ga0137365_11332976 | Not Available | 508 | Open in IMG/M |
3300012203|Ga0137399_10767522 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300012209|Ga0137379_11262176 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012212|Ga0150985_123210879 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
3300012351|Ga0137386_10718451 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012353|Ga0137367_10689122 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300012357|Ga0137384_10840127 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300012359|Ga0137385_11020182 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300012917|Ga0137395_11106400 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012925|Ga0137419_10692157 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300012925|Ga0137419_11216247 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300012927|Ga0137416_11840576 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012929|Ga0137404_12009025 | Not Available | 539 | Open in IMG/M |
3300012930|Ga0137407_10137076 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
3300012944|Ga0137410_10007179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 7570 | Open in IMG/M |
3300012971|Ga0126369_10026035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4754 | Open in IMG/M |
3300012971|Ga0126369_10028438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4574 | Open in IMG/M |
3300012971|Ga0126369_10041669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3860 | Open in IMG/M |
3300012971|Ga0126369_10056555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3378 | Open in IMG/M |
3300012971|Ga0126369_10105785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2558 | Open in IMG/M |
3300012971|Ga0126369_10500994 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300012971|Ga0126369_11316506 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300014158|Ga0181521_10015552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6781 | Open in IMG/M |
3300014161|Ga0181529_10107448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1767 | Open in IMG/M |
3300014167|Ga0181528_10042317 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
3300014498|Ga0182019_10029968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3037 | Open in IMG/M |
3300015242|Ga0137412_10275407 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300015371|Ga0132258_10471367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3134 | Open in IMG/M |
3300016319|Ga0182033_10805410 | Not Available | 828 | Open in IMG/M |
3300016371|Ga0182034_10062327 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
3300016371|Ga0182034_12065484 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300016445|Ga0182038_10023693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3745 | Open in IMG/M |
3300017822|Ga0187802_10021847 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
3300017822|Ga0187802_10300441 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300017823|Ga0187818_10050738 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
3300017823|Ga0187818_10067612 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300017928|Ga0187806_1374890 | Not Available | 511 | Open in IMG/M |
3300017930|Ga0187825_10124393 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300017933|Ga0187801_10253795 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300017933|Ga0187801_10293847 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300017933|Ga0187801_10517621 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300017943|Ga0187819_10037986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2848 | Open in IMG/M |
3300017943|Ga0187819_10083638 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
3300017943|Ga0187819_10770600 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300017948|Ga0187847_10397930 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300017955|Ga0187817_10119649 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300017955|Ga0187817_10120967 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300017959|Ga0187779_10006098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7034 | Open in IMG/M |
3300017959|Ga0187779_10587906 | Not Available | 744 | Open in IMG/M |
3300017959|Ga0187779_10699973 | Not Available | 685 | Open in IMG/M |
3300017961|Ga0187778_10027469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3476 | Open in IMG/M |
3300017961|Ga0187778_10086969 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
3300017961|Ga0187778_10314435 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300017966|Ga0187776_10203090 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300017970|Ga0187783_10011540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6499 | Open in IMG/M |
3300017970|Ga0187783_10027655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4201 | Open in IMG/M |
3300017970|Ga0187783_10069039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2603 | Open in IMG/M |
3300017970|Ga0187783_10252912 | Not Available | 1288 | Open in IMG/M |
3300017970|Ga0187783_10609053 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300017970|Ga0187783_10907781 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300017970|Ga0187783_11284771 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300017972|Ga0187781_10002094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15259 | Open in IMG/M |
3300017972|Ga0187781_10006484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8616 | Open in IMG/M |
3300017972|Ga0187781_10081330 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
3300017972|Ga0187781_10400747 | Not Available | 979 | Open in IMG/M |
3300017972|Ga0187781_11437734 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300017974|Ga0187777_11173094 | Not Available | 561 | Open in IMG/M |
3300017975|Ga0187782_10129540 | All Organisms → cellular organisms → Bacteria | 1869 | Open in IMG/M |
3300017975|Ga0187782_10332584 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300017975|Ga0187782_10495636 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300017975|Ga0187782_10516475 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300017975|Ga0187782_11450225 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300017975|Ga0187782_11513965 | Not Available | 529 | Open in IMG/M |
3300017995|Ga0187816_10143268 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300017999|Ga0187767_10049235 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300018007|Ga0187805_10060427 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
3300018034|Ga0187863_10018235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4335 | Open in IMG/M |
3300018034|Ga0187863_10086060 | Not Available | 1767 | Open in IMG/M |
3300018034|Ga0187863_10145103 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300018046|Ga0187851_10625714 | Not Available | 608 | Open in IMG/M |
3300018062|Ga0187784_10011217 | All Organisms → cellular organisms → Bacteria | 7230 | Open in IMG/M |
3300018062|Ga0187784_10442348 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300018062|Ga0187784_11546875 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300018085|Ga0187772_10022507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3648 | Open in IMG/M |
3300018085|Ga0187772_10048053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2610 | Open in IMG/M |
3300018085|Ga0187772_10537824 | Not Available | 827 | Open in IMG/M |
3300018085|Ga0187772_11001905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 610 | Open in IMG/M |
3300018088|Ga0187771_10104636 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
3300018090|Ga0187770_10158304 | All Organisms → cellular organisms → Bacteria | 1729 | Open in IMG/M |
3300018468|Ga0066662_11084391 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300018468|Ga0066662_11812402 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300019256|Ga0181508_1460062 | Not Available | 603 | Open in IMG/M |
3300019789|Ga0137408_1422509 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
3300020579|Ga0210407_10319728 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
3300020580|Ga0210403_10037046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3898 | Open in IMG/M |
3300020581|Ga0210399_10008739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7920 | Open in IMG/M |
3300020581|Ga0210399_10069681 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
3300020581|Ga0210399_10176719 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300021088|Ga0210404_10162974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1176 | Open in IMG/M |
3300021180|Ga0210396_10056261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 3596 | Open in IMG/M |
3300021181|Ga0210388_11500481 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300021407|Ga0210383_10062789 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
3300021420|Ga0210394_10056001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3438 | Open in IMG/M |
3300021476|Ga0187846_10223838 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300021478|Ga0210402_11018249 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300021560|Ga0126371_10003489 | All Organisms → cellular organisms → Bacteria | 13782 | Open in IMG/M |
3300021560|Ga0126371_10003591 | All Organisms → cellular organisms → Bacteria | 13597 | Open in IMG/M |
3300021560|Ga0126371_10035047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4728 | Open in IMG/M |
3300021560|Ga0126371_10040091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4435 | Open in IMG/M |
3300021560|Ga0126371_10086974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3081 | Open in IMG/M |
3300021560|Ga0126371_10104011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 2835 | Open in IMG/M |
3300021560|Ga0126371_10176105 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
3300021560|Ga0126371_10642508 | Not Available | 1210 | Open in IMG/M |
3300021560|Ga0126371_11317463 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300021560|Ga0126371_11503291 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300021560|Ga0126371_13565704 | Not Available | 525 | Open in IMG/M |
3300022523|Ga0242663_1016307 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300022557|Ga0212123_10120526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2087 | Open in IMG/M |
3300024330|Ga0137417_1041544 | Not Available | 1081 | Open in IMG/M |
3300024330|Ga0137417_1236018 | All Organisms → cellular organisms → Bacteria | 2335 | Open in IMG/M |
3300025898|Ga0207692_10727640 | Not Available | 645 | Open in IMG/M |
3300025898|Ga0207692_10843008 | Not Available | 601 | Open in IMG/M |
3300025905|Ga0207685_10332033 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300025906|Ga0207699_10063297 | All Organisms → Viruses → Predicted Viral | 2234 | Open in IMG/M |
3300025906|Ga0207699_10298943 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300025907|Ga0207645_11009854 | Not Available | 563 | Open in IMG/M |
3300025932|Ga0207690_10184521 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
3300025939|Ga0207665_10218128 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300025981|Ga0207640_11045935 | Not Available | 720 | Open in IMG/M |
3300026334|Ga0209377_1201308 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300026538|Ga0209056_10536882 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300026847|Ga0207802_1019981 | Not Available | 580 | Open in IMG/M |
3300026887|Ga0207805_1025940 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027376|Ga0209004_1001816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2573 | Open in IMG/M |
3300027502|Ga0209622_1059737 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300027633|Ga0208988_1039301 | Not Available | 1216 | Open in IMG/M |
3300027812|Ga0209656_10045582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2510 | Open in IMG/M |
3300027824|Ga0209040_10164817 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300027826|Ga0209060_10001726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22655 | Open in IMG/M |
3300027826|Ga0209060_10050651 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
3300027826|Ga0209060_10416622 | Not Available | 611 | Open in IMG/M |
3300027826|Ga0209060_10493327 | Not Available | 556 | Open in IMG/M |
3300027842|Ga0209580_10000154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 47936 | Open in IMG/M |
3300027842|Ga0209580_10008419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4417 | Open in IMG/M |
3300027842|Ga0209580_10120999 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300027842|Ga0209580_10159434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1112 | Open in IMG/M |
3300027842|Ga0209580_10487431 | Not Available | 614 | Open in IMG/M |
3300027842|Ga0209580_10493525 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300027854|Ga0209517_10002094 | All Organisms → cellular organisms → Bacteria | 28838 | Open in IMG/M |
3300027857|Ga0209166_10000041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 176480 | Open in IMG/M |
3300027857|Ga0209166_10006854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7642 | Open in IMG/M |
3300027867|Ga0209167_10038661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2315 | Open in IMG/M |
3300027867|Ga0209167_10237463 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300027869|Ga0209579_10000036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 313075 | Open in IMG/M |
3300027869|Ga0209579_10008158 | All Organisms → cellular organisms → Bacteria | 6665 | Open in IMG/M |
3300027869|Ga0209579_10791782 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300027874|Ga0209465_10199137 | Not Available | 999 | Open in IMG/M |
3300027874|Ga0209465_10261529 | Not Available | 866 | Open in IMG/M |
3300027874|Ga0209465_10521302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 593 | Open in IMG/M |
3300027889|Ga0209380_10052700 | All Organisms → cellular organisms → Bacteria | 2309 | Open in IMG/M |
3300027898|Ga0209067_10010401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4929 | Open in IMG/M |
3300027898|Ga0209067_10363466 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300027898|Ga0209067_10560531 | Not Available | 653 | Open in IMG/M |
3300027903|Ga0209488_10484292 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300027908|Ga0209006_10083070 | All Organisms → cellular organisms → Bacteria | 2849 | Open in IMG/M |
3300027910|Ga0209583_10070824 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300027910|Ga0209583_10182578 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300027911|Ga0209698_10001240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 29556 | Open in IMG/M |
3300027911|Ga0209698_10170735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1772 | Open in IMG/M |
3300027911|Ga0209698_10433169 | Not Available | 1024 | Open in IMG/M |
3300027911|Ga0209698_11062606 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300027965|Ga0209062_1002341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25979 | Open in IMG/M |
3300027986|Ga0209168_10000075 | All Organisms → cellular organisms → Bacteria | 112108 | Open in IMG/M |
3300027986|Ga0209168_10000897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25764 | Open in IMG/M |
3300027986|Ga0209168_10011170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5361 | Open in IMG/M |
3300028780|Ga0302225_10343622 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300028792|Ga0307504_10007573 | All Organisms → cellular organisms → Bacteria | 2348 | Open in IMG/M |
3300028800|Ga0265338_10023331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6366 | Open in IMG/M |
3300029999|Ga0311339_10004625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 22710 | Open in IMG/M |
3300031573|Ga0310915_10370429 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300031708|Ga0310686_103065228 | All Organisms → cellular organisms → Bacteria | 9162 | Open in IMG/M |
3300031708|Ga0310686_108433635 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
3300031715|Ga0307476_10000085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 100245 | Open in IMG/M |
3300031715|Ga0307476_10147540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1687 | Open in IMG/M |
3300031715|Ga0307476_10312500 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300031718|Ga0307474_11233078 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300031720|Ga0307469_10072424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2291 | Open in IMG/M |
3300031720|Ga0307469_10202360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1552 | Open in IMG/M |
3300031720|Ga0307469_10363935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1220 | Open in IMG/M |
3300031740|Ga0307468_100053885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2122 | Open in IMG/M |
3300031744|Ga0306918_10382811 | Not Available | 1095 | Open in IMG/M |
3300031744|Ga0306918_11576363 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300031753|Ga0307477_10168276 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300031754|Ga0307475_10292700 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300031796|Ga0318576_10454330 | Not Available | 605 | Open in IMG/M |
3300031820|Ga0307473_10576324 | Not Available | 773 | Open in IMG/M |
3300031823|Ga0307478_10076453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2544 | Open in IMG/M |
3300031823|Ga0307478_10173332 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
3300031890|Ga0306925_10238156 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
3300031890|Ga0306925_10534601 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
3300031890|Ga0306925_11993788 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300031912|Ga0306921_10389537 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300031912|Ga0306921_10789408 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300031938|Ga0308175_102389571 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300031939|Ga0308174_11094398 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300031945|Ga0310913_10935901 | Not Available | 609 | Open in IMG/M |
3300031946|Ga0310910_10296470 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
3300031962|Ga0307479_10011233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8336 | Open in IMG/M |
3300031996|Ga0308176_10605111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1127 | Open in IMG/M |
3300032001|Ga0306922_10058805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3993 | Open in IMG/M |
3300032001|Ga0306922_10311949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1689 | Open in IMG/M |
3300032160|Ga0311301_12339491 | Not Available | 606 | Open in IMG/M |
3300032205|Ga0307472_100066854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2326 | Open in IMG/M |
3300032770|Ga0335085_10000098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 281483 | Open in IMG/M |
3300032770|Ga0335085_10009720 | All Organisms → cellular organisms → Bacteria | 14479 | Open in IMG/M |
3300032770|Ga0335085_10012118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12724 | Open in IMG/M |
3300032770|Ga0335085_10584720 | Not Available | 1259 | Open in IMG/M |
3300032770|Ga0335085_12054650 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300032782|Ga0335082_10000232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 57002 | Open in IMG/M |
3300032782|Ga0335082_10113442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2669 | Open in IMG/M |
3300032782|Ga0335082_10202297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1886 | Open in IMG/M |
3300032782|Ga0335082_10341814 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300032783|Ga0335079_10000154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 78909 | Open in IMG/M |
3300032783|Ga0335079_10016677 | All Organisms → cellular organisms → Bacteria | 8399 | Open in IMG/M |
3300032783|Ga0335079_10137196 | All Organisms → cellular organisms → Bacteria | 2752 | Open in IMG/M |
3300032783|Ga0335079_10477335 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300032783|Ga0335079_10717487 | Not Available | 1043 | Open in IMG/M |
3300032783|Ga0335079_11493822 | Not Available | 668 | Open in IMG/M |
3300032805|Ga0335078_10248814 | All Organisms → cellular organisms → Bacteria | 2427 | Open in IMG/M |
3300032805|Ga0335078_10607390 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
3300032805|Ga0335078_10622440 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300032805|Ga0335078_11794372 | Not Available | 667 | Open in IMG/M |
3300032828|Ga0335080_10000018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 222078 | Open in IMG/M |
3300032828|Ga0335080_10079274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3644 | Open in IMG/M |
3300032828|Ga0335080_10334998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1635 | Open in IMG/M |
3300032828|Ga0335080_10821480 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300032829|Ga0335070_10004463 | All Organisms → cellular organisms → Bacteria | 16362 | Open in IMG/M |
3300032829|Ga0335070_10033503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5814 | Open in IMG/M |
3300032892|Ga0335081_10161616 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
3300032893|Ga0335069_10019749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9346 | Open in IMG/M |
3300032893|Ga0335069_10046853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 5715 | Open in IMG/M |
3300032893|Ga0335069_10482457 | Not Available | 1441 | Open in IMG/M |
3300032893|Ga0335069_11122264 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300032897|Ga0335071_10260610 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
3300032897|Ga0335071_10854582 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300032898|Ga0335072_10361486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1582 | Open in IMG/M |
3300032954|Ga0335083_10023434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7036 | Open in IMG/M |
3300032954|Ga0335083_10130262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2413 | Open in IMG/M |
3300032955|Ga0335076_10001309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 24048 | Open in IMG/M |
3300032955|Ga0335076_10180068 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
3300033004|Ga0335084_10149339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
3300033004|Ga0335084_10247937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1846 | Open in IMG/M |
3300033004|Ga0335084_10875602 | Not Available | 909 | Open in IMG/M |
3300033004|Ga0335084_11259508 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300033134|Ga0335073_10125000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3292 | Open in IMG/M |
3300033134|Ga0335073_10713584 | Not Available | 1093 | Open in IMG/M |
3300033134|Ga0335073_11908748 | Not Available | 548 | Open in IMG/M |
3300033289|Ga0310914_10994739 | Not Available | 739 | Open in IMG/M |
3300033433|Ga0326726_10747218 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300034282|Ga0370492_0063296 | Not Available | 1517 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 11.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 10.55% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.63% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.91% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.32% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.08% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.44% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.20% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.72% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.48% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.48% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.48% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.24% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.24% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.24% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.24% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.24% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.24% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.24% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.24% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.24% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_76230 | 2035918004 | Soil | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSNSKEKE |
MRS1b_0587.00001520 | 2162886011 | Miscanthus Rhizosphere | MCPACIASVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ |
deeps_00381130 | 2199352024 | Soil | LEVRRGDMCPACMASAGVVVGGVVSSGGLTALVLKVLRKKKSEKNHNKPEE |
INPhiseqgaiiFebDRAFT_1011198332 | 3300000364 | Soil | MCPACIASAGVILGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE* |
INPhiseqgaiiFebDRAFT_1012804292 | 3300000364 | Soil | MCPACLASAGIVLGSVVSTGGLTALVMKVLRKKKGEKSDSKGRE* |
JGI12270J11330_101681621 | 3300000567 | Peatlands Soil | MCPVCMASATVVVGGVVSTGGVTALLVKVLGRKKKDEKGNSK |
AP72_2010_repI_A01DRAFT_10020293 | 3300000579 | Forest Soil | MCPACVANAGVVLGSAVSTGGLTALVVRVLRKKKVQKSDSKEKE* |
JGI1027J12803_1003832772 | 3300000955 | Soil | MCPACIASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSNAKEKE* |
JGI1027J12803_1003987091 | 3300000955 | Soil | MCPACIASAGVVVGGVVSTGGLTALVAKVLRKKKGEKSDSKKKE* |
JGI1027J12803_1011848042 | 3300000955 | Soil | ACLASAGIVLGSVVSTGGLTALVMKVLRKKKGEKSDSKGRE* |
JGI12053J15887_100076286 | 3300001661 | Forest Soil | MCPACIASAGMVVGSVVSTGGVTALLMKVLRKNKGEKSDSKEKE* |
JGIcombinedJ26739_1000050353 | 3300002245 | Forest Soil | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSDSKEKE* |
C688J35102_1200040812 | 3300002568 | Soil | MCPACIASVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
C688J35102_1205429993 | 3300002568 | Soil | MCPACIASAGVVVGSVVSTGGLTALVAKILRKKKREKSNLQEKE* |
C688J35102_1209890818 | 3300002568 | Soil | MCPACIASAGMVVGSVVSTGGVTALVMKVLRKKKLGKSISKEKEQ* |
JGI25616J43925_100721192 | 3300002917 | Grasslands Soil | MCPACLASAGMVVGSVVSTGGVSALLVKVLRKKKSEKSVSKEKE* |
Ga0062387_1014456481 | 3300004091 | Bog Forest Soil | MCPVCMASAGLLAGSVVSTGGLTALVVKVLGKKKGEKNDSKIKEQGS* |
Ga0062386_1002189032 | 3300004152 | Bog Forest Soil | MCPACLASAGVVVGSALSTGGLTALVVKVFRMKKGGKNESKEKE* |
Ga0062386_1018700572 | 3300004152 | Bog Forest Soil | MCPVCMASAGLLAGSVVSTGGLTALVVKVLSRKKGEKNDSKIKEQGI* |
Ga0062595_1017236912 | 3300004479 | Soil | MCPACVASAGVVVGSVLSTGGLTALVARVLRKKKGEKSNSKEKE* |
Ga0066395_100753552 | 3300004633 | Tropical Forest Soil | MCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKGEKSDSKEKE* |
Ga0066395_103402912 | 3300004633 | Tropical Forest Soil | MCPACVASAGVVLGSAVSTAGLTALVVKVFRKKKVEKSDSKEKE* |
Ga0066672_100711844 | 3300005167 | Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE* |
Ga0066683_107440722 | 3300005172 | Soil | MCPACIASAGVVAGSVVSTGGVTALVMKVLRKKKGGKNYLKEKE* |
Ga0066679_101553892 | 3300005176 | Soil | MCPACIASAGMVVGSVVSTGGVTALVMKVLRKTKGEKSTSKEKE* |
Ga0070683_1004207851 | 3300005329 | Corn Rhizosphere | MCPACIATVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
Ga0066388_1003078753 | 3300005332 | Tropical Forest Soil | MCPACVASAGVVLGSAVSTAGLTALVVKVFRKKKVEKNDSKEKE* |
Ga0066388_1014723672 | 3300005332 | Tropical Forest Soil | MCPACMASAGLVAGSVVSGGGVTALLVKVLRKKESEKSDSKEKGDSKEKE* |
Ga0066388_1058826192 | 3300005332 | Tropical Forest Soil | MCPACIASAGVVLGSAVSTGGLTALLVKVLRKKKGEKSESKDKE* |
Ga0070669_1002241902 | 3300005353 | Switchgrass Rhizosphere | MCSACIASVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
Ga0070659_1000418701 | 3300005366 | Corn Rhizosphere | MMCPACIASVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
Ga0070709_100274473 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACVASAGVVVGSVVSTGGLSALVLRVLRKKKSEKSNSKEKE* |
Ga0070709_116486712 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACAAMAAIVIGGVVSTGGLTALAVKVFRKNKGEKNDSKEKE* |
Ga0070714_1005560052 | 3300005435 | Agricultural Soil | MCPACVASAGVVLGSAVSTGGLTALVVRVLRKKKVQKSDSKEKE* |
Ga0070714_1009616232 | 3300005435 | Agricultural Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRMKKGEKSDSKKKE* |
Ga0070714_1016669101 | 3300005435 | Agricultural Soil | MCPACMASAGVVVGSVVSTGGLTALVAKILRKKKTETNDSKNKEQ* |
Ga0070713_1000876802 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKSEKSNSKEKE* |
Ga0070713_1007915962 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACVASAGVVVGSVLSTGGLTALVAKVLRKKKGEKSNSKEKE* |
Ga0070713_1010270462 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPGCAAMAAIVVGGVVSTGGLTALAVKILRKNKGEKADSKEKE* |
Ga0070711_1009297212 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACIASAGVVVGSVVSTGGLTALVVKVLRKKKGEKNDLKEKE* |
Ga0070708_1007022333 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACIASTGMVVGSVVSTGGVTALVMKVIRKKKAEKGDSKEKE* |
Ga0070741_100090376 | 3300005529 | Surface Soil | MCPACMASAGLVVGSVVSTGGVTALLAKVLRKRKDDSKAKEK* |
Ga0070741_101886213 | 3300005529 | Surface Soil | MCPGCAAMALIVAGGVVSTGGLTALTLKVLRKNKTAKIESKDKE* |
Ga0070741_108284702 | 3300005529 | Surface Soil | MCPACIASAGVVVGSAVSTGGLTALVMKVLRKKKVGKSNSNEKE* |
Ga0070738_1000043263 | 3300005531 | Surface Soil | MCPACIASAGMAVGGAVSSGGLTALVMKVLRKKKIEKSVSKEKE* |
Ga0070734_1000049775 | 3300005533 | Surface Soil | MCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKGERSDSKEKE* |
Ga0070734_100364104 | 3300005533 | Surface Soil | MCPACIASAGVMVGSAVSTGGLTALVVRVLRKKKIDQSNPKAKE* |
Ga0070734_101068843 | 3300005533 | Surface Soil | MCPACLATAGIVIGSVVSTGGVAALVAKLIGKRKGEKNDSKTKEQ* |
Ga0070734_101204273 | 3300005533 | Surface Soil | MCPACVASAAMVAGSVVSGGGVTALLVKVLRKKKVEKSDSTKEEKE* |
Ga0070734_107473662 | 3300005533 | Surface Soil | MCPACIASAGMVVGSAVSTGGLTALVVKVLRKKKGEKNDSKEKE* |
Ga0070735_1000064627 | 3300005534 | Surface Soil | MCPACIASAGVVVGSAVSTGGLTALIVKVLRKKKGEKHDSKEKE* |
Ga0070735_1000124816 | 3300005534 | Surface Soil | MCPACLAAAGIVVGGVISTGGLTALAVKVLRKKKGEKSESKEKE* |
Ga0070735_100481382 | 3300005534 | Surface Soil | MCPACVASAGVVVGSVLSTGGLTALVAKVLRKKKGEKSDSKEKE* |
Ga0070730_1000028443 | 3300005537 | Surface Soil | MCPACAATAAVVVGSVVSTGGLTALVAKVLRKKKGEKSDSKEKE* |
Ga0070730_1000034110 | 3300005537 | Surface Soil | MCPACVASAGVVVGSVVSTGGLTALLAKVLRKKKGEKSNSKEKE* |
Ga0070731_10000074154 | 3300005538 | Surface Soil | MCPACLATAGIVIGSVVSTGGVAALVAKMIGKRKGEKNDSKMKEQ* |
Ga0070731_100152335 | 3300005538 | Surface Soil | MCPACIASAGVVVGSAVSTGGLTALFVKIFRKKTNVKNNSKEKE* |
Ga0070731_104647192 | 3300005538 | Surface Soil | MCPACIASAGVVLGSAVSTGGVTALVLKVFRKKKIEKSDSKEKE* |
Ga0070733_100677302 | 3300005541 | Surface Soil | MCPACLASAGVVVGSAVSTGSLTALVVKVLRKKKSEKSDSKEKE* |
Ga0070733_105566901 | 3300005541 | Surface Soil | GVVVGSVVSTGGLTALLAKVLRKKKGEKSNSKEKE* |
Ga0070732_1000022310 | 3300005542 | Surface Soil | MCPACIASAGVVVGSVVSTGGLTALVVRVLRKKKGEKSDSKQKE* |
Ga0070732_100140743 | 3300005542 | Surface Soil | MCPACMASAGIIVGSVVSTGGLTALVAKILRKKKVETNDSKAKEQ* |
Ga0070732_101588132 | 3300005542 | Surface Soil | MCPACIASATVVVGSVVSTGGLTALVVKVLRKKKVEKGNSKEKE* |
Ga0070732_102019812 | 3300005542 | Surface Soil | MCPACIASAGVVVGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE* |
Ga0070732_105507662 | 3300005542 | Surface Soil | MCPACVASAGVVVGSVVSTGWLSALVLKVLRKKKGEKSNSKEKE* |
Ga0070732_105626612 | 3300005542 | Surface Soil | MCPACVASAGVVVGSVLSTGGLTALVARVLRKKKGEKSNSKEKESRS* |
Ga0070732_109739122 | 3300005542 | Surface Soil | AGSVVSTGGLTALVVKVFSKKKGEKNDSKTKEQGS* |
Ga0070672_1021633422 | 3300005543 | Miscanthus Rhizosphere | SVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
Ga0066693_101701243 | 3300005566 | Soil | MCPACIASVGIVVGSVVSAGGATALVMKVLRSKRTEKSISKEKEQ* |
Ga0066705_101311323 | 3300005569 | Soil | GRDEIEVEVEEVYMCPACMASAGLVVGGVVSTSGVTALLAKILRKKKTATNDSKGKEQ* |
Ga0070740_103815801 | 3300005607 | Surface Soil | CPACFASAALVVGGVISTGGLTAVAMKVLRKKKSEKSDSKEKE* |
Ga0066903_1002749832 | 3300005764 | Tropical Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKSELKDKE* |
Ga0066903_1004558033 | 3300005764 | Tropical Forest Soil | MCPACMASAGVVLGSAVSTGGLTALLVKVLRKKKGEKSESKDKE* |
Ga0066903_1010563252 | 3300005764 | Tropical Forest Soil | MCPACIASATVVLGSAVSTGGLTALVVKVLRKKKGEKSESKEKE* |
Ga0066903_1026981172 | 3300005764 | Tropical Forest Soil | MCPACVANAGVVVGSVVSTGGLSALVLKVLRKKKGEKSDSKEKE* |
Ga0066903_1042732952 | 3300005764 | Tropical Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKRELKDKE* |
Ga0066903_1061722282 | 3300005764 | Tropical Forest Soil | MCPACVASAGVVLGSAVSTGGLTALVVKVLRKKKVEKRDSKERE* |
Ga0068858_1014354551 | 3300005842 | Switchgrass Rhizosphere | IVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
Ga0070717_100117935 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACIASAGVVVSSAVSTGGLTALVVKVLRKKKGEKSELKDKE* |
Ga0070717_104016662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPGCIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE* |
Ga0070717_115905142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RARSEEVIMCPACMASAGVVVGSVVSTGGLTALVAKILRKKKTETNDSKNKEQ* |
Ga0075023_1003133371 | 3300006041 | Watersheds | IASAGMVVGSVVSTGGVTALVMKVLRKKKGEKSVSKEKEQRS* |
Ga0075028_1002212953 | 3300006050 | Watersheds | MCPACVASAGMVVGSVVSTGGVTALVMKVLRKKKNGNNEFKEKE* |
Ga0075029_1000712162 | 3300006052 | Watersheds | MCPVCMAGAGLVAGSVVSTGGLTALVVKVLSRKKGEKNDSKSKEQGS* |
Ga0075029_1000823032 | 3300006052 | Watersheds | MCPACIASAGVVVGSAVSTGGLTALIVKVLRKKKGEKSDSKEKE* |
Ga0075029_1001511782 | 3300006052 | Watersheds | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSNSKEKE* |
Ga0075029_1001587361 | 3300006052 | Watersheds | MCPACIASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSDSKQKE* |
Ga0075029_1007627832 | 3300006052 | Watersheds | MCPFCAATGAVVVGSAVSTGGLTALFVKILRKKKGENSDSKKEKE* |
Ga0075029_1012744752 | 3300006052 | Watersheds | AMCPACIASAGVVLGSAVSTGGLTALVVKVLRRKKGEKSDSKEKE* |
Ga0075017_1000276694 | 3300006059 | Watersheds | MCPACIASAGVVLGSAVSTGGLTALVVKVLRRKKGEKSDSKEKE* |
Ga0075017_1000341276 | 3300006059 | Watersheds | MCPVCMASAGLVAGSVVSTGGLTALVVRVLGKKKGEKNDSKTKEQAS* |
Ga0075017_1001080733 | 3300006059 | Watersheds | MCPVCMASAGLVAGSVVSTGGLTALVVRVLSKKKGEKNDSKKEQGS* |
Ga0075017_1012005492 | 3300006059 | Watersheds | MCPACISSAGVVVGSVVSTGGLTALVAKVLRKKKGEKSNSKEKE* |
Ga0075019_104674632 | 3300006086 | Watersheds | MCPVCMASAGLIAGSVVSTGGLTALVVKVLGKKKVEKSDSKTKEQGS* |
Ga0075015_1007001892 | 3300006102 | Watersheds | MCPVCMVSAGLVAGSVVSTGGLTALVVKVLSKKKGEKNDSKTKEQGS* |
Ga0075030_1000055989 | 3300006162 | Watersheds | MASAGLIAGSVVSTGGLTALVVKVLGKKKVEKSDSKTKEQGS* |
Ga0075030_1000199777 | 3300006162 | Watersheds | MCPACIASAGVVVGSVVSTGGLTALVAKVLRKKKGQKSDSKQKE* |
Ga0075030_1000619562 | 3300006162 | Watersheds | MSLFQEENMCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSNSKEKE* |
Ga0075030_1004830873 | 3300006162 | Watersheds | MCPVCMASAGLVAGSVMSTGGLTALVVRVLSKKKGEKKNSKAEEQAS* |
Ga0075030_1005272612 | 3300006162 | Watersheds | GVVVGSVVSTGGLTALVAKVLRKKKGEKSNAKEKE* |
Ga0075030_1012431152 | 3300006162 | Watersheds | MCPACLASAGVVVGSVVSTGGLTALVARVLRKKKSEESNSKEKE* |
Ga0075030_1013284412 | 3300006162 | Watersheds | AGSVVSTGGLTALVIKVLSKNKGEKNDSKIKEQAS* |
Ga0070716_1013696602 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKDEKSNSKEKE* |
Ga0075014_1006560302 | 3300006174 | Watersheds | AGLVAGSVVSTGGLTALVVKVLSRKKGEKNDSKSKEQGS* |
Ga0075014_1008770172 | 3300006174 | Watersheds | MCPACLASAGVVVGSVVSTGGLTALVARVLRKKKGEKSNPKQKE* |
Ga0070712_1013651901 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACIASAGLLVGSAVSTGGLTALVVKVLRKKKGEKNDLKEKE* |
Ga0079222_123590171 | 3300006755 | Agricultural Soil | MCPACAAMGAIVIGSVVSTGGLTALAVKVLRKNKGEKSDSKEKE* |
Ga0066659_106926042 | 3300006797 | Soil | MSLCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE* |
Ga0066660_108171801 | 3300006800 | Soil | MCPVCIASAGVVVGSVVSTGGVSALVMKVLRKKKADKNDSKEK |
Ga0079221_109197492 | 3300006804 | Agricultural Soil | MCPACVASAGVVVGSVLSTGGLTALVARVLRKKKGEKSKSKEKE* |
Ga0075425_1019607012 | 3300006854 | Populus Rhizosphere | MCPACIASAGMVVGSVVSTGGVTALVMKVIRKKKAEKGDSKEKE* |
Ga0075426_106087682 | 3300006903 | Populus Rhizosphere | MCPACVASAGVVVGSVLSTGGLTALIARVLRKKKKGEKSNSKEKE* |
Ga0099793_1000356210 | 3300007258 | Vadose Zone Soil | MVVGSVVSTGGVTALVMRVLRKKKGEKSDSKEKE* |
Ga0102924_100318410 | 3300007982 | Iron-Sulfur Acid Spring | MCPACFASAGVVVGSAVSTGGLTALVMKVLRKKKGEKNELKEKE* |
Ga0102924_11068763 | 3300007982 | Iron-Sulfur Acid Spring | VASAGVVVGSVLSTDGLTALVARVLRKKKGEKSNSKEKE* |
Ga0066710_1006958193 | 3300009012 | Grasslands Soil | GAMCPACIASAGVVAGSVVSTGGVTALVMKVLRKKKGGKNYLKEKE |
Ga0099792_106905752 | 3300009143 | Vadose Zone Soil | MCPACIASAGIVVGSVVSTGGVTALVMKVLRKKKGEKSDSNEKEERS* |
Ga0105243_121054012 | 3300009148 | Miscanthus Rhizosphere | ACIASVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ* |
Ga0116214_11301781 | 3300009520 | Peatlands Soil | MASTGLVAGSVVSTGGLTALVVKVLSRKKGEKNDSKIKEQAS* |
Ga0105249_114068442 | 3300009553 | Switchgrass Rhizosphere | MCPACIASVGIVVGSVVSAGGATALVVKVLRSKKTEKSISKEKEQ* |
Ga0116133_12025721 | 3300009623 | Peatland | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSESKEKE* |
Ga0126380_106643072 | 3300010043 | Tropical Forest Soil | MASAGLVAGGVVSGGGVTALLVKVLRKKESGKSDSKEKSDSKEKE* |
Ga0126382_106227732 | 3300010047 | Tropical Forest Soil | MCPACIASAGVVLGSAVSTGGLTALVVKVLRKKKGEKSESKDKE* |
Ga0126373_101497474 | 3300010048 | Tropical Forest Soil | MCPACIASATVVVGSAVSTGGLTALVWRVLRKKKGEKSISKEKE* |
Ga0126373_103650432 | 3300010048 | Tropical Forest Soil | MCPACVASAGVVVGGVVSTGGLSALVLKVLRKKKGEKSDSKEKE* |
Ga0126373_108379072 | 3300010048 | Tropical Forest Soil | MCPACFASAALVVGGVISTGGLTAVAMKVLRKKKTERSDSKEKE* |
Ga0126373_108641592 | 3300010048 | Tropical Forest Soil | MCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKGEKSTSKEKE* |
Ga0126373_108796732 | 3300010048 | Tropical Forest Soil | MVAGSVVSGGGVTALLVKVLRKKKSEKSDRTKVEKE* |
Ga0126373_124346922 | 3300010048 | Tropical Forest Soil | MCPACIASAGVVVGSVVSTGGLTALVLRVLRKKKGEKSDSKDKE* |
Ga0126373_124705232 | 3300010048 | Tropical Forest Soil | LVLGSAVSTGGLTALVVKVLRKKKVEKNDSKEKEKE* |
Ga0074045_100509584 | 3300010341 | Bog Forest Soil | LASAGLVAGSVVSTGGLTALLVRVLSKNKGEKNVSKAKEQGS* |
Ga0074044_100359484 | 3300010343 | Bog Forest Soil | MCPACIASAGVVVGSVVSTGGVTALVVKILGKKKGEKSDSRTKEQ* |
Ga0126370_116139252 | 3300010358 | Tropical Forest Soil | MCPACIASAGLVVGSVVSGGGVTALVVKVLGRKKKGDKTDLNKEKES* |
Ga0126370_117616132 | 3300010358 | Tropical Forest Soil | MASAGVVLGSAVSTGGLTALVVKVLRKKKGEKSESKDKE* |
Ga0126370_117647181 | 3300010358 | Tropical Forest Soil | VVLGGAVSTGGLTALVVKVLRKKKDEKSESKEKE* |
Ga0126376_129837731 | 3300010359 | Tropical Forest Soil | LKPALGETTVEKQEVRMCPACAAMAAIVVGGVVSTGGLTALAVKVLRKNKGEKNDSKEKE |
Ga0126372_100024605 | 3300010360 | Tropical Forest Soil | VVLGSAVSTAGLTALVVKVFRKKKVEKNDSKEKE* |
Ga0126378_105745601 | 3300010361 | Tropical Forest Soil | MASAGLVAGSVVSGGGVTALLVKVLRKKESEKSDSKEK |
Ga0126378_107073372 | 3300010361 | Tropical Forest Soil | MCPACIASATVVVGSAVSTGGLTALVWRVLRKKKGEKSNSQEKE* |
Ga0126378_107398851 | 3300010361 | Tropical Forest Soil | MRHRQEVLMCPACIASATVVVGSAVSTGGLTALVVRVLRKKKGEKSD |
Ga0126378_115571162 | 3300010361 | Tropical Forest Soil | AGLVAGSVVSGGGVTALLVKVLRKKESEKSDSQEKNDSKEKE* |
Ga0126378_134090492 | 3300010361 | Tropical Forest Soil | MASAGLVAGGVVSSGGVTALLVKVLRKKKGEKSDSTKEEKE* |
Ga0126379_102235433 | 3300010366 | Tropical Forest Soil | MVSIFEGVVMCPACVASAGVVAGSVISTGGLSALVLKVLRKRKSEKRDSKEKE* |
Ga0126381_1000520388 | 3300010376 | Tropical Forest Soil | CIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKSELKDKE* |
Ga0126381_1001273193 | 3300010376 | Tropical Forest Soil | MVAGSVVSGGGVTALLVKILRKKKSEKSDRTKVEKE* |
Ga0126381_1007282801 | 3300010376 | Tropical Forest Soil | MKHRQEVLMCPACIASATVVVGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE* |
Ga0126381_1012758731 | 3300010376 | Tropical Forest Soil | MASAGVLLGSAISTGGLTALVAGIFRKKKVKKSESQEKEQGS* |
Ga0136449_1014715542 | 3300010379 | Peatlands Soil | MASATVVVGGVVSTGGVTALLVKVLGRKKKDEKGNSKKER* |
Ga0126383_101729014 | 3300010398 | Tropical Forest Soil | MASAGVVLGSAVSTGGLTALLVKVLRKKKGEKSESKDKE* |
Ga0126383_101866264 | 3300010398 | Tropical Forest Soil | MASAGLVAGSVVSGGGVTALLVKVLRKKESGKSDSKEKSDSKEKE* |
Ga0126383_104553083 | 3300010398 | Tropical Forest Soil | MCPACVANAGVVVGSVFSTGGLTALVVKVLRKKKSEKSELKHKE* |
Ga0126383_107013652 | 3300010398 | Tropical Forest Soil | MVSIFEGVVMCPACVASAGVVVGSVISTGGLSALVLKVLRKKKSEKRDSKEKE* |
Ga0150983_121519892 | 3300011120 | Forest Soil | VVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE* |
Ga0150983_140561942 | 3300011120 | Forest Soil | SAGVVVGSVVSTGGLTALVARVLRRKKGEKNDSKKKE* |
Ga0137393_102355402 | 3300011271 | Vadose Zone Soil | MCPACIASAGVVVGSVVSTGGVSALVMKVLRKKKGGKSDSSEKEQRS* |
Ga0137365_113329761 | 3300012201 | Vadose Zone Soil | IASAGVVAGSVVSTGGITALVMKVLRKKKGGKNYLKEKE* |
Ga0137399_107675222 | 3300012203 | Vadose Zone Soil | MCPACIASAGVVVGSVVSTGGVTALVMKVLRKKKSNNSDIKEKE* |
Ga0137379_112621762 | 3300012209 | Vadose Zone Soil | MCPACIASAGVVAGSVVSTGGVTALVMKVLRKKKDGKNNLKEKE* |
Ga0150985_1232108793 | 3300012212 | Avena Fatua Rhizosphere | MCPACIANAGVVVGSVVSTGGLTALVAKILRKKKREKSNLQEKE* |
Ga0137386_107184512 | 3300012351 | Vadose Zone Soil | MCPFCAATAAVVVGSAVSTGGLTALIVEVLRKKKGENSDSKKGKE* |
Ga0137367_106891222 | 3300012353 | Vadose Zone Soil | MCPACIASATFVVGSAVSTGGLTALVVKVLRKKKGEKSDSKEKE* |
Ga0137384_108401272 | 3300012357 | Vadose Zone Soil | MCPACIASAGIVVGSVVSTGGVTALLMKVLRRKKGGKSDSKEKE* |
Ga0137385_110201822 | 3300012359 | Vadose Zone Soil | MCPACIASAGIVVGSVVSTGGVSALVVNVLRKKKSEKSVSKEKE* |
Ga0137395_111064002 | 3300012917 | Vadose Zone Soil | MCPACIASAGVVVGSVVSTGGVSALVMKVLRRKKADKNDSKEKEQRS* |
Ga0137419_106921572 | 3300012925 | Vadose Zone Soil | MVVGSVVSTGGVTTLVMKVLRKTKSEKSTSKEKE* |
Ga0137419_112162472 | 3300012925 | Vadose Zone Soil | MCPACIASAGIVVGSVVSTGGVTALLMKVLRKKKGNKNDSKEKE* |
Ga0137416_118405762 | 3300012927 | Vadose Zone Soil | MCPACIASAGIVVGSVVSTGGVTALLMKVLKKKKGNK |
Ga0137404_120090252 | 3300012929 | Vadose Zone Soil | MVVGSVVSTGGVSALVVKVLRKKKSEKSVSKEKE* |
Ga0137407_101370762 | 3300012930 | Vadose Zone Soil | MCPACIASAGIVAGSVVSIGGVTALVMKVLRRKKGEKSDSKERE* |
Ga0137410_100071797 | 3300012944 | Vadose Zone Soil | MCPACIASAGIAVGSVVSTGGVTALVMKVLKKIKSNKNDSKEKE* |
Ga0126369_100260355 | 3300012971 | Tropical Forest Soil | VVLGSAVSTGGLTALVVKVLRKKKVEKRDSKERE* |
Ga0126369_100284381 | 3300012971 | Tropical Forest Soil | MCPACVANAGVVVGSVFSTGGLTALVVKVLRKKKGEKRELKDKE* |
Ga0126369_100416697 | 3300012971 | Tropical Forest Soil | MVFKFEGEWFMCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKGEKSDSKEKE* |
Ga0126369_100565556 | 3300012971 | Tropical Forest Soil | CMASAGLVAGSVVSGGGVTALLVKVLRKKESEKSDSKEKGDSKEKE* |
Ga0126369_101057853 | 3300012971 | Tropical Forest Soil | MCPACIASATVLLGGAVSTGGLTALTLKVLRKKKGEKSELKEKE* |
Ga0126369_105009942 | 3300012971 | Tropical Forest Soil | VVLGSAVSTAGLTALVVKVFRKKKVEKSDSKEKE* |
Ga0126369_113165062 | 3300012971 | Tropical Forest Soil | MVLGSMVSAGGLTALVVTVLGKKKREKSDSKEKE* |
Ga0181521_100155526 | 3300014158 | Bog | MASATVVVGGVVSTGGVTALLVKVLGRKKKDEKSNSKKER* |
Ga0181529_101074482 | 3300014161 | Bog | MASAGVVVGSVVSTGGLTALALTILRKRKAGNRDSKEKERTS* |
Ga0181528_100423173 | 3300014167 | Bog | MCPACLASAGAVVGSVVSTGGLTALVAKVLRKKKGEKSDPKEKE* |
Ga0182019_100299682 | 3300014498 | Fen | MASAGLVVGSAVSTGGLTALVLKVLRKKKVEKDDSKAKEQ* |
Ga0137412_102754071 | 3300015242 | Vadose Zone Soil | MCPACIASAGVVVGSVVSTGGLTALAMKVLRKKKGEKSDSKEKEKE* |
Ga0132258_104713672 | 3300015371 | Arabidopsis Rhizosphere | MAAIVIGGVVSTGGLTALAVKVFRKNKGEKNDSKEKE* |
Ga0182033_108054102 | 3300016319 | Soil | MVLIWKECFMCPACVASAGVVVGSVVSTGGLSALILRVLRKKNSEKSDSKEKE |
Ga0182034_100623274 | 3300016371 | Soil | GGKKFAVGGSMCPACFANAGMVLGSMVSAGGLTALVVTVLGKKKREKSDSKEKE |
Ga0182034_120654842 | 3300016371 | Soil | MCPACLASAGVVLGSVVSTGGLTALLLTVMGKKKREKSDSKKKE |
Ga0182038_100236934 | 3300016445 | Soil | MCPACLASAGVVLGSVVSSGGLTALLLTVLGKKKREKSDSKKKE |
Ga0187802_100218472 | 3300017822 | Freshwater Sediment | MCPACIASAGVVVGSAVSTGGLTALVMKVLRKKKGEKSESQKQEKE |
Ga0187802_103004412 | 3300017822 | Freshwater Sediment | MCPACMASAGLVVGSVVSSGGVSALLVKVLRKKKGEKNASTKEGKE |
Ga0187818_100507383 | 3300017823 | Freshwater Sediment | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKQKE |
Ga0187818_100676122 | 3300017823 | Freshwater Sediment | MCPACIASATVVVGSAVSTGGLTALVVKVLRKKKSEKSDSKEKE |
Ga0187820_10918042 | 3300017924 | Freshwater Sediment | MCPACAAMAAVVVGGVVSTGGLTALVVKVLRKKKSKDASKRQGVKV |
Ga0187806_13748901 | 3300017928 | Freshwater Sediment | MCPACIASATVVVGSAVSTGGLTALVVKVLRKKKGEKSDSKEKE |
Ga0187825_101243934 | 3300017930 | Freshwater Sediment | MCPACAVSAGLVVGSVVSTGGLTAVVLKVLGKKKGEKSNSKGK |
Ga0187801_102537952 | 3300017933 | Freshwater Sediment | MCPACIASAGVVVGSVVSTGGLTALVMKVLRKKKSGKSESQNQEKEREL |
Ga0187801_102938472 | 3300017933 | Freshwater Sediment | MCPACIASAGVVVGSVVSTGGLTALVVKVLRKKKGEKSDSKQKE |
Ga0187801_105176212 | 3300017933 | Freshwater Sediment | MCPACIASAGVVVGSAVSTGGLTALVMKVLRKKKGEKSESQKLEKE |
Ga0187819_100379865 | 3300017943 | Freshwater Sediment | MCPACMASAGLVVGSVVSSGGVSALLVKVLRKKKGEKNPSTKEGKE |
Ga0187819_100836382 | 3300017943 | Freshwater Sediment | MCPACIASATVVVGSAVSTGGLTALVVKVLRKKKGEKSDSQEKE |
Ga0187819_107706002 | 3300017943 | Freshwater Sediment | MCPACIASAGVVVGSAVSTGGLTALVMKVLRRKKGEKSESQKLEKE |
Ga0187847_103979302 | 3300017948 | Peatland | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSESKEKE |
Ga0187817_101196491 | 3300017955 | Freshwater Sediment | MCPACIASATVVVGSAVSTGGLTALVVKVLRKKKGENSNSKEKEQAS |
Ga0187817_101209673 | 3300017955 | Freshwater Sediment | MCPACIASATVMVGSAVSTGGLTALVVKVLRKKKSEKSDSKEKE |
Ga0187779_100060982 | 3300017959 | Tropical Peatland | MCPACVATAGVVLGSMVSTGGLTALVVTVLGKKKREKSDSKEKE |
Ga0187779_105879062 | 3300017959 | Tropical Peatland | KEVSMCPACRASAGLVVGGVVSSGGVTALLVKVLRKKKNEKSDSKEQE |
Ga0187779_106999731 | 3300017959 | Tropical Peatland | VGGSMCPACLASAGVVLGSTVSTGGLTALVVTVLRKKKREKSDSKEKE |
Ga0187778_100274696 | 3300017961 | Tropical Peatland | MCPACLASAGVVLGSTVSTGGLTALVVTVLRKKKREKSDSKEKE |
Ga0187778_100869691 | 3300017961 | Tropical Peatland | VPNMRLASATVVVGSAVSTGGLTALIVKVLGQKKGEKSGLKEDLKGKE |
Ga0187778_103144352 | 3300017961 | Tropical Peatland | MCPACVATAGVVLGRMVSTGGLTALVVTVLGKKKREKSDSKEKE |
Ga0187776_102030901 | 3300017966 | Tropical Peatland | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKSESKEKE |
Ga0187783_100115407 | 3300017970 | Tropical Peatland | MCPACMASAGLLAGGVVSSGGVTALLVKVLRKKKGEKSDSKEKE |
Ga0187783_100276554 | 3300017970 | Tropical Peatland | MCPACLASAGVVLGSTISTGGLTALVMTVLAKKRREKNNSKEKV |
Ga0187783_100690393 | 3300017970 | Tropical Peatland | MCPACMASAGLVVGGVVSSGGVTALLVKVLRKRKGEKSDSKEKE |
Ga0187783_102529122 | 3300017970 | Tropical Peatland | MCPACLASAGLLVGGVVSSRGVTALLVKVLRKKKGEKSDSKEKEKE |
Ga0187783_106090532 | 3300017970 | Tropical Peatland | MCPVCVASAGVVLGSAISTGGLTALLVKVLCKKKVEKSNSRSEQIEVKE |
Ga0187783_109077812 | 3300017970 | Tropical Peatland | MCPACLASAGVVLGSTLSTGGLTALVMTVLGKKKREKNNSKEKG |
Ga0187783_112847712 | 3300017970 | Tropical Peatland | MCPACVACAGAVLGSTVSTGGLTALVVTVLRKKKREKSDAKEREKE |
Ga0187781_1000209410 | 3300017972 | Tropical Peatland | MCPACMASAGLVVGGVVSSGGVTALLVKVVRKKKGEKNDSKEKE |
Ga0187781_1000648410 | 3300017972 | Tropical Peatland | MCPVCMASAGVVIGSAVSTGGLTALVVKVLRKKKGEKSDSREKE |
Ga0187781_100813304 | 3300017972 | Tropical Peatland | MCPACVACAGAVLGGTVSTGGLTALVITVLRKKKREKSDAQEREKE |
Ga0187781_104007472 | 3300017972 | Tropical Peatland | MCPVCMASAGVVVGSAVSTGGLTALVVKVLRKKKSEKNESKEKE |
Ga0187781_114377342 | 3300017972 | Tropical Peatland | MCPACMAGAGLVLGGVVSSGGVTALLVKVLRKKENEKSDSKEKE |
Ga0187777_111730942 | 3300017974 | Tropical Peatland | VASAGVVLGSAVSTGGLTALVVKVLRKKKGAKSDLKEKE |
Ga0187782_101295403 | 3300017975 | Tropical Peatland | MCPACMASAGLLAGGVVSSGGVTALLVKVLRKKKGEKSDSKEKG |
Ga0187782_103325843 | 3300017975 | Tropical Peatland | NAIRSKEVSMCPACMASAGLVVGGVVSSGGVTALLVKVLRKKKGEKSDSKEKE |
Ga0187782_104956362 | 3300017975 | Tropical Peatland | MCPACVACAGAVLSGTVSTGGLTALVVTVLRKKKREKSDAKEREKE |
Ga0187782_105164753 | 3300017975 | Tropical Peatland | MCPACMASAGLVVGGVVSSGGVTALLVKVLRKKKGEKSDSKEKE |
Ga0187782_114502251 | 3300017975 | Tropical Peatland | MCPVCMASTGVVVGSAVSTGGLTALVVKILRRAKKSESKEKE |
Ga0187782_115139652 | 3300017975 | Tropical Peatland | NAIRSKEVSMCPACMASAGLVVGGVVSSGGVTALLVKVLRKKKGEKTDSKEKE |
Ga0187816_101432682 | 3300017995 | Freshwater Sediment | MCPACIASATVVVGSAVSTGGLTALVVRVLRKKKGENSNSKEKEQAS |
Ga0187767_100492352 | 3300017999 | Tropical Peatland | MCPACLASAGVVLGSVVSTGGLTALLLTVLGKKKREKSDSKEKE |
Ga0187805_100604272 | 3300018007 | Freshwater Sediment | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKNDSKQKE |
Ga0187863_100182354 | 3300018034 | Peatland | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKGDPKEKE |
Ga0187863_100860604 | 3300018034 | Peatland | MCPTCLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSESKEKE |
Ga0187863_101451033 | 3300018034 | Peatland | MCPACLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSDSKEKE |
Ga0187851_106257142 | 3300018046 | Peatland | GTMCPTCLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSESKEKE |
Ga0187784_1001121710 | 3300018062 | Tropical Peatland | MCPVCMASAGVVIGSAVSTGGLTALVVKVLRKKKGEKSDSKEKE |
Ga0187784_104423482 | 3300018062 | Tropical Peatland | MCPACLASAGLVVGGVVSSGGVTALLVKVLRKKKGEKTDSKEKE |
Ga0187784_115468752 | 3300018062 | Tropical Peatland | MCPACMASAGLVVGGVVSSGGVTALLVKVLRKKKNEKSDSKEKG |
Ga0187772_100225076 | 3300018085 | Tropical Peatland | MCPVCMAGAGAIVGGVVSTGEVTALVVTILRKNKTEKNDSKKEQ |
Ga0187772_100480534 | 3300018085 | Tropical Peatland | MCPVCIANAGVLVAGAVSTGGVSALVAKILHKKIKREVSNSKTKEQ |
Ga0187772_105378242 | 3300018085 | Tropical Peatland | MCPACIASAGVVVGSAVSTGGLTALVLKVLRKKKGEKSDSKEKE |
Ga0187772_110019052 | 3300018085 | Tropical Peatland | MCPACMAGAGLVLGGVVSSGGVTALLVKVLRKKKNEKSDSKEKE |
Ga0187771_101046363 | 3300018088 | Tropical Peatland | MCPACIATAGVVVGSVVSTGGLTAMVAKVLRKKKAEQSDTKEKE |
Ga0187770_101583042 | 3300018090 | Tropical Peatland | MCPVCMASAGVVVGSAVSTGGLTALVVKVLRKKKGEKNDSREKE |
Ga0066662_110843912 | 3300018468 | Grasslands Soil | MVVGSVVSTGGVTALVMKVLRKKKGGKSTSKEKEQ |
Ga0066662_118124022 | 3300018468 | Grasslands Soil | MCPACAASAGLVVGSVVSTGGLTALIARVLRRKKIQKRNSKEKES |
Ga0181508_14600621 | 3300019256 | Peatland | MCPACLASAGAVVGSVVSTGGLTALVAKVLRKKKGEKSDPKEKE |
Ga0137408_14225092 | 3300019789 | Vadose Zone Soil | MCPACIATAGIVAGSVVSTGGVTALVMKVLRRKKDQKSGSKEKEQPS |
Ga0210407_103197283 | 3300020579 | Soil | PACLASVGLVVSGMVSTGGVSALVVKVLRKKKAEQNRTKEENDSKAKER |
Ga0210403_100370465 | 3300020580 | Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKNDSKKKE |
Ga0210399_100087399 | 3300020581 | Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRRKKGEKNDSKKKE |
Ga0210399_100696811 | 3300020581 | Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKNDSKQKE |
Ga0210399_101767192 | 3300020581 | Soil | MSGSDLKEKSMCPACIASAGVVVGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE |
Ga0210404_101629743 | 3300021088 | Soil | MCPACIASAGMVVGSVVSTGGLTALVMKVLRKKKGEKSDSKEKE |
Ga0210396_100562612 | 3300021180 | Soil | MCPACIASAGVVVGSVVSTGGLAALVARVLRKKKGEKGDSKKKE |
Ga0210388_115004812 | 3300021181 | Soil | MCPLCVASASVVMGSIVSGGGLTALAVKLLRQKKIEKNNSNV |
Ga0210383_100627892 | 3300021407 | Soil | MCPACLASVGLVVSGMVSTGGVSALVVKVLRKKKAEQNRTKEENDSKAKER |
Ga0210394_100560013 | 3300021420 | Soil | MCPACIASAGVVVGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE |
Ga0187846_102238381 | 3300021476 | Biofilm | MCPACVASAGVLVSSVVSTGGLTALVVKVLRKKKGEKSDSKEKE |
Ga0210402_110182492 | 3300021478 | Soil | MCPACMASAGVVVGGIVSTGGVTALVAKILGKKKNSKSNPK |
Ga0126371_1000348911 | 3300021560 | Tropical Forest Soil | MCPACVASAGVVVGGVVSTGGLSALVLKVLRKKKGEKSDSKEKE |
Ga0126371_100035917 | 3300021560 | Tropical Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKRELKDKE |
Ga0126371_100350476 | 3300021560 | Tropical Forest Soil | MCPACVASAAMVAGSVVSGGGVTALLVKVLRKKKSEKSDRTKVEKE |
Ga0126371_100400917 | 3300021560 | Tropical Forest Soil | MCPACIASATVVVGSAVSTGGLTALVWRVLRKKKGEKSNSQEKE |
Ga0126371_100869745 | 3300021560 | Tropical Forest Soil | MCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKGEKSDSKEKE |
Ga0126371_101040115 | 3300021560 | Tropical Forest Soil | MCPACFASAALVVGGVISTGGLTAVAMKVLRKKKTEKSDSKEKE |
Ga0126371_101761052 | 3300021560 | Tropical Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKSELKDKE |
Ga0126371_106425081 | 3300021560 | Tropical Forest Soil | MCPACVASAGVVLGSAVSTAGLTALVVKVFRKKKVEKSDSKEKE |
Ga0126371_113174631 | 3300021560 | Tropical Forest Soil | MASAGVVLGSAVSTGGLTALLVKVLRKKKGEKSESKDKE |
Ga0126371_115032912 | 3300021560 | Tropical Forest Soil | MCPACVANAGVVVGSVFSTGGLTALVVKVLRKKKGE |
Ga0126371_135657041 | 3300021560 | Tropical Forest Soil | MCPACIASAGVVVGSVVSTGGLTALVVKVLRKKKDEKSDSKDKE |
Ga0242663_10163072 | 3300022523 | Soil | MCPACISSAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE |
Ga0212123_101205262 | 3300022557 | Iron-Sulfur Acid Spring | MCPACFASAGVVVGSAVSTGGLTALVMKVLRKKKGEKNELKEKE |
Ga0137417_10415442 | 3300024330 | Vadose Zone Soil | MCPACIASAGMVVGSVVSTGGVTALVMRVLRKKKGEKSDSKEKE |
Ga0137417_12360186 | 3300024330 | Vadose Zone Soil | IASAGMVVGSVVSTGGVTALVMRVLRKKKGEKSDSKEKE |
Ga0207692_107276401 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLMCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE |
Ga0207692_108430082 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAIVVGGVVSTGGLTALAVKVLRRNKGEKSDSKEKE |
Ga0207685_103320331 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACVASAGVVLGSAVSTGGLTALVVRVLRKKKVQKSD |
Ga0207699_100632973 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACVASAGVVVGSVVSTGGLSALVLRVLRKKKSEKSNSKEKE |
Ga0207699_102989432 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MCPACVASAGVVVGSVLSTGGLTALVAKVLRKKKSEKSNSKEKE |
Ga0207645_110098541 | 3300025907 | Miscanthus Rhizosphere | GIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ |
Ga0207690_101845212 | 3300025932 | Corn Rhizosphere | MCPACIATVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ |
Ga0207665_102181282 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLFQEENMCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE |
Ga0207640_110459352 | 3300025981 | Corn Rhizosphere | ATVGIVVGSVVSAGGATALVMKVLRSKKTEKSISKEKEQ |
Ga0209377_12013082 | 3300026334 | Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSK |
Ga0209056_105368821 | 3300026538 | Soil | MCPACIASAGVVAGSVVSTGGITALVMKVLRKKKGGKNYLK |
Ga0207802_10199812 | 3300026847 | Tropical Forest Soil | PACVASAGVLVSSVVSTGGLTALIVRVLRKKKGQKSDSKEKE |
Ga0207805_10259402 | 3300026887 | Tropical Forest Soil | MCPACIASAGMVVGSAVSTGGLTALVVRILRKKKAEQTGSKKEEQ |
Ga0209004_10018163 | 3300027376 | Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVMKVLRKQKSGKSESQNQEKEREL |
Ga0209622_10597372 | 3300027502 | Forest Soil | MCPACVASAGVVLGSAVSTGGLTALVVKVLRKKKGEKNDSTKEERE |
Ga0208988_10393011 | 3300027633 | Forest Soil | MCPACIASAGMVVGSVVSTGGVTALLVKVLRKNKGEKSDSKEKE |
Ga0209656_100455824 | 3300027812 | Bog Forest Soil | MCPVCMASAGLLAGSVVSTGGLTALVVKVLSRKKGEKNDSKIKEQGI |
Ga0209040_101648173 | 3300027824 | Bog Forest Soil | MCPACLASAGVVVGSALSTGGLTALVVKVFRMKKGGKNESKEKE |
Ga0209060_1000172620 | 3300027826 | Surface Soil | MCPACVASAGVVVGSVVSTGGLSALVLKVLRKKKGERSDSKEKE |
Ga0209060_100506512 | 3300027826 | Surface Soil | MCPACIASAGVMVGSAVSTGGLTALVVRVLRKKKIDQSNPKAKE |
Ga0209060_104166221 | 3300027826 | Surface Soil | MCPACLATAGIVIGSVVSTGGVAALVAKLIGKRKGEKNDSKTKEQ |
Ga0209060_104933272 | 3300027826 | Surface Soil | MCPACIASAGMVVGSAVSTGGLTALVVKVLRKKKGEKNDSKEKE |
Ga0209580_1000015434 | 3300027842 | Surface Soil | MCPACIASAGVVVGSVVSTGGLTALVVRVLRKKKGEKSDSKQKE |
Ga0209580_100084196 | 3300027842 | Surface Soil | MCPACMASAGIIVGSVVSTGGLTALVAKILRKKKVETNDSKAKEQ |
Ga0209580_101209993 | 3300027842 | Surface Soil | MCPACIASATVVVGSVVSTGGLTALVVKVLRKKKVEKSNSKEKE |
Ga0209580_101594341 | 3300027842 | Surface Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKK |
Ga0209580_104874312 | 3300027842 | Surface Soil | ERSKEVPMCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE |
Ga0209580_104935251 | 3300027842 | Surface Soil | MCPACIASATVVVGSVVSTGGLTALVVKVLRKKKVE |
Ga0209517_1000209427 | 3300027854 | Peatlands Soil | MCPVCMASATVVVGGVVSTGGVTALLVKVLGRKKKDEKGNSKKER |
Ga0209166_10000041114 | 3300027857 | Surface Soil | MCPACAATAAVVVGSVVSTGGLTALVAKVLRKKKGEKSDSKEKE |
Ga0209166_100068542 | 3300027857 | Surface Soil | MCPACVASAGVVVGSVVSTGGLTALLAKVLRKKKGEKSNSKEKE |
Ga0209167_100386613 | 3300027867 | Surface Soil | MCPACLASAGVVVGSAVSTGSLTALVVKVLRKKKSEKSDSKEKE |
Ga0209167_102374632 | 3300027867 | Surface Soil | MCPTCIASAGVVVGSVVSTGGLTALLAKVLRKKKGEKSNSKEKE |
Ga0209579_10000036152 | 3300027869 | Surface Soil | MCPACLATAGIVIGSVVSTGGVAALVAKMIGKRKGEKNDSKMKEQ |
Ga0209579_100081584 | 3300027869 | Surface Soil | MCPACIASAGVVVGSAVSTGGLTALFVKIFRKKTNVKNNSKEKE |
Ga0209579_107917822 | 3300027869 | Surface Soil | MCPACIASAGVVLGSAVSTGGVTALVLKVFRKKKIEKSD |
Ga0209465_101991372 | 3300027874 | Tropical Forest Soil | QEVGMCPACVASAGVVLGSAVSTAGLTALVVKVFRKKKVEKNDSKEKE |
Ga0209465_102615292 | 3300027874 | Tropical Forest Soil | MASAGLVAGSVVSGGGVTALLVKVLRKKESEKSDSKEKGDSKEKE |
Ga0209465_105213022 | 3300027874 | Tropical Forest Soil | EVGGVMCPACIASATVVLGSAVSTGGLTALVVKVLRKKKGEKSESKEKE |
Ga0209380_100527001 | 3300027889 | Soil | CLASAGVVVGSVVSTGGLTALVAKVLRKKKGEKGDPKEKE |
Ga0209067_100104013 | 3300027898 | Watersheds | MCPVCMAGAGLVAGSVVSTGGLTALVVKVLSRKKGEKNDSKSKEQGS |
Ga0209067_103634662 | 3300027898 | Watersheds | MASAGLIAGSVVSTGGLTALVVKVLGKKKVEKSDSKTKEQGS |
Ga0209067_105605312 | 3300027898 | Watersheds | MSLFLEENMCPACLASAGVVVGSVVSTGGLTALVARVLRKKKGEKSNSKEKEKE |
Ga0209488_104842922 | 3300027903 | Vadose Zone Soil | MCPACIASAGIVVGSVVSTGGVTALVMKVLRKKKGEKSDSKEKE |
Ga0209006_100830701 | 3300027908 | Forest Soil | RSMCPVCMASAGMVVAGTVSTGGLTALVARILRKKKREKSSSKSKEQGR |
Ga0209583_100708242 | 3300027910 | Watersheds | MCPACFASAGLVVGSVISTGGLTALVARVLRKKKVEKNDSQQKEQGS |
Ga0209583_101825782 | 3300027910 | Watersheds | MCPACLASAGVVLGSVVSTGGVTALVMKVLRKKKVEKNISKEKEQ |
Ga0209698_1000124012 | 3300027911 | Watersheds | MCPACIASAGVVVGSVVSTGGLTALVAKVLRKKKGQKSDSKQKE |
Ga0209698_100056289 | 3300027911 | Watersheds | MASAGLVVGSILSTGAVAALVAKVLRQTNNSKSNSKAKEQ |
Ga0209698_101707353 | 3300027911 | Watersheds | MCPVCMASAGLVAGSVVSTGGLTALVVRVLSKKKGEKNDSKKEQGS |
Ga0209698_104331692 | 3300027911 | Watersheds | MCPGCIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKKKE |
Ga0209698_110626062 | 3300027911 | Watersheds | MCPVCMASAGLVAGSVMSTGGLTALVVRVLSKKKGEKKNSKAEEQAS |
Ga0209062_10023416 | 3300027965 | Surface Soil | MCPACIASAGMAVGGAVSSGGLTALVMKVLRKKKIEKSVSKEKE |
Ga0209168_1000007575 | 3300027986 | Surface Soil | MCPACIASAGVVVGSAVSTGGLTALIVKVLRKKKGEKHDSKEKE |
Ga0209168_1000089712 | 3300027986 | Surface Soil | MCPACLAAAGIVVGGVISTGGLTALAVKVLRKKKGEKSESKEKE |
Ga0209168_100111702 | 3300027986 | Surface Soil | MCPACVASAGVVVGSVLSTGGLTALVAKVLRKKKGEKSDSKEKE |
Ga0302225_103436222 | 3300028780 | Palsa | MCPVCMASAGVVVGSAVSTGGLTALAVRILRRTKKNESKEKE |
Ga0307504_100075734 | 3300028792 | Soil | MCPACIASAGVVVGSVVSTGGLTALVAKVLRKKKGEKSNSKKKE |
Ga0265338_100233316 | 3300028800 | Rhizosphere | MCPACAAMAATVVGSVVSTGGLTALAVKVLRKKKSDSKEKE |
Ga0311339_1000462517 | 3300029999 | Palsa | MCPVCMASAGVVVGSAVSTGGLTALAVRILLRTKKNESKEKE |
Ga0310915_103704292 | 3300031573 | Soil | MCPACVANAGVLVGSVVSTGGLTALVVKVLRKKKGKKSDLKEKE |
Ga0310686_10306522810 | 3300031708 | Soil | MCPVCMASAAVVVGSAVSTGGVTALAVKVFRIKKTEKRNSKEKE |
Ga0310686_1084336352 | 3300031708 | Soil | MCPVCMASAGLVAGSVVSTGGLTALFVKVFSKKKGEKNDSKT |
Ga0307476_1000008550 | 3300031715 | Hardwood Forest Soil | MCPGCMASAGLVAGSVVSTGGLTALVVKVFSKKKGEKNDAKTKEQGS |
Ga0307476_101475403 | 3300031715 | Hardwood Forest Soil | MCPACMASAGIIVGSVVSTGGVTALVAKILRKKKGETNDSKAKEQ |
Ga0307476_103125002 | 3300031715 | Hardwood Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVMKVLRKKKSGKSESQNQEKEREL |
Ga0307474_112330782 | 3300031718 | Hardwood Forest Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLREKKGEKSDSKKKE |
Ga0307469_100724242 | 3300031720 | Hardwood Forest Soil | MCPACLASAGIVLGSVVSTGGLTALVMKVLRKKKGEKSDSKGRE |
Ga0307469_102023602 | 3300031720 | Hardwood Forest Soil | MCPACLASAGIVLGSVVSTGGVTALVMKVLRKKKGEKSDSKG |
Ga0307469_103639352 | 3300031720 | Hardwood Forest Soil | MCPACIASAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKEKE |
Ga0307468_1000538853 | 3300031740 | Hardwood Forest Soil | MCPACLASAGIVLGSVVSTGGLTALVMKVLQKKKGEKSDSKGRE |
Ga0306918_103828111 | 3300031744 | Soil | ACLASAGVVLGSVVSSGGLTALLLTVLGKKKREKSDSKKKE |
Ga0306918_115763632 | 3300031744 | Soil | MCPACFANAGMVLGSMVSAGGLTALVVTVLGKKKHEKSDSKEKE |
Ga0307477_101682763 | 3300031753 | Hardwood Forest Soil | MASAGLVAGSVVSTGGLTALVVKVFGKKKGEKNDSKTKEQGS |
Ga0307475_102927003 | 3300031754 | Hardwood Forest Soil | MCPACIASAGVVVGSVVSTGGLAALVARVLRKKKGDSKKKE |
Ga0318576_104543302 | 3300031796 | Soil | SRRCLMCPACVASAGVVVGSVVSTGGLTALVATVLRSKKKSEKSDSKEKE |
Ga0307473_105763242 | 3300031820 | Hardwood Forest Soil | MCPACLASAGVVVGSVISTGGLTALVAKVLRKKKGEKSNSKEKE |
Ga0307478_100764536 | 3300031823 | Hardwood Forest Soil | MCPACIASAGVVVGSAVSTGGLTALVMKVLRKKKSGKSESQNQEKERES |
Ga0307478_101733321 | 3300031823 | Hardwood Forest Soil | SAGVVVGSAVSTGGLTALVMKVLRKKKSGKSESQNQEKEREL |
Ga0306925_102381564 | 3300031890 | Soil | MCPACLASAGVVLGSVVSTGGLTALLLTVLGKKKREKSDSKKKE |
Ga0306925_105346013 | 3300031890 | Soil | CVASAGVVVGSVVSTGGLTALVATVLRSKKKSEKSDSKEKE |
Ga0306925_119937882 | 3300031890 | Soil | MCPGCAAMAAIVVGGVVSTGGLTALAVRVLRKNKGEKSDSKEKE |
Ga0306921_103895374 | 3300031912 | Soil | MCPACLASAGVVLGSVVSTGGLTALLLTVLGKKKREKSDSKK |
Ga0306921_107894082 | 3300031912 | Soil | MCPACVASAGVVVGSVVSTGGLTALVATVLRSKKKSEKSDSKEKE |
Ga0308175_1023895712 | 3300031938 | Soil | MASAGIVVGSVVSTGGVTALLAKVLRKKKSNDSKAKEQ |
Ga0308174_110943982 | 3300031939 | Soil | MCPACLASAGVVVSSVVSTGGLTTLVVKVLRKKKGQQSDRKEKEQ |
Ga0310913_109359012 | 3300031945 | Soil | EVGMCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKRELKDKE |
Ga0310910_102964701 | 3300031946 | Soil | FEVGGSMCPACLASAGVVLGSVVSSGGLTALLLTVLGKKKREKSDSKEKE |
Ga0307479_100112331 | 3300031962 | Hardwood Forest Soil | MCPVCMASAGLVAGSVVSTGGLTALVVKVFGKKKGEKNDSKTKEQGS |
Ga0308176_106051113 | 3300031996 | Soil | MCPACIASVGIVVGSVVSAGGATALVMKVLRSKKTEKS |
Ga0306922_100588055 | 3300032001 | Soil | MCPACLASAGVVLGSVVSSGGLTALLLTVLGKKKREKSDSKEKE |
Ga0306922_103119491 | 3300032001 | Soil | MCPACIASAGVVVGSAVSTGGLTALVVKVLRKKKGEKRELKD |
Ga0311301_123394912 | 3300032160 | Peatlands Soil | MCPVCMASTGLVAGSVVSTGGLTALVVKVLSRKKGEKNDSKIKEQAS |
Ga0307472_1000668543 | 3300032205 | Hardwood Forest Soil | MCPACLASAGVVVGSVISTGGLTALVAKVLRKKKGEKSNSKERSRR |
Ga0335085_1000009864 | 3300032770 | Soil | MCPACVASAGMLVGGVVSTGGLTALVVKVLRKKKVEKSELKEKE |
Ga0335085_1000972020 | 3300032770 | Soil | MCPACIASATVVLGSAVSTGGLTALVVKVLRKKKGEKSESKEKESV |
Ga0335085_100121184 | 3300032770 | Soil | MCPGCAAMAAIVVGGVVSTGGLTALAVKVLRKNKSEKSDSKEKE |
Ga0335085_105847203 | 3300032770 | Soil | MCPACAAMAAIVVGGVVSTGGLTALAVKVFRKNKGEKSDSKEKE |
Ga0335085_120546502 | 3300032770 | Soil | MASATVALGSAASTGGLTALIVKVLRKKKGEKSESKEKE |
Ga0335082_1000023228 | 3300032782 | Soil | MCPGCAAMAAIVVGGVVSTGGLTALAVKVLRKHKGEKNDSKEKE |
Ga0335082_101134423 | 3300032782 | Soil | VCPACIASATVVLGSAVSTGGLTALVVKVLRKKKGEKSDSKEKE |
Ga0335082_102022971 | 3300032782 | Soil | MAAIVVGGVVSTGGLTALAVKVLRKNKSEKSDSKEKE |
Ga0335082_103418142 | 3300032782 | Soil | MCPACAAMAAIVVGGVVSTGGLTALAVKVLRKNKGEKSDSKEKE |
Ga0335079_100001547 | 3300032783 | Soil | MCPACIASAGMVVGSVVSTGGVTALVMKVLRKKKSEKTVSKEKE |
Ga0335079_100166778 | 3300032783 | Soil | MCPACLASAGVVLGSVVSTGGLTALLVTVLGKKRREKSDSKEKE |
Ga0335079_101371964 | 3300032783 | Soil | MCPACVASATIVVSSAVSTGGLAALVIKVLRKKKDERGESKEKE |
Ga0335079_104773352 | 3300032783 | Soil | MCPACLASAGVVLGSVVSTGGLTALLVTVLGKKKREKSDSKQKE |
Ga0335079_107174872 | 3300032783 | Soil | GAMSRFAGEKFMCPACIASAGMVVGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE |
Ga0335079_114938222 | 3300032783 | Soil | MCPACVASAGVVVGSVISTGGLSALIVKVLRKKKGEKSDSKEKE |
Ga0335078_102488141 | 3300032805 | Soil | EVPMCPACVASATIVVSSAVSTGGLAALVIKVLRKKKDERGESKEKE |
Ga0335078_106073902 | 3300032805 | Soil | MCPVCMASAGLVVGSVVSTGGLTALVAKVLGKKKGEKNDSKGKEQGS |
Ga0335078_106224402 | 3300032805 | Soil | MCPACMASAGVIVGSVVSTGGVTAVLAKILRTKKSGNNVSKQDETNAKEK |
Ga0335078_117943721 | 3300032805 | Soil | MAAIVVGGVVSTGGLTALAVKVLRKNKGEKSDSKEKE |
Ga0335080_10000018161 | 3300032828 | Soil | MCPACIASAGVVVGSAVSTGGLTALVLRVLRKKKVEKSDSKEKE |
Ga0335080_100792746 | 3300032828 | Soil | MCPACIASAGMVVGSAVSTGGLTALVVRVLRKKKGEKSDSKEKE |
Ga0335080_103349983 | 3300032828 | Soil | MCPACMASAGLVVGSVVSGGGVTALVVKVLGRKKKDEKIDLNKEKES |
Ga0335080_108214802 | 3300032828 | Soil | MCPACVASATVVVGSVVSGGGVAAVVAKLLGKKKAATKKNEK |
Ga0335070_1000446317 | 3300032829 | Soil | MCPACIAGAGVVVGSAISTGGLTALIVKVLRKKKGEKSDSKEKE |
Ga0335070_100335033 | 3300032829 | Soil | MCPACIASAGMVIGSAVSTGGLTALVVKVLRKKKGEKSESKEKE |
Ga0335081_101616164 | 3300032892 | Soil | MCPACVASAGVVLGSAVSTGGLTALVVKVLRKKKREQSDSKEKE |
Ga0335069_100197494 | 3300032893 | Soil | MCPACAASATVVVGSVVSGGGVAAMVAKLLGKKKPDAKKADK |
Ga0335069_100468532 | 3300032893 | Soil | MCPACVASAGVVVGSVVSSGGLTALVVKLVRKKKTKKNDSKEKE |
Ga0335069_104824573 | 3300032893 | Soil | MCPACIASAALVMGGVVSSGGVTALLVKVLRKKKGEKSISKEKE |
Ga0335069_111222642 | 3300032893 | Soil | MCPGCAAMAAIVVGGVVSTGGLTALAVKVFRKNKSDKSDSKEKE |
Ga0335071_102606103 | 3300032897 | Soil | MCPACAAMAPIVVGGVVSTGGLTALAVKVLRKNKKSEAKEKE |
Ga0335071_108545822 | 3300032897 | Soil | MCPACVASAGVVLGSAVSTGGLAALIVRVLRKKKVEKSDLKERE |
Ga0335072_103614861 | 3300032898 | Soil | MCPACLAAAGIVVGGVISTGGLTALAVKVLRKKKG |
Ga0335083_1002343411 | 3300032954 | Soil | MCPACAATATVVIGSVVSTGGVTALVVKIFGKRNSSKADSKTKE |
Ga0335083_101302623 | 3300032954 | Soil | MCPACLAAAGIVIGSVVSTGGVAVLVAKMIGKRKGEKNDSKTKEQGL |
Ga0335076_1000130914 | 3300032955 | Soil | MCPACAASAGVMIGGVLSTGGVTALVARVLGKKKNTKSDSKKER |
Ga0335076_101800682 | 3300032955 | Soil | MCPTCVASATVVVGSVVSGGGVAAVVAKLLGKKKAATKKNEK |
Ga0335084_101493393 | 3300033004 | Soil | MCPACIASAGVIVGSAVSTGGLTALVVRVLRKKKCEKSDSKEKE |
Ga0335084_102479371 | 3300033004 | Soil | MCPGCAAMAAIVVGGVVSTGGLTALAVKVVRKNKGEKSDSKEKE |
Ga0335084_108756021 | 3300033004 | Soil | ASAGMVVGSVVSTGGVTAVVMKVLRRKKGKKSVSKEKEQ |
Ga0335084_112595082 | 3300033004 | Soil | MCPACIASATVVVGSAVSTGGLTALVVKVLRKQKGEKSNSKEKE |
Ga0335073_101250005 | 3300033134 | Soil | MCPFCLATAGIVAGSVISTGGLAALAVKVLRKKKDEKSESKEKE |
Ga0335073_107135841 | 3300033134 | Soil | MCPGCAAMAAIVVGGVVSTGGLTALAVKVLRKNKGEKSDSKEKE |
Ga0335073_119087482 | 3300033134 | Soil | MCPFCLATAGIVAGSVISTGGLAALAVKVLRKKKDEKIESKEKE |
Ga0310914_109947391 | 3300033289 | Soil | LQEEIMCPACVANAGVLVGSVVSTGGLTALVVKVLRKKKGKKSDLKEKE |
Ga0326726_107472183 | 3300033433 | Peat Soil | MCPACIASAGVVLGSAVSTGGLTALVVKVLRKKKGK |
Ga0370492_0063296_896_1030 | 3300034282 | Untreated Peat Soil | MCPACLANAGVVVGSVVSTGGLTALVARVLRKKKGEKSDSKEKE |
⦗Top⦘ |