| Basic Information | |
|---|---|
| Family ID | F004844 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 421 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Number of Associated Samples | 287 |
| Number of Associated Scaffolds | 421 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.29 % |
| % of genes near scaffold ends (potentially truncated) | 17.34 % |
| % of genes from short scaffolds (< 2000 bps) | 82.66 % |
| Associated GOLD sequencing projects | 261 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.361 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (7.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.553 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.606 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 421 Family Scaffolds |
|---|---|---|
| PF12773 | DZR | 20.90 |
| PF00334 | NDK | 8.55 |
| PF08245 | Mur_ligase_M | 6.65 |
| PF13396 | PLDc_N | 5.70 |
| PF10458 | Val_tRNA-synt_C | 3.56 |
| PF08241 | Methyltransf_11 | 2.85 |
| PF02545 | Maf | 0.71 |
| PF13649 | Methyltransf_25 | 0.71 |
| PF01636 | APH | 0.48 |
| PF06723 | MreB_Mbl | 0.48 |
| PF13302 | Acetyltransf_3 | 0.48 |
| PF00583 | Acetyltransf_1 | 0.48 |
| PF06175 | MiaE | 0.24 |
| PF01274 | Malate_synthase | 0.24 |
| PF09924 | LPG_synthase_C | 0.24 |
| PF12911 | OppC_N | 0.24 |
| PF10150 | RNase_E_G | 0.24 |
| PF02595 | Gly_kinase | 0.24 |
| PF06971 | Put_DNA-bind_N | 0.24 |
| PF01522 | Polysacc_deac_1 | 0.24 |
| PF01019 | G_glu_transpept | 0.24 |
| PF13610 | DDE_Tnp_IS240 | 0.24 |
| PF08264 | Anticodon_1 | 0.24 |
| PF14691 | Fer4_20 | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 421 Family Scaffolds |
|---|---|---|---|
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 8.55 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.71 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.48 |
| COG4445 | tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE (synthesis of 2-methylthio-cis-ribozeatin) | Translation, ribosomal structure and biogenesis [J] | 0.48 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.24 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
| COG1929 | Glycerate kinase | Carbohydrate transport and metabolism [G] | 0.24 |
| COG2225 | Malate synthase | Energy production and conversion [C] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.36 % |
| Unclassified | root | N/A | 11.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908007|FWIRElOz_GKZ9IRQ02JVVWT | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 2124908032|Perma_A_C_ConsensusfromContig74276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 2124908039|B3_v_NODE_18523_len_1894_cov_6_930834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1944 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig26672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 2140918006|ConsensusfromContig12974 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 2140918007|ConsensusfromContig197612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 2140918025|NODE_409489_length_2008_cov_7.839143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2058 | Open in IMG/M |
| 2166559005|cont_contig00967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3248 | Open in IMG/M |
| 2170459003|FZ032L002GLVQI | Not Available | 540 | Open in IMG/M |
| 2170459003|FZ032L002JMEVM | Not Available | 509 | Open in IMG/M |
| 2170459003|FZN2CUW02IPH8B | Not Available | 518 | Open in IMG/M |
| 2170459010|GIO7OMY01APKFU | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 2170459016|G1P06HT02GX3KC | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 2189573000|GPBTN7E02IDVZL | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 2228664022|INPgaii200_c1064554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300000880|AL20A1W_1046853 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300000955|JGI1027J12803_100072059 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300001205|C688J13580_1050867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300001305|C688J14111_10178711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300001532|A20PFW1_1061769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5337 | Open in IMG/M |
| 3300001535|A3PFW1_10217589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1002 | Open in IMG/M |
| 3300001536|A1565W1_11182269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1467 | Open in IMG/M |
| 3300001538|A10PFW1_11011381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
| 3300001538|A10PFW1_11172418 | Not Available | 2171 | Open in IMG/M |
| 3300001686|C688J18823_10150302 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300001686|C688J18823_10465797 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300001686|C688J18823_10530914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300002568|C688J35102_118440301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300002568|C688J35102_118490009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300002568|C688J35102_119921687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
| 3300002568|C688J35102_120786600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1577 | Open in IMG/M |
| 3300002568|C688J35102_120886950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2030 | Open in IMG/M |
| 3300002568|C688J35102_120962082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3271 | Open in IMG/M |
| 3300004081|Ga0063454_101099587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300004081|Ga0063454_101371097 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300004479|Ga0062595_102455303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300004643|Ga0062591_100875240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300005093|Ga0062594_100314479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1202 | Open in IMG/M |
| 3300005176|Ga0066679_10366842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 942 | Open in IMG/M |
| 3300005176|Ga0066679_10927273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300005179|Ga0066684_10936772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 563 | Open in IMG/M |
| 3300005187|Ga0066675_11066086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
| 3300005293|Ga0065715_10619292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300005327|Ga0070658_10742412 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005327|Ga0070658_10927490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300005329|Ga0070683_100056062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3659 | Open in IMG/M |
| 3300005329|Ga0070683_102155373 | Not Available | 535 | Open in IMG/M |
| 3300005339|Ga0070660_101282491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005344|Ga0070661_100143234 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300005355|Ga0070671_101243899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300005434|Ga0070709_11374681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300005435|Ga0070714_100778769 | Not Available | 926 | Open in IMG/M |
| 3300005435|Ga0070714_101044786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300005435|Ga0070714_101683229 | Not Available | 620 | Open in IMG/M |
| 3300005436|Ga0070713_100882041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300005436|Ga0070713_101412012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300005437|Ga0070710_11410484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300005444|Ga0070694_100120768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1880 | Open in IMG/M |
| 3300005454|Ga0066687_10459751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300005455|Ga0070663_100360067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1180 | Open in IMG/M |
| 3300005458|Ga0070681_10442569 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005529|Ga0070741_10000221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 216785 | Open in IMG/M |
| 3300005529|Ga0070741_10000639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 120657 | Open in IMG/M |
| 3300005529|Ga0070741_10007329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 22896 | Open in IMG/M |
| 3300005529|Ga0070741_10024361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9079 | Open in IMG/M |
| 3300005529|Ga0070741_10112728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2838 | Open in IMG/M |
| 3300005529|Ga0070741_10354106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1361 | Open in IMG/M |
| 3300005529|Ga0070741_10684068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300005529|Ga0070741_10995313 | Not Available | 719 | Open in IMG/M |
| 3300005532|Ga0070739_10000776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 54847 | Open in IMG/M |
| 3300005532|Ga0070739_10008222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10773 | Open in IMG/M |
| 3300005532|Ga0070739_10012494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7856 | Open in IMG/M |
| 3300005532|Ga0070739_10028492 | All Organisms → cellular organisms → Bacteria | 4202 | Open in IMG/M |
| 3300005532|Ga0070739_10073768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2045 | Open in IMG/M |
| 3300005533|Ga0070734_10144265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1383 | Open in IMG/M |
| 3300005533|Ga0070734_10365245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 824 | Open in IMG/M |
| 3300005534|Ga0070735_10046860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2886 | Open in IMG/M |
| 3300005535|Ga0070684_100294867 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300005538|Ga0070731_10000777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 38195 | Open in IMG/M |
| 3300005538|Ga0070731_10002271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 18519 | Open in IMG/M |
| 3300005538|Ga0070731_10174531 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300005538|Ga0070731_10242772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1196 | Open in IMG/M |
| 3300005538|Ga0070731_11150582 | Not Available | 512 | Open in IMG/M |
| 3300005540|Ga0066697_10691123 | Not Available | 559 | Open in IMG/M |
| 3300005548|Ga0070665_100037861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4848 | Open in IMG/M |
| 3300005548|Ga0070665_100873290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 912 | Open in IMG/M |
| 3300005554|Ga0066661_10169971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
| 3300005555|Ga0066692_10854477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300005557|Ga0066704_10563232 | Not Available | 740 | Open in IMG/M |
| 3300005557|Ga0066704_10992451 | Not Available | 518 | Open in IMG/M |
| 3300005563|Ga0068855_100055408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4657 | Open in IMG/M |
| 3300005563|Ga0068855_100141791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2738 | Open in IMG/M |
| 3300005563|Ga0068855_100196193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2274 | Open in IMG/M |
| 3300005563|Ga0068855_100521928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1288 | Open in IMG/M |
| 3300005563|Ga0068855_101918389 | Not Available | 600 | Open in IMG/M |
| 3300005563|Ga0068855_101981008 | Not Available | 589 | Open in IMG/M |
| 3300005566|Ga0066693_10281114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300005575|Ga0066702_10020514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3215 | Open in IMG/M |
| 3300005578|Ga0068854_101810878 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005587|Ga0066654_10277521 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005587|Ga0066654_10350676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300005587|Ga0066654_10386139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 763 | Open in IMG/M |
| 3300005614|Ga0068856_100415711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
| 3300005616|Ga0068852_100866842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 919 | Open in IMG/M |
| 3300005764|Ga0066903_106977386 | Not Available | 586 | Open in IMG/M |
| 3300005885|Ga0075284_1062703 | Not Available | 538 | Open in IMG/M |
| 3300005892|Ga0075275_1089032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300006028|Ga0070717_10293932 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300006028|Ga0070717_11463391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300006034|Ga0066656_10822047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300006049|Ga0075417_10627651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300006175|Ga0070712_100443045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1080 | Open in IMG/M |
| 3300006175|Ga0070712_100749132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 836 | Open in IMG/M |
| 3300006175|Ga0070712_100904463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300006175|Ga0070712_101146044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 676 | Open in IMG/M |
| 3300006175|Ga0070712_101419648 | Not Available | 606 | Open in IMG/M |
| 3300006237|Ga0097621_100993089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300006358|Ga0068871_101077276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300006638|Ga0075522_10223522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300006755|Ga0079222_10593331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
| 3300006755|Ga0079222_12098504 | Not Available | 559 | Open in IMG/M |
| 3300006791|Ga0066653_10551544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300006794|Ga0066658_10457484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 695 | Open in IMG/M |
| 3300006804|Ga0079221_10635397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300006804|Ga0079221_10901863 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006806|Ga0079220_11440564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300006852|Ga0075433_10015712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6219 | Open in IMG/M |
| 3300006871|Ga0075434_101193908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 773 | Open in IMG/M |
| 3300006871|Ga0075434_101287068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300006881|Ga0068865_100798469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300006904|Ga0075424_100758075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1036 | Open in IMG/M |
| 3300006954|Ga0079219_12472908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300007819|Ga0104322_113265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1150 | Open in IMG/M |
| 3300007821|Ga0104323_100532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300009012|Ga0066710_100526946 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300009012|Ga0066710_102527075 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300009038|Ga0099829_10533100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300009038|Ga0099829_10913080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300009093|Ga0105240_12185695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300009093|Ga0105240_12371818 | Not Available | 549 | Open in IMG/M |
| 3300009098|Ga0105245_11143641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
| 3300009137|Ga0066709_103168492 | Not Available | 600 | Open in IMG/M |
| 3300009148|Ga0105243_10864751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300009162|Ga0075423_10539597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1228 | Open in IMG/M |
| 3300009174|Ga0105241_11729873 | Not Available | 608 | Open in IMG/M |
| 3300009177|Ga0105248_10901275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300009551|Ga0105238_11495822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
| 3300009650|Ga0105857_1181292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 603 | Open in IMG/M |
| 3300009660|Ga0105854_1000606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15783 | Open in IMG/M |
| 3300009789|Ga0126307_10031687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4069 | Open in IMG/M |
| 3300009789|Ga0126307_10087920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2455 | Open in IMG/M |
| 3300009789|Ga0126307_10500055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300009840|Ga0126313_11376979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300009840|Ga0126313_11621414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300010038|Ga0126315_10213101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300010038|Ga0126315_11113024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 534 | Open in IMG/M |
| 3300010039|Ga0126309_10013404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3437 | Open in IMG/M |
| 3300010039|Ga0126309_11126730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300010042|Ga0126314_10484926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 896 | Open in IMG/M |
| 3300010043|Ga0126380_10413910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1006 | Open in IMG/M |
| 3300010043|Ga0126380_10721023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300010044|Ga0126310_10576140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
| 3300010044|Ga0126310_11357750 | Not Available | 577 | Open in IMG/M |
| 3300010046|Ga0126384_11947422 | Not Available | 561 | Open in IMG/M |
| 3300010152|Ga0126318_10371895 | Not Available | 502 | Open in IMG/M |
| 3300010152|Ga0126318_10766292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1177 | Open in IMG/M |
| 3300010335|Ga0134063_10200435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300010361|Ga0126378_12700066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300010371|Ga0134125_10499064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1348 | Open in IMG/M |
| 3300010373|Ga0134128_12158859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300010376|Ga0126381_100877070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
| 3300010396|Ga0134126_10203622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2366 | Open in IMG/M |
| 3300010396|Ga0134126_11918368 | Not Available | 648 | Open in IMG/M |
| 3300010396|Ga0134126_12955070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300010400|Ga0134122_12669176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
| 3300010401|Ga0134121_10084708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2640 | Open in IMG/M |
| 3300010403|Ga0134123_10660272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
| 3300010937|Ga0137776_1429045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
| 3300012001|Ga0120167_1010220 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300012011|Ga0120152_1183854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
| 3300012014|Ga0120159_1110226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012198|Ga0137364_10350849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300012204|Ga0137374_10204889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1695 | Open in IMG/M |
| 3300012208|Ga0137376_10641529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
| 3300012208|Ga0137376_11262387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300012209|Ga0137379_10744070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 886 | Open in IMG/M |
| 3300012211|Ga0137377_10532524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300012212|Ga0150985_105493253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300012212|Ga0150985_107527310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1326 | Open in IMG/M |
| 3300012212|Ga0150985_112818837 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300012212|Ga0150985_116672986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300012212|Ga0150985_117100058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
| 3300012350|Ga0137372_10061691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3263 | Open in IMG/M |
| 3300012354|Ga0137366_10408228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 988 | Open in IMG/M |
| 3300012355|Ga0137369_10116597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2167 | Open in IMG/M |
| 3300012469|Ga0150984_110623254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300012469|Ga0150984_119302567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300012478|Ga0157328_1028602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300012582|Ga0137358_10479654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 839 | Open in IMG/M |
| 3300012683|Ga0137398_10481825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 851 | Open in IMG/M |
| 3300012685|Ga0137397_10095180 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300012918|Ga0137396_10080219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2296 | Open in IMG/M |
| 3300012918|Ga0137396_11147699 | Not Available | 552 | Open in IMG/M |
| 3300012931|Ga0153915_10206583 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300012931|Ga0153915_11867628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300012948|Ga0126375_11021471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300012951|Ga0164300_10124776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
| 3300012955|Ga0164298_10316627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
| 3300012957|Ga0164303_10833740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300012960|Ga0164301_10058272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2030 | Open in IMG/M |
| 3300012960|Ga0164301_10140208 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300012960|Ga0164301_10169216 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300012977|Ga0134087_10140535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
| 3300012982|Ga0168317_1049600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300012982|Ga0168317_1079423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300012986|Ga0164304_10764490 | Not Available | 741 | Open in IMG/M |
| 3300012987|Ga0164307_10042276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2560 | Open in IMG/M |
| 3300013100|Ga0157373_11327592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300013104|Ga0157370_11166269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300013105|Ga0157369_10004150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17162 | Open in IMG/M |
| 3300013105|Ga0157369_10027845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6261 | Open in IMG/M |
| 3300013105|Ga0157369_11382709 | Not Available | 717 | Open in IMG/M |
| 3300013296|Ga0157374_12779693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300013306|Ga0163162_13001402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300013427|Ga0120106_1056656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300013765|Ga0120172_1118327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300013766|Ga0120181_1128781 | Not Available | 552 | Open in IMG/M |
| 3300013768|Ga0120155_1097663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| 3300013832|Ga0120132_1111508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300014150|Ga0134081_10381391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300014157|Ga0134078_10365359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300014157|Ga0134078_10614450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300014166|Ga0134079_10364641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300014311|Ga0075322_1161968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300014488|Ga0182001_10622669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300014498|Ga0182019_10898931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300015158|Ga0167622_1056101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300015161|Ga0167623_1004390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4901 | Open in IMG/M |
| 3300015203|Ga0167650_1004122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4328 | Open in IMG/M |
| 3300015241|Ga0137418_10213009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1662 | Open in IMG/M |
| 3300015245|Ga0137409_11083485 | Not Available | 640 | Open in IMG/M |
| 3300015262|Ga0182007_10370377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300015358|Ga0134089_10529334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300015371|Ga0132258_10094955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 7007 | Open in IMG/M |
| 3300015371|Ga0132258_10580478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2813 | Open in IMG/M |
| 3300015371|Ga0132258_12840783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300016341|Ga0182035_11288514 | Not Available | 654 | Open in IMG/M |
| 3300016445|Ga0182038_10741260 | Not Available | 858 | Open in IMG/M |
| 3300017656|Ga0134112_10364804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300017792|Ga0163161_11814123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300017937|Ga0187809_10222966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300017947|Ga0187785_10153284 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300017959|Ga0187779_10161001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1389 | Open in IMG/M |
| 3300017961|Ga0187778_10515912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300017966|Ga0187776_10325094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
| 3300017973|Ga0187780_10884190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300017973|Ga0187780_11182257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
| 3300017974|Ga0187777_10104118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1867 | Open in IMG/M |
| 3300017974|Ga0187777_10196846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1357 | Open in IMG/M |
| 3300017974|Ga0187777_10339124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300017994|Ga0187822_10080386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300018058|Ga0187766_10136067 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300018060|Ga0187765_10954743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300018060|Ga0187765_11053358 | Not Available | 561 | Open in IMG/M |
| 3300018433|Ga0066667_11273796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300018468|Ga0066662_10002210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9114 | Open in IMG/M |
| 3300018482|Ga0066669_11439778 | Not Available | 625 | Open in IMG/M |
| 3300018482|Ga0066669_11606838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300019767|Ga0190267_11637048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300019888|Ga0193751_1167538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300020069|Ga0197907_10032768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300020069|Ga0197907_11033160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300020070|Ga0206356_10000915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300020070|Ga0206356_10282509 | Not Available | 511 | Open in IMG/M |
| 3300020070|Ga0206356_11064516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1914 | Open in IMG/M |
| 3300020070|Ga0206356_11822346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
| 3300020075|Ga0206349_1681851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
| 3300020078|Ga0206352_11110956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300020080|Ga0206350_11044825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300020081|Ga0206354_10305754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2401 | Open in IMG/M |
| 3300020081|Ga0206354_11607115 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300020082|Ga0206353_12041578 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300021363|Ga0193699_10020197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2430 | Open in IMG/M |
| 3300021363|Ga0193699_10246496 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300021374|Ga0213881_10066021 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
| 3300021384|Ga0213876_10353252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
| 3300021478|Ga0210402_10129597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2286 | Open in IMG/M |
| 3300021560|Ga0126371_11019195 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300021953|Ga0213880_10160579 | Not Available | 617 | Open in IMG/M |
| 3300022467|Ga0224712_10183713 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300022467|Ga0224712_10296895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300022467|Ga0224712_10387250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300022467|Ga0224712_10409281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300022467|Ga0224712_10630819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300024254|Ga0247661_1112338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300025574|Ga0208717_1052779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300025679|Ga0207933_1008168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5284 | Open in IMG/M |
| 3300025679|Ga0207933_1193088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300025898|Ga0207692_10673986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300025903|Ga0207680_11094307 | Not Available | 570 | Open in IMG/M |
| 3300025909|Ga0207705_10988398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300025909|Ga0207705_11356613 | Not Available | 542 | Open in IMG/M |
| 3300025909|Ga0207705_11418082 | Not Available | 528 | Open in IMG/M |
| 3300025910|Ga0207684_10708898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300025911|Ga0207654_10952777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300025913|Ga0207695_10847512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300025913|Ga0207695_11038349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300025915|Ga0207693_10779740 | Not Available | 737 | Open in IMG/M |
| 3300025915|Ga0207693_10995916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300025915|Ga0207693_11001287 | Not Available | 638 | Open in IMG/M |
| 3300025915|Ga0207693_11366023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
| 3300025916|Ga0207663_10256171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
| 3300025917|Ga0207660_10833900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
| 3300025917|Ga0207660_11382495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300025919|Ga0207657_11197220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300025924|Ga0207694_11685999 | Not Available | 533 | Open in IMG/M |
| 3300025927|Ga0207687_11105065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300025927|Ga0207687_11391574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
| 3300025928|Ga0207700_10196418 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
| 3300025928|Ga0207700_11085073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300025929|Ga0207664_10418059 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300025929|Ga0207664_10448723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
| 3300025929|Ga0207664_10519368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300025935|Ga0207709_11706605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300025939|Ga0207665_11602698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300025944|Ga0207661_10197607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1767 | Open in IMG/M |
| 3300025986|Ga0207658_10065895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2722 | Open in IMG/M |
| 3300026035|Ga0207703_10168194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1926 | Open in IMG/M |
| 3300026041|Ga0207639_12234425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300026078|Ga0207702_10951173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
| 3300026089|Ga0207648_11481046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300026275|Ga0209901_1024270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1482 | Open in IMG/M |
| 3300026527|Ga0209059_1024303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2753 | Open in IMG/M |
| 3300026552|Ga0209577_10313361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
| 3300027706|Ga0209581_1000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1458151 | Open in IMG/M |
| 3300027725|Ga0209178_1253498 | Not Available | 636 | Open in IMG/M |
| 3300027773|Ga0209810_1000015 | All Organisms → cellular organisms → Bacteria | 608252 | Open in IMG/M |
| 3300027773|Ga0209810_1000063 | All Organisms → cellular organisms → Bacteria | 325079 | Open in IMG/M |
| 3300027773|Ga0209810_1015805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5249 | Open in IMG/M |
| 3300027773|Ga0209810_1078707 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300027775|Ga0209177_10113196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
| 3300027826|Ga0209060_10102968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1335 | Open in IMG/M |
| 3300027869|Ga0209579_10028532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3062 | Open in IMG/M |
| 3300027869|Ga0209579_10127972 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300027869|Ga0209579_10299965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 866 | Open in IMG/M |
| 3300027882|Ga0209590_10966204 | Not Available | 533 | Open in IMG/M |
| 3300027908|Ga0209006_11240422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300028536|Ga0137415_10446870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1098 | Open in IMG/M |
| 3300028563|Ga0265319_1011930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3533 | Open in IMG/M |
| 3300028563|Ga0265319_1028652 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300028577|Ga0265318_10336868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300028666|Ga0265336_10248992 | Not Available | 528 | Open in IMG/M |
| 3300028715|Ga0307313_10156047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300028799|Ga0307284_10097264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300028800|Ga0265338_10534785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300029923|Ga0311347_10904196 | Not Available | 536 | Open in IMG/M |
| 3300029984|Ga0311332_11169204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300029987|Ga0311334_10659660 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300030520|Ga0311372_11382338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 880 | Open in IMG/M |
| 3300031231|Ga0170824_105896456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300031232|Ga0302323_100758128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
| 3300031247|Ga0265340_10069114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1676 | Open in IMG/M |
| 3300031247|Ga0265340_10442210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300031366|Ga0307506_10043751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1270 | Open in IMG/M |
| 3300031543|Ga0318516_10037500 | All Organisms → cellular organisms → Bacteria | 2588 | Open in IMG/M |
| 3300031543|Ga0318516_10395204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300031544|Ga0318534_10134246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1425 | Open in IMG/M |
| 3300031548|Ga0307408_102289464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300031564|Ga0318573_10048484 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300031564|Ga0318573_10179314 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300031670|Ga0307374_10004045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 24639 | Open in IMG/M |
| 3300031670|Ga0307374_10432378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 741 | Open in IMG/M |
| 3300031672|Ga0307373_10284819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1068 | Open in IMG/M |
| 3300031680|Ga0318574_10300257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
| 3300031713|Ga0318496_10447784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300031747|Ga0318502_10147865 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300031748|Ga0318492_10463230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300031890|Ga0306925_10113472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2894 | Open in IMG/M |
| 3300031896|Ga0318551_10304472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300031938|Ga0308175_100893743 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300031938|Ga0308175_102327404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300031938|Ga0308175_102808178 | Not Available | 544 | Open in IMG/M |
| 3300031939|Ga0308174_10153561 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300031939|Ga0308174_10170082 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300031939|Ga0308174_10426694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
| 3300031939|Ga0308174_10609592 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300031941|Ga0310912_11354122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300031996|Ga0308176_10187211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1934 | Open in IMG/M |
| 3300031996|Ga0308176_10365572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1428 | Open in IMG/M |
| 3300031996|Ga0308176_10603103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1129 | Open in IMG/M |
| 3300031996|Ga0308176_11370000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300031996|Ga0308176_12279904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300032008|Ga0318562_10754748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300032043|Ga0318556_10226358 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300032074|Ga0308173_10039536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3361 | Open in IMG/M |
| 3300032180|Ga0307471_102443140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300032205|Ga0307472_101660738 | Not Available | 630 | Open in IMG/M |
| 3300032261|Ga0306920_104069737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300032770|Ga0335085_10460607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1460 | Open in IMG/M |
| 3300032770|Ga0335085_10899061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300032770|Ga0335085_11857716 | Not Available | 615 | Open in IMG/M |
| 3300032782|Ga0335082_10347287 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300032782|Ga0335082_11421070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300032828|Ga0335080_10611271 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300032892|Ga0335081_10535416 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300032893|Ga0335069_10337787 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300032893|Ga0335069_10719702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1133 | Open in IMG/M |
| 3300032893|Ga0335069_11277755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300032893|Ga0335069_12125801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300032896|Ga0335075_10115921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3454 | Open in IMG/M |
| 3300032896|Ga0335075_10156509 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
| 3300032897|Ga0335071_10049767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4136 | Open in IMG/M |
| 3300032897|Ga0335071_10173075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2112 | Open in IMG/M |
| 3300033758|Ga0314868_008042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300033803|Ga0314862_0002005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2883 | Open in IMG/M |
| 3300033805|Ga0314864_0029460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
| 3300034090|Ga0326723_0591695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300034195|Ga0370501_0005922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3186 | Open in IMG/M |
| 3300034268|Ga0372943_0001055 | All Organisms → cellular organisms → Bacteria | 12908 | Open in IMG/M |
| 3300034268|Ga0372943_0025446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3177 | Open in IMG/M |
| 3300034384|Ga0372946_0138936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.28% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.09% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.66% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.66% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.43% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.43% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.43% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.19% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.19% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.19% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.19% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.71% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.71% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.71% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.71% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.48% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.48% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.48% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.48% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.48% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.48% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.24% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.24% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.24% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.24% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.24% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.24% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.24% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.24% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.24% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908007 | Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2 | Environmental | Open in IMG/M |
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2140918025 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009650 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 | Environmental | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013427 | Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015158 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin) | Environmental | Open in IMG/M |
| 3300015161 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026275 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033758 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRElOz_00696080 | 2124908007 | Soil | RVKGHTMARPGERISVFLFALLILALFVGLAFAAGYGIGRILL |
| Perma_A_C_00870160 | 2124908032 | Soil | MARPSERISVFLFALVLLVLFVGLAFAAGYGLGRILL |
| B3_v_01054530 | 2124908039 | Soil | MTRPGERITVLLFALFLLVLFVALAFAAGYGLGRILL |
| A2_c1_00847280 | 2124908043 | Soil | MHTMSRSGERISVLLFALFILVLFVGLAFAAGYGLGRILL |
| P1_C_02072550 | 2140918006 | Soil | MARPSERISVFLFALVLLVLFVGLAFATGYGLGRILL |
| A_all_C_02024240 | 2140918007 | Soil | MSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL |
| b3_nosca_v_02330060 | 2140918025 | Soil | MHTMTRPGERITVLLFALFLLVLFVALAFAAGYGLGRILL |
| cont_0967.00000020 | 2166559005 | Simulated | MLTMTRPSERISVFLFAFVLLALFVGLTFAAGYLLGRVLL |
| E4A_08541070 | 2170459003 | Grass Soil | MTRPGERISVLLFALLLLVLFVGLAFAAGYGLGRILL |
| E4A_05519210 | 2170459003 | Grass Soil | MTSEMHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL |
| E4A_03265450 | 2170459003 | Grass Soil | MTRPSERISVFLFAFVLLALFVGLTFAAGYLLGRVLL |
| F62_07791740 | 2170459010 | Grass Soil | YLPTSPENGEMHTMTRRGERISVFLFALAILAIFVGAAFAAGYALGRMLL |
| 2ZMR_00987920 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MSRSGGRISVFLFAFVLLALFVGLTFAAGYALGRILL |
| N55_05408690 | 2189573000 | Grass Soil | MTRARERITVFLFAFLLLALFVGLAFAAGYGVGSILL |
| INPgaii200_10645542 | 2228664022 | Soil | MLTMARPGERISVFLFALFLLVGFVLLAFAAGYGIGRILL |
| AL20A1W_10468535 | 3300000880 | Permafrost | LRERLSVLLFAAFLLLAFVGLAFAAGYALGKIIL* |
| JGI1027J12803_1000720592 | 3300000955 | Soil | MLTMARPGERISVFLFALFLLVGFVLLAFAAGYGIGRILL* |
| C688J13580_10508672 | 3300001205 | Soil | MSRSGERISVFLFALFLLAAFVVLAFAAGYGLGKILL* |
| C688J14111_101787112 | 3300001305 | Soil | MLTMSRSGERISVFLFALFLLAAFVVLAFAAGYGLGKILL* |
| A20PFW1_10617696 | 3300001532 | Permafrost | MHTMARPSERISVFLFALVLLVLFVGLAFAAGYGLGRILL* |
| A3PFW1_102175892 | 3300001535 | Permafrost | MHTMARPRERISVFLFALVLLVLFVGLAFAAGYGLGRILL* |
| A1565W1_111822692 | 3300001536 | Permafrost | MRGLRERLSVLLFAAFLLLAFVGLAFAAGYALGKIIL* |
| A10PFW1_110113812 | 3300001538 | Permafrost | MTRARERITVFLFAFLLLALFVGLAFAAGYGVGSILL* |
| A10PFW1_111724184 | 3300001538 | Permafrost | MHTMSRPNERISVFLFALALLALFIGITFAAGYAIGRILL* |
| C688J18823_101503022 | 3300001686 | Soil | MSRSGERISVFLFALFLLAAFVVLAFAAGYGVGKVLL* |
| C688J18823_104657972 | 3300001686 | Soil | MNTMSRSGGRISVFLFALGLLALFVGLAFAVGYALGRMLL* |
| C688J18823_105309142 | 3300001686 | Soil | MLTMXRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL* |
| C688J35102_1184403012 | 3300002568 | Soil | MLTMSRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL* |
| C688J35102_1184900092 | 3300002568 | Soil | MHTMSRSGGRISVFLFAFGLLALFVGLAFAAGYALGRVLL* |
| C688J35102_1199216872 | 3300002568 | Soil | MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL* |
| C688J35102_1207866002 | 3300002568 | Soil | MHTMSRSGERISVLLFALFLLVLFVGLAFAAGYGLGRILL* |
| C688J35102_1208869503 | 3300002568 | Soil | MLTMSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL* |
| C688J35102_1209620822 | 3300002568 | Soil | MLTMSRSSERISVFLFAVFILVAFVFLAFAAGYGIGRILL* |
| Ga0063454_1010995872 | 3300004081 | Soil | MLTMSRSSDRISVLLFALFLVVAFVVVAFAAGYGIGKILL* |
| Ga0063454_1013710972 | 3300004081 | Soil | MLTMARPGERISVFLFALFLLVAFVVIAFAAGYGIGRILL* |
| Ga0062595_1024553032 | 3300004479 | Soil | MHTMSQPGGRISVFLFALIVLAVFVGVAFAAGYVVGRILL* |
| Ga0062591_1008752402 | 3300004643 | Soil | MLTMSRSSERISVFLFALFLLAAFVVLAFAAGYGVGKILL* |
| Ga0062594_1003144792 | 3300005093 | Soil | MLTMSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL* |
| Ga0066679_103668422 | 3300005176 | Soil | MLTMSRSSDRISVFRCALFLLVAFVVIAFAAGYGVGKILL* |
| Ga0066679_109272731 | 3300005176 | Soil | EMHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGKILL* |
| Ga0066684_109367722 | 3300005179 | Soil | MHTMTRPGERIAIFLFALVLLALFVGLAFAVGYAVGRLLL* |
| Ga0066675_110660862 | 3300005187 | Soil | LHTMSRSGGRISVFLFAFALLALFVGLAFAAGYALGRILL* |
| Ga0065715_106192922 | 3300005293 | Miscanthus Rhizosphere | MLTMSRSSDRISVFLFALFLLAAFVLIAFAAGYGLGRILL* |
| Ga0070658_107424123 | 3300005327 | Corn Rhizosphere | LPICPKKNEMHTMTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL* |
| Ga0070658_109274902 | 3300005327 | Corn Rhizosphere | MHTMSRPGERISVFLFALFLLALFVGLAFAVGYGIGRMLL* |
| Ga0070683_1000560623 | 3300005329 | Corn Rhizosphere | MHTMTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL* |
| Ga0070683_1021553732 | 3300005329 | Corn Rhizosphere | MHTMFRPSERISVVFFAVVLLVLFVGLAFAAGYVLGRILL* |
| Ga0070660_1012824911 | 3300005339 | Corn Rhizosphere | IRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL* |
| Ga0070661_1001432341 | 3300005344 | Corn Rhizosphere | PRIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL* |
| Ga0070671_1012438992 | 3300005355 | Switchgrass Rhizosphere | MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0070709_113746812 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRIFL* |
| Ga0070714_1007787692 | 3300005435 | Agricultural Soil | MLTMSRSGERISVFLFALFLLVAFVVIAFAAGYGLGKILL* |
| Ga0070714_1010447863 | 3300005435 | Agricultural Soil | EMHTMTRPGERISVFLFALFLLALFIGLAFAAGYGVGRILL* |
| Ga0070714_1016832292 | 3300005435 | Agricultural Soil | MHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0070713_1008820412 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMARPGERISVFLFAVFLLVAFVVIAFAAGYGLGRILL* |
| Ga0070713_1014120122 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMNRPGERISVFVFAFLLLALFVGLAFAAGYLLGRILL* |
| Ga0070710_114104841 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EMHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0070694_1001207684 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL* |
| Ga0066687_104597512 | 3300005454 | Soil | MLTMSRSSDRISVFLFALFLLVAFVVIAFAAGYGVGKILL* |
| Ga0070663_1003600672 | 3300005455 | Corn Rhizosphere | MHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0070681_104425691 | 3300005458 | Corn Rhizosphere | KIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL* |
| Ga0070741_10000221151 | 3300005529 | Surface Soil | MPTMSRPGERISVFLFAVLLLALFVALTFAAGYGLGKILL* |
| Ga0070741_1000063936 | 3300005529 | Surface Soil | MSRARERITVFLFALFLLALFVALAFAAGYGIGRMLV* |
| Ga0070741_100073297 | 3300005529 | Surface Soil | MSRSRERISVTLFALALLALFVGLAFAAGYGVGRMLL* |
| Ga0070741_100243615 | 3300005529 | Surface Soil | MSRARERISVFLFAVLLLLLFVGLAFAAGYGVGRMLL* |
| Ga0070741_101127283 | 3300005529 | Surface Soil | MSQPGGRISVFLFALVVLAVFVGIAFAAGYAVGRILL* |
| Ga0070741_103541063 | 3300005529 | Surface Soil | MTRARERISVFLFAVFLLALFVGLAFAAGYGLGRILL* |
| Ga0070741_106840682 | 3300005529 | Surface Soil | MTRARERITVFLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0070741_109953132 | 3300005529 | Surface Soil | MLTMPRPRERISVFLFALTLLGLFVGAAFAVGYLLGRILL* |
| Ga0070739_1000077610 | 3300005532 | Surface Soil | MTRARERTTVFLFALLLLVLYVGLAFAAGYGLGRILL* |
| Ga0070739_100082224 | 3300005532 | Surface Soil | MLTMTRPRERVSVFLFALALLALFVALTFAAGYALGRMLL* |
| Ga0070739_100124947 | 3300005532 | Surface Soil | MHTMSRSGGRLSVFLFALFLLAFFLAVTFAAGYAVGKILL* |
| Ga0070739_100284924 | 3300005532 | Surface Soil | MHTMTRPGERVSVFLFALALLALFVVLTFAAGYALGRILL* |
| Ga0070739_100737684 | 3300005532 | Surface Soil | MTRARERSSVFLFAVFLLVLFVGLAFAAGYGLGRILL* |
| Ga0070734_101442652 | 3300005533 | Surface Soil | MTRSRERISVTLFALFLLALFVVLAFAVGYGVGRMLL* |
| Ga0070734_103652452 | 3300005533 | Surface Soil | MTPRARERITVFLFALFLLVLFVGLAFAAGYGLGRILL* |
| Ga0070735_100468603 | 3300005534 | Surface Soil | MPITMTGTRERVSVTLFALFLLALFVGLAFAAGYGVGRMLL* |
| Ga0070684_1002948671 | 3300005535 | Corn Rhizosphere | RIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL* |
| Ga0070731_100007779 | 3300005538 | Surface Soil | MLTMTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL* |
| Ga0070731_100022714 | 3300005538 | Surface Soil | MTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL* |
| Ga0070731_101745313 | 3300005538 | Surface Soil | MLTMTRPSERISVFLFAVVLLALFVGLAFAAGYLLGRILL* |
| Ga0070731_102427722 | 3300005538 | Surface Soil | MMRPRDRVTVFLFAVFLLVLFVGLSFAAGYLLGRMLL* |
| Ga0070731_111505822 | 3300005538 | Surface Soil | MMRPRDRVSVFLFALFLLVLFVGLSFAAGYLLGRMLL* |
| Ga0066697_106911232 | 3300005540 | Soil | MSRSGGRISVFLFAFALLALFVGLAFAAGYALGRILL* |
| Ga0070665_1000378617 | 3300005548 | Switchgrass Rhizosphere | MTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL* |
| Ga0070665_1008732902 | 3300005548 | Switchgrass Rhizosphere | MSRSGGRISVFLFAFGLLALFVGLAFAAGYAIGRILL* |
| Ga0066661_101699714 | 3300005554 | Soil | MLTMSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL* |
| Ga0066692_108544772 | 3300005555 | Soil | MSRSSDRISVFLFALFLLVAFVVIAFAAGYGLGKILL* |
| Ga0066704_105632322 | 3300005557 | Soil | MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL* |
| Ga0066704_109924512 | 3300005557 | Soil | MSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL* |
| Ga0068855_1000554083 | 3300005563 | Corn Rhizosphere | MTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL* |
| Ga0068855_1001417912 | 3300005563 | Corn Rhizosphere | MSRPGDRISVFLFALVLLALFVGAAFAVGYLVGRILL* |
| Ga0068855_1001961933 | 3300005563 | Corn Rhizosphere | MTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL* |
| Ga0068855_1005219284 | 3300005563 | Corn Rhizosphere | SPRTSEMHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0068855_1019183892 | 3300005563 | Corn Rhizosphere | MTRPGERISVFLFALLLLVLFVGLAFAAGYGIGRILL* |
| Ga0068855_1019810082 | 3300005563 | Corn Rhizosphere | MTRARERTTLFLFALLLLALFVGLAFAAGYGIGRILL* |
| Ga0066693_102811142 | 3300005566 | Soil | MLTMSRSSDRISVFLFALFLLVAFVVLAFAAGYGVGKILL* |
| Ga0066702_100205146 | 3300005575 | Soil | SGERISVFLFALFLLVAFVVLAFAAGYGIGRILL* |
| Ga0068854_1018108782 | 3300005578 | Corn Rhizosphere | MSRSGGRISVFLFAIGLLALFVGLAFAAGYALGRILL* |
| Ga0066654_102775213 | 3300005587 | Soil | TSEMLTMSRSSERISVFLFALFLLVAFVALAFAAGYGLGRILL* |
| Ga0066654_103506762 | 3300005587 | Soil | VASEIRTMTRARERITVFLFALLLLVLFVGLAFAAGYGLGKILL* |
| Ga0066654_103861391 | 3300005587 | Soil | MLTMTRHRERITVFLFALTLLGLFVGAAFAVGYLLGRILL* |
| Ga0068856_1004157112 | 3300005614 | Corn Rhizosphere | MTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0068852_1008668422 | 3300005616 | Corn Rhizosphere | MTRPGERISVLFFALVLLVLFVGLAFAAGYAVGRLLL* |
| Ga0066903_1069773862 | 3300005764 | Tropical Forest Soil | MRERLSVFGFALFLLGSFVLLAFAAGYLLGKILL* |
| Ga0075284_10627032 | 3300005885 | Rice Paddy Soil | MTRARDRLSVFLFALLLLVLFVGLAFAAGYGLGRILL* |
| Ga0075275_10890321 | 3300005892 | Rice Paddy Soil | MRPGDRISVFLFALVLLVVFVGAAFAVGYIVGRILV* |
| Ga0070717_102939323 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSSERISVFLFALGLLALFVGLAFAAGYALGRILL* |
| Ga0070717_114633911 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTSTTSSEMPTMTRSRERISVTLFALFLLALFVVLAFAAGYGVGKMLL* |
| Ga0066656_108220472 | 3300006034 | Soil | MSRSGGRISVFLFAFALLALFVGLSFAVGYALGRILL* |
| Ga0075417_106276512 | 3300006049 | Populus Rhizosphere | MLTMSRSSDRISVFLFALFILVAFVALAFAAGYGLGKILL* |
| Ga0070712_1004430452 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSRERISVTLFALFLLALFVVLAFAAGYGVGKMLL* |
| Ga0070712_1007491322 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRLLL* |
| Ga0070712_1009044632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0070712_1011460442 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MARPGERISVFLFALVILALFVGLAFAAGYGIGRILL* |
| Ga0070712_1014196482 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0097621_1009930893 | 3300006237 | Miscanthus Rhizosphere | RTMTRARERITVFLFALFLLVLFVGLAFAAGYGLGRILL* |
| Ga0068871_1010772762 | 3300006358 | Miscanthus Rhizosphere | MHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0075522_102235223 | 3300006638 | Arctic Peat Soil | MFRVRERLSVFAFAAFLLALFVGLAFAAGWAVGRFLL* |
| Ga0079222_105933312 | 3300006755 | Agricultural Soil | MTRDRERTTVFLFAVLVLALFVGLAFAAGYGVGRILL* |
| Ga0079222_120985041 | 3300006755 | Agricultural Soil | MTRARERTTVFLFAVLVLALFVGLAFAAGYGVGRILL* |
| Ga0066653_105515442 | 3300006791 | Soil | MRERLSVFAFALFLLGSFVLLAFAAGYLLGKILL* |
| Ga0066658_104574842 | 3300006794 | Soil | MLTMSRSSDRISVFLFALFLLVAFVALAFAAGYGVGKILL* |
| Ga0079221_106353972 | 3300006804 | Agricultural Soil | MTRARERTSVFLFAVLLLALFVGLAFAAGYGVGRILL* |
| Ga0079221_109018632 | 3300006804 | Agricultural Soil | LHTMSRSGGRISVFLFALALLALFVGLAFAAGYALGRILL* |
| Ga0079220_114405641 | 3300006806 | Agricultural Soil | MSQPGGRISVFLFALIVLAVFVGLAFAAGYVVGRILL* |
| Ga0075433_100157123 | 3300006852 | Populus Rhizosphere | MLTMSRSSDRISVFLFALFLLVAFVALAFAAGYGLGKILL* |
| Ga0075434_1011939082 | 3300006871 | Populus Rhizosphere | MAGVRDRLSVFAFAAFLLALFVGLAFAAGYVLGKILL* |
| Ga0075434_1012870682 | 3300006871 | Populus Rhizosphere | MLTMSRSSERISVFLFALFLLAAFVVLAFAAGYGVGKIL |
| Ga0068865_1007984692 | 3300006881 | Miscanthus Rhizosphere | MSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL* |
| Ga0075424_1007580752 | 3300006904 | Populus Rhizosphere | MRERLSVFGFALFLLGGFVLLAFAAGYLLGKILL* |
| Ga0079219_124729082 | 3300006954 | Agricultural Soil | MSRSGGRISVFLFALGLLALFVGLAFAAGYAVGRILL* |
| Ga0104322_1132654 | 3300007819 | Permafrost Soil | TMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL* |
| Ga0104323_1005322 | 3300007821 | Soil | MSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL* |
| Ga0066710_1005269462 | 3300009012 | Grasslands Soil | MSRSGGRISVFLFAFALLALFVGLSFAVGYALGRILL |
| Ga0066710_1025270752 | 3300009012 | Grasslands Soil | MSRARERLTVFGFALLLLGLFVGLAFAAGWALGKVLL |
| Ga0099829_105331003 | 3300009038 | Vadose Zone Soil | MSRSGGRISVFLFAFGLLALFVGLAFAAGYALGRILL* |
| Ga0099829_109130802 | 3300009038 | Vadose Zone Soil | MARRGERISVFLFALLLLVLFIGLTFAAGYGLGRILL* |
| Ga0105240_121856952 | 3300009093 | Corn Rhizosphere | MSRARERITVFLFALLLLVVFVGLAFAAGYGVGRILL* |
| Ga0105240_123718182 | 3300009093 | Corn Rhizosphere | MFRPSERISVVFFAVVLLVLFVGLAFAAGYVLGRILL* |
| Ga0105245_111436411 | 3300009098 | Miscanthus Rhizosphere | MFRTRERIAVVLFALGLLGLFVGGAFAVGYLVGRIVL* |
| Ga0066709_1031684922 | 3300009137 | Grasslands Soil | MTRARERITVFLFALFLLVLFVGLAFAAGYGLGRILL* |
| Ga0105243_108647511 | 3300009148 | Miscanthus Rhizosphere | MSRSGGRISVFLFAIGLLALFVGLAFAAGYALGRI |
| Ga0075423_105395972 | 3300009162 | Populus Rhizosphere | MRDMLTMSRSSDRISVFLFALFLLVAFVALAFAAGYGLGKILL* |
| Ga0105241_117298731 | 3300009174 | Corn Rhizosphere | MLTMSRSGDRISVFLFAIFLLAAFVVLAFAAGYGVGRILL* |
| Ga0105248_109012752 | 3300009177 | Switchgrass Rhizosphere | MSRSGGRISVFLFALGLLALFVGLAFAAGYVLGKILL* |
| Ga0105238_114958222 | 3300009551 | Corn Rhizosphere | MLTMPRPRERVSVFLFALTLLGLFVGIAFAVGYFLGRILL* |
| Ga0105857_11812922 | 3300009650 | Permafrost Soil | MFLVRERLSVFAFAAFLLALFVGLAFAAGWAVGRFLL* |
| Ga0105854_10006065 | 3300009660 | Permafrost Soil | MHTMARPGERISVFLFALVLLVLFVGLAFAAGYGLGRILL* |
| Ga0126307_100316874 | 3300009789 | Serpentine Soil | MTRVRDRLSVFTFAAFLLALFVGLAFAAGYTLGKILL* |
| Ga0126307_100879204 | 3300009789 | Serpentine Soil | MSRVRDRLSVFTFAAVLLALFVGLAFAAGYALGKVLL* |
| Ga0126307_105000552 | 3300009789 | Serpentine Soil | MSRVRDRLSVFTFAAVLLVLFVGLAFAAGYALGKILL* |
| Ga0126313_113769792 | 3300009840 | Serpentine Soil | MSRVRDRLSVFAFAALLLALFVGLAFAAGWALGKILL* |
| Ga0126313_116214142 | 3300009840 | Serpentine Soil | MFGVRDRLSVFAFAALLLALFVGLAFAAGYALGKILL* |
| Ga0126315_102131014 | 3300010038 | Serpentine Soil | RVRDRLSVFAFAGLLLALFVGLAFAAGYALGKILL* |
| Ga0126315_111130242 | 3300010038 | Serpentine Soil | MFGVRDRLSVFAFAALLLALFVGLAFAAGYALGKVLL* |
| Ga0126309_100134045 | 3300010039 | Serpentine Soil | MSRVRDRLSVFGFAGLLLALFVGLAFAAGYALGKILL* |
| Ga0126309_111267302 | 3300010039 | Serpentine Soil | MSGVRDRLSVFAFAALLLALFVGLAFAAGYALGRILL* |
| Ga0126314_104849262 | 3300010042 | Serpentine Soil | MRERLSVFSFALFLLGSFVLLAFAAGYLLGKILL* |
| Ga0126380_104139102 | 3300010043 | Tropical Forest Soil | MSRRGERISVFLFALAVLAVFVGAAFAVGYALGRILL* |
| Ga0126380_107210232 | 3300010043 | Tropical Forest Soil | MSRRGERISVFLFALAVLAVFVGAAFAAGYALGRILL* |
| Ga0126310_105761402 | 3300010044 | Serpentine Soil | MHTMSRSGGRLSVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0126310_113577502 | 3300010044 | Serpentine Soil | MSRVRDRLSVFTFAAVLLALFVGLAFAAGYVLGKVLL* |
| Ga0126384_119474222 | 3300010046 | Tropical Forest Soil | MSRSRERISVTLFALFLLALFVVLAFAVGYGVGKMLL* |
| Ga0126318_103718952 | 3300010152 | Soil | MLTMTRPSERISVFLFALFLLALFVAVTFAAGYALGRILL* |
| Ga0126318_107662924 | 3300010152 | Soil | SPVTSEIRTMTRARERISVFLFALFLLVLFVGLAFAAGYGLGRILL* |
| Ga0134063_102004352 | 3300010335 | Grasslands Soil | MLTMSRASDRISVFLFAVFILVAFVVLAFAAGYGLGKILL* |
| Ga0126378_127000662 | 3300010361 | Tropical Forest Soil | GRKALKLHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL* |
| Ga0134125_104990642 | 3300010371 | Terrestrial Soil | MSRPGDRLSVLFFAVVLLVLFVGLAFAAGYALGRVLL* |
| Ga0134128_121588592 | 3300010373 | Terrestrial Soil | MAGVRDRLSVFAFAAILLALFVGLAFAAGYVLGKILL* |
| Ga0126381_1008770704 | 3300010376 | Tropical Forest Soil | MTRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL* |
| Ga0134126_102036224 | 3300010396 | Terrestrial Soil | MTRPGERISVLFFALVVLVLFVGLAFAVGYAVGRLLL* |
| Ga0134126_119183681 | 3300010396 | Terrestrial Soil | MTRARERITVFLFAFLLLALFVGLAFAAGYGVGRILL* |
| Ga0134126_129550701 | 3300010396 | Terrestrial Soil | MSRARERISVFLFALFLLVLFVALAFAAGYGLGRMLV* |
| Ga0134122_126691762 | 3300010400 | Terrestrial Soil | MTRARERTTVFLFAVLLLALFVVLAFAAGYGVGRILL* |
| Ga0134121_100847083 | 3300010401 | Terrestrial Soil | MTRARERITVFVFALFLLVLFVGLAFAAGYGLGRILL* |
| Ga0134123_106602722 | 3300010403 | Terrestrial Soil | MSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGKILL* |
| Ga0137776_14290453 | 3300010937 | Sediment | MATGEMHTMARRGERISVFLFAIAILAIFVGAAFAAGYALGRILL* |
| Ga0120167_10102203 | 3300012001 | Permafrost | MARPSERISVFLFALVLLVLFVGLAFAAGYGLGRILL* |
| Ga0120152_11838542 | 3300012011 | Permafrost | MSRPNERISVFLFALALLALFIGITFAAGYAIGRILL |
| Ga0120159_11102262 | 3300012014 | Permafrost | MSRPNERISVFLFALALLALFIGITFAAGYAIGRIL |
| Ga0137364_103508492 | 3300012198 | Vadose Zone Soil | MREMLTMSRSSDRISVFLFALFLVVAFVAVAFAAGYGIGKIFL* |
| Ga0137374_102048892 | 3300012204 | Vadose Zone Soil | MSGVRDRLSVFAFAALLLALFVGLAFAAGYALGKILL* |
| Ga0137376_106415292 | 3300012208 | Vadose Zone Soil | MTRARERITVFLFALFLLVLFVGLAFAAGYGVGRILL* |
| Ga0137376_112623872 | 3300012208 | Vadose Zone Soil | MREMLTMSRSSDRISVFLFALFLVVAFVVVAFAAGYGIGKILL* |
| Ga0137379_107440702 | 3300012209 | Vadose Zone Soil | MSRSGGRISVFLFAFGLLALFVGLAFAAGYAVGRILL* |
| Ga0137377_105325242 | 3300012211 | Vadose Zone Soil | MSRSGGRISVFLFAFALLALFVGLAFAVGYALGRILL* |
| Ga0150985_1054932532 | 3300012212 | Avena Fatua Rhizosphere | MLTMSRSGERISVFLFALFLLVAFVALAFAAGYGLGKILL* |
| Ga0150985_1075273102 | 3300012212 | Avena Fatua Rhizosphere | MTRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL* |
| Ga0150985_1128188373 | 3300012212 | Avena Fatua Rhizosphere | RSGGRISVFLFALGLLALFVGLAFAVGYALGRMLL* |
| Ga0150985_1166729861 | 3300012212 | Avena Fatua Rhizosphere | RVRDRLSVFTFAAFLLVLFVGLAFAAGYALGKILL* |
| Ga0150985_1171000582 | 3300012212 | Avena Fatua Rhizosphere | MSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL* |
| Ga0137372_100616912 | 3300012350 | Vadose Zone Soil | MHTMSRPGERISVFLFALVLLALFVGIAFAAGYALGRILL* |
| Ga0137366_104082282 | 3300012354 | Vadose Zone Soil | MRDRLSVFGFALFLLGAFVLLAFAAGYLLGKILL* |
| Ga0137369_101165972 | 3300012355 | Vadose Zone Soil | MRERLAVFGFALFLLGAFVLLAFAAGYVLGKILL* |
| Ga0150984_1106232542 | 3300012469 | Avena Fatua Rhizosphere | MLTMTRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL* |
| Ga0150984_1193025672 | 3300012469 | Avena Fatua Rhizosphere | MSRVRDRLSVFTFAAFLLVLFVGLAFAAGYALGKILL* |
| Ga0157328_10286021 | 3300012478 | Arabidopsis Rhizosphere | TRTEMHTMSRSGGRISVFLFAVGLLALFVGLAFAAGYALGRILL* |
| Ga0137358_104796542 | 3300012582 | Vadose Zone Soil | MSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRILL* |
| Ga0137398_104818252 | 3300012683 | Vadose Zone Soil | MSRSSDRISVFLFALFLLLAFVAIAFAAGYGLGRILL* |
| Ga0137397_100951804 | 3300012685 | Vadose Zone Soil | MLTMSRSSDRISVFLFALFLLTAFVVLAFAAGYGLGRILL* |
| Ga0137396_100802193 | 3300012918 | Vadose Zone Soil | MSRSSDRISVFLFALFLLVAFVALAFAAGYGVGKILL* |
| Ga0137396_111476992 | 3300012918 | Vadose Zone Soil | MLSMSRSSDRISVFLFALFLLTAFVVLAFAAGYGLGRILL* |
| Ga0153915_102065834 | 3300012931 | Freshwater Wetlands | MHTMTRPGERISVFLFALFLLALFVILAFAAGYGVGRILL* |
| Ga0153915_118676282 | 3300012931 | Freshwater Wetlands | MHTMTRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0126375_110214712 | 3300012948 | Tropical Forest Soil | MRDMLTMSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL* |
| Ga0164300_101247762 | 3300012951 | Soil | MSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL* |
| Ga0164298_103166272 | 3300012955 | Soil | MSRSGGRISVFLFAIVLLGLFVGLAFAAGYALGRILL* |
| Ga0164303_108337402 | 3300012957 | Soil | MSRSSDRISVFLFALFLLAAFVLIAFAAGYGLGRILL* |
| Ga0164301_100582722 | 3300012960 | Soil | MLTMSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL* |
| Ga0164301_101402082 | 3300012960 | Soil | MTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0164301_101692163 | 3300012960 | Soil | MSRSGGRISVFLFAIVLVGLFVGLAFAEGYALVRILL* |
| Ga0134087_101405352 | 3300012977 | Grasslands Soil | MREMLTMSRSSDRISVFLFALFLVVAFVVLAFAAGYGLGKILL* |
| Ga0168317_10496003 | 3300012982 | Weathered Mine Tailings | MHTMWPRGERISVFLFALVLLALFVGLTFAAGYVLGRMLL* |
| Ga0168317_10794232 | 3300012982 | Weathered Mine Tailings | MSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRMLL* |
| Ga0164304_107644902 | 3300012986 | Soil | MLTMSRSSDRISVFLFALFLVVAFVVVAFAAGYGVGKILL* |
| Ga0164307_100422762 | 3300012987 | Soil | MLTMSRSSERITVFLFALFLLAAFVVLAFAAGYGVGRILL* |
| Ga0157373_113275923 | 3300013100 | Corn Rhizosphere | MLITMPKARERISVFLFALTLLGLFVGAAFAVGYLIGRILL* |
| Ga0157370_111662692 | 3300013104 | Corn Rhizosphere | MTRPRERLSVFLFAIALLALFVALTFAVGYALGRMLL* |
| Ga0157369_1000415014 | 3300013105 | Corn Rhizosphere | MTRPRERLSVFLFAIALLALFVAFTFAVGYALGRMLL* |
| Ga0157369_100278454 | 3300013105 | Corn Rhizosphere | MLTMPRPRERVSVFLFALTLLGLFVGAAFAVGYLIGRILL* |
| Ga0157369_113827091 | 3300013105 | Corn Rhizosphere | MTRPGERISVLFFAVVLLVVFVGLAFAAGYAVGKLLL* |
| Ga0157374_127796931 | 3300013296 | Miscanthus Rhizosphere | KPAGTSEMLTMSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRILL* |
| Ga0163162_130014022 | 3300013306 | Switchgrass Rhizosphere | MNTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0120106_10566561 | 3300013427 | Permafrost | SEMLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL* |
| Ga0120172_11183272 | 3300013765 | Permafrost | MSRPNERISVFLFALALLALFIGITFAAGYAIGRILL* |
| Ga0120181_11287812 | 3300013766 | Permafrost | MSRSGERISVLLFALFILALFVGLAFAAGYGLGRILL* |
| Ga0120155_10976632 | 3300013768 | Permafrost | MARPGERISVFLFALVLLVLFVGLAFAAGYGLGRILL* |
| Ga0120132_11115082 | 3300013832 | Permafrost | MTRARERTTVFLFALLLLALFVGLAFAAGYGVGRILL* |
| Ga0134081_103813912 | 3300014150 | Grasslands Soil | SEMLTMSRSSERISVFLFAVFILVAFVALAFAAGYGIGRILL* |
| Ga0134078_103653592 | 3300014157 | Grasslands Soil | MSRSGGRISVFLFAIALLALFVGLAFAAGYALGRILL* |
| Ga0134078_106144502 | 3300014157 | Grasslands Soil | MTRARERIAVFLFALALLVLFVGLAFAAGYGIGRIIL* |
| Ga0134079_103646411 | 3300014166 | Grasslands Soil | NEIRTMTRARERIAVFLFALALLVLFVGLAFAAGYGIGRIIL* |
| Ga0075322_11619681 | 3300014311 | Natural And Restored Wetlands | MTRARERITVFLFAVLLLALFVGLAFAAGYGVGRILL* |
| Ga0182001_106226692 | 3300014488 | Soil | MSRVRDRFSVFAFAALLLALFVGLAFAAGYALGKILL* |
| Ga0182019_108989312 | 3300014498 | Fen | MSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL* |
| Ga0167622_10561012 | 3300015158 | Glacier Forefield Soil | MHTMSRPGDRISVFLFALFLLALFVGAAFAAGYALGRVLL* |
| Ga0167623_10043903 | 3300015161 | Glacier Forefield Soil | MSRARDRISVFAFALFLLVVFVGLAFAAGYALGKVLL* |
| Ga0167650_10041227 | 3300015203 | Glacier Forefield Soil | MARPSDRISVFLFALFLLVLFVGLAFAAGYGLGRILL* |
| Ga0137418_102130092 | 3300015241 | Vadose Zone Soil | MSRSSDRISVFLFALFLLTAFVVLAFAAGYGLGRILL* |
| Ga0137409_110834852 | 3300015245 | Vadose Zone Soil | MSRSGERISLLLFALFLLALFVGLAFAAGYGLGRILL* |
| Ga0182007_103703772 | 3300015262 | Rhizosphere | MTRARERTTVFLFALLVLALFVGLAFAAGYGVGRILL* |
| Ga0134089_105293342 | 3300015358 | Grasslands Soil | MREMLTMSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL* |
| Ga0132258_100949557 | 3300015371 | Arabidopsis Rhizosphere | MSRRGERISVFVFALAVLAVFVGAAFAAGYALGRLLL* |
| Ga0132258_105804784 | 3300015371 | Arabidopsis Rhizosphere | MHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL* |
| Ga0132258_128407834 | 3300015371 | Arabidopsis Rhizosphere | PLPTEMHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL* |
| Ga0182035_112885142 | 3300016341 | Soil | MHTMTRRGERISVFLFALAMLAISVGAAFAAGYAVGRILL |
| Ga0182038_107412602 | 3300016445 | Soil | MHTMTRRGERISVFLFALAMLAIFVGVAFAAGYAVGRILL |
| Ga0134112_103648043 | 3300017656 | Grasslands Soil | EMPTMTRSRERISVTLFALFLLALFVVLAFAAGYGVGKMLL |
| Ga0163161_118141232 | 3300017792 | Switchgrass Rhizosphere | MSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL |
| Ga0187809_102229662 | 3300017937 | Freshwater Sediment | LPISHLTTEMLTMTRPGERISVFLFALALLALFVGLTFAAGYLLGKILL |
| Ga0187785_101532842 | 3300017947 | Tropical Peatland | MTAGMPTMSRSRERIVVTLFAFLLLVLFVGLAFAAGYGLGRILL |
| Ga0187779_101610012 | 3300017959 | Tropical Peatland | MSRSRERITVTLFALFLLALFVAAAFAIGYGVARMLL |
| Ga0187778_105159122 | 3300017961 | Tropical Peatland | MSRSRERITVTLFALFLLALFVAAAFAIGYGVGRMLL |
| Ga0187776_103250942 | 3300017966 | Tropical Peatland | MSRVRERLSVFAFAALLLALFVGLAFAAGWILGRLLL |
| Ga0187780_108841902 | 3300017973 | Tropical Peatland | VKYLADMPTMSRSRERIVVTLFALCLLILFVGLAFAVGYGVGRMLL |
| Ga0187780_111822572 | 3300017973 | Tropical Peatland | MTRARERITVFLFALLLLVLFVGLAFAVGYGVGRMLL |
| Ga0187777_101041183 | 3300017974 | Tropical Peatland | MSRSRERIVVTLFAFLLLVLFVGLAFAAGYGLGRLLL |
| Ga0187777_101968463 | 3300017974 | Tropical Peatland | MSRPGERISVFLFALFLLVLFVGLAFAAGYGLGRILL |
| Ga0187777_103391243 | 3300017974 | Tropical Peatland | MLTMSRPGERVSVFLFALFLLALFVGLAFAAGYGLGRLLL |
| Ga0187822_100803862 | 3300017994 | Freshwater Sediment | MTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL |
| Ga0187766_101360672 | 3300018058 | Tropical Peatland | MTRRGERISVFLFALAMLAIFVGVAFADGYAVGRILL |
| Ga0187765_109547432 | 3300018060 | Tropical Peatland | MSRSRERISVTLFALFLLALFIAVAFAVGYGVGRMLL |
| Ga0187765_110533582 | 3300018060 | Tropical Peatland | MTRSRERITVTLFALFLLALFVVLAFAVGYGVGKMLL |
| Ga0066667_112737962 | 3300018433 | Grasslands Soil | MLTMSRSSDRISVFLFALFLVVAFVAVAFAAGYGIGKILL |
| Ga0066662_100022109 | 3300018468 | Grasslands Soil | MLTMSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL |
| Ga0066669_114397781 | 3300018482 | Grasslands Soil | MSRSGGRISVFLFAFALLALFVGLSFAVGYALGRIL |
| Ga0066669_116068382 | 3300018482 | Grasslands Soil | SRSGGRISVFLFAFALLALFVGLAFAAGYALGRILL |
| Ga0190267_116370482 | 3300019767 | Soil | MTRARERLSVFAFAAFLLALFVGLAFVAGWLLGRVLL |
| Ga0193751_11675382 | 3300019888 | Soil | MLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRI |
| Ga0197907_100327682 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL |
| Ga0197907_110331601 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | KIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL |
| Ga0206356_100009152 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL |
| Ga0206356_102825092 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRPGERISVFLFALFLLALFVGLAFAVGYGIGRMLL |
| Ga0206356_110645163 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL |
| Ga0206356_118223462 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRPGDRISVFLFALVLLALFVGAAFAVGYLVGRILL |
| Ga0206349_16818512 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRARERITVFLFALLLLVVFVGLAFAAGYGVGRILL |
| Ga0206352_111109562 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTMTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL |
| Ga0206350_110448252 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | TMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL |
| Ga0206354_103057544 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0206354_116071151 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTMSRPGDRISVFLFALVLLALFVGAAFAVGYLVGRILL |
| Ga0206353_120415783 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0193699_100201973 | 3300021363 | Soil | MLTTPRSSDRISVFLFALFLLAAFVVIAFAAGYGIGRILL |
| Ga0193699_102464962 | 3300021363 | Soil | MTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL |
| Ga0213881_100660212 | 3300021374 | Exposed Rock | MTRARERLSVFLFAVFLLVLFVGLAFAAGYGLGRILL |
| Ga0213876_103532522 | 3300021384 | Plant Roots | MSRARERISVFLFALFLLVLFVGLAFAAGYGVGRMLL |
| Ga0210402_101295972 | 3300021478 | Soil | MARRGERISVFLFALAVLAIFVGAAFAAGYALGRILL |
| Ga0126371_110191952 | 3300021560 | Tropical Forest Soil | MSRRGERISVFLFALAVLAVFVGAAFAVGYALGRILL |
| Ga0213880_101605792 | 3300021953 | Exposed Rock | MTRARERITVFLFALFILVLFVVLAFAAGYGVGRILL |
| Ga0224712_101837133 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | RARERITVFLFALLLLVVFVGLAFAAGYGVGRILL |
| Ga0224712_102968952 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL |
| Ga0224712_103872502 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | EIHTMPGPRERVSVFLFALTLVGLFVGAAFAVGYLLGRILL |
| Ga0224712_104092812 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRPRERLSVFLFAIALLALFVALTFAVGYALGRMLL |
| Ga0224712_106308192 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL |
| Ga0247661_11123382 | 3300024254 | Soil | MSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRILL |
| Ga0208717_10527792 | 3300025574 | Arctic Peat Soil | MTRPGDRISVFLFAFVLLALFVGVAFAVGYLVGRILL |
| Ga0207933_10081683 | 3300025679 | Arctic Peat Soil | MTRPGDRISVFLFALVLLALFVGVAFAVGYLVGRILL |
| Ga0207933_11930881 | 3300025679 | Arctic Peat Soil | RPGDRLSVFLFALVLLALFVGAAFAVGYLVGRILL |
| Ga0207692_106739862 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EMHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0207680_110943072 | 3300025903 | Switchgrass Rhizosphere | MLTMSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL |
| Ga0207705_109883982 | 3300025909 | Corn Rhizosphere | TCLPIWPGTSEIRTMTRARERISVFLFAVFLLVLFVGLAFAAGYGLGRILL |
| Ga0207705_113566132 | 3300025909 | Corn Rhizosphere | MTRPGERISVFLFALLLLVLFVGLAFAAGYGIGRILL |
| Ga0207705_114180822 | 3300025909 | Corn Rhizosphere | MHTMSRPGERISVFLFALFLLALFVGLAFAVGYGIGRMLL |
| Ga0207684_107088982 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL |
| Ga0207654_109527772 | 3300025911 | Corn Rhizosphere | MTRARERTTLFLFALLLLALFVGLAFAAGYGIGRILL |
| Ga0207695_108475122 | 3300025913 | Corn Rhizosphere | MHTMFRPSERISVVFFAVVLLVLFVGLAFAAGYVLGRILL |
| Ga0207695_110383491 | 3300025913 | Corn Rhizosphere | TRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL |
| Ga0207693_107797402 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSSERISVFLFALGLLALFVGLAFAAGYALGRILL |
| Ga0207693_109959162 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRLLL |
| Ga0207693_110012872 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL |
| Ga0207693_113660232 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MARPGERISVFLFALVILALFVGLAFAAGYGIGRILL |
| Ga0207663_102561713 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMTRPGERISVLLFALFLLVLFVGLAFAAGYGLGRILL |
| Ga0207660_108339002 | 3300025917 | Corn Rhizosphere | MSRSSDRISVFLFALFLLAAFVLIAFAAGYGLGRILL |
| Ga0207660_113824952 | 3300025917 | Corn Rhizosphere | MTRPGERISVLFFAFVLLVCFVGLAFAAGYVLGRLLL |
| Ga0207657_111972202 | 3300025919 | Corn Rhizosphere | MARPSDRISVFLFALFLLVLFVGLAFATGYGLGRILL |
| Ga0207694_116859992 | 3300025924 | Corn Rhizosphere | MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALG |
| Ga0207687_111050652 | 3300025927 | Miscanthus Rhizosphere | MSRSGGRISVFLFAFGLLALFVGLAFAAGYAIGRILL |
| Ga0207687_113915742 | 3300025927 | Miscanthus Rhizosphere | MHTMSRSGGRISVFLFAFGLLALFVGLAFAAGYALGRVLL |
| Ga0207700_101964184 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EIRTMTRARERISVFLFALFLLVLFVGLAFAAGYGLGRILL |
| Ga0207700_110850732 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTMNRPGERISVFVFAFLLLALFVGLAFAAGYLLGRILL |
| Ga0207664_104180593 | 3300025929 | Agricultural Soil | MLTMSRSGERISVFLFALFLLVAFVVIAFAAGYGLGKILL |
| Ga0207664_104487234 | 3300025929 | Agricultural Soil | TMSRPGDRLSVLFFAFVLLVLFVGLLFAAGYALGRVLL |
| Ga0207664_105193682 | 3300025929 | Agricultural Soil | MLTMSRPGERISVFLFALFLLVAFVVLAFAAGYGLGRILL |
| Ga0207709_117066052 | 3300025935 | Miscanthus Rhizosphere | MAGVRDRLSVFAFAAFLLALFVGLAFAAGYVLGKILL |
| Ga0207665_116026982 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSEMHTMTRPGERISVFLFALFLLAAFVVIAFAAGYGLGRILL |
| Ga0207661_101976072 | 3300025944 | Corn Rhizosphere | MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL |
| Ga0207658_100658953 | 3300025986 | Switchgrass Rhizosphere | MPTPGERTSVVLFALVLLALFVGLAFAVGYFLGKMLL |
| Ga0207703_101681943 | 3300026035 | Switchgrass Rhizosphere | MSEMRTMPTPGERTSVVLFALVLLALFVGLAFAVGYFLG |
| Ga0207639_122344252 | 3300026041 | Corn Rhizosphere | IRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL |
| Ga0207702_109511731 | 3300026078 | Corn Rhizosphere | ISPRTSEMHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0207648_114810462 | 3300026089 | Miscanthus Rhizosphere | MHTMSRSGGRISVFLFAIGLLGLFVGLAFAAGYALGRILL |
| Ga0209901_10242702 | 3300026275 | Permafrost Soil | MARPGERISVFLFALVLLVLFVGLAFAAGYGLGRILL |
| Ga0209059_10243031 | 3300026527 | Soil | RMSEMLTMSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL |
| Ga0209577_103133611 | 3300026552 | Soil | MLTMSRSSDRISVFLFALFLLVAFVVIAFAAGYGVGKILL |
| Ga0209581_10000021075 | 3300027706 | Surface Soil | MHTMTRPGERVSVFLFALALLALFVVLTFAAGYALGRILL |
| Ga0209178_12534982 | 3300027725 | Agricultural Soil | MTRARERTSVFLFAVLLLALFVGLAFAAGYGVGRILL |
| Ga0209810_1000015546 | 3300027773 | Surface Soil | MHTMSRSGGRLSVFLFALFLLAFFLAVTFAAGYAVGKILL |
| Ga0209810_100006315 | 3300027773 | Surface Soil | MTRARERTTVFLFALLLLVLYVGLAFAAGYGLGRILL |
| Ga0209810_10158054 | 3300027773 | Surface Soil | MLTMTRPRERVSVFLFALALLALFVALTFAAGYALGRMLL |
| Ga0209810_10787072 | 3300027773 | Surface Soil | MTRARERSSVFLFAVFLLVLFVGLAFAAGYGLGRILL |
| Ga0209177_101131962 | 3300027775 | Agricultural Soil | MSRSGGRISVFLFAIGLLALFVGLAFAAGYALGRILL |
| Ga0209060_101029683 | 3300027826 | Surface Soil | RSRERISVTLFALFLLALFVVLAFAVGYGVGRMLL |
| Ga0209579_100285325 | 3300027869 | Surface Soil | MLTMTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL |
| Ga0209579_101279722 | 3300027869 | Surface Soil | MLTMTRPSERISVFLFAVVLLALFVGLAFAAGYLLGRILL |
| Ga0209579_102999652 | 3300027869 | Surface Soil | MMRPRDRVTVFLFAVFLLVLFVGLSFAAGYLLGRMLL |
| Ga0209590_109662042 | 3300027882 | Vadose Zone Soil | MARRGERISVFLFALLLLVLFIGLTFAAGYGLGRILL |
| Ga0209006_112404222 | 3300027908 | Forest Soil | MMRPRDRVTVFLFAVFLLVLFVGLSFAAGYLLGRVLL |
| Ga0137415_104468702 | 3300028536 | Vadose Zone Soil | MSRSSDRISVFLFALFLLVAFVALAFAAGYGVGKILL |
| Ga0265319_10119303 | 3300028563 | Rhizosphere | MMGPGDRISVFLFALFLLALFVGLSFAAGYLVGRMLL |
| Ga0265319_10286522 | 3300028563 | Rhizosphere | MMRPGDRVSVFLFALFLLVLFVGLSFAAGYLLGRMLL |
| Ga0265318_103368681 | 3300028577 | Rhizosphere | SRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0265336_102489922 | 3300028666 | Rhizosphere | MSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0307313_101560472 | 3300028715 | Soil | MGRVRERVAVFAFAIFLLGSFVLLAFAAGYLLGKILL |
| Ga0307284_100972642 | 3300028799 | Soil | MSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL |
| Ga0265338_105347852 | 3300028800 | Rhizosphere | MTSEMHTMSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0311347_109041961 | 3300029923 | Fen | MSRSSERISVLLFALFIVLLFVGLAFAAGYGLGRILL |
| Ga0311332_111692042 | 3300029984 | Fen | MSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL |
| Ga0311334_106596601 | 3300029987 | Fen | HTMSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL |
| Ga0311372_113823381 | 3300030520 | Palsa | MFRVRERLSVFVFAAFLLAAFVGLAFAAGWAVGRFLL |
| Ga0170824_1058964562 | 3300031231 | Forest Soil | KIRTMTRARERTTLFLFAVLVLALFVGLAFAAGYGVGRILL |
| Ga0302323_1007581283 | 3300031232 | Fen | MHTMSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL |
| Ga0265340_100691142 | 3300031247 | Rhizosphere | MHTMSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0265340_104422102 | 3300031247 | Rhizosphere | VRAMMRPRDRVSVFLFALFLLVLFVGLSFAAGYLLGRMLL |
| Ga0307506_100437513 | 3300031366 | Soil | MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL |
| Ga0318516_100375002 | 3300031543 | Soil | MTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRILL |
| Ga0318516_103952042 | 3300031543 | Soil | MTRSGGRISVFLFALGLLALFVGLAFAAGYALGKILL |
| Ga0318534_101342462 | 3300031544 | Soil | MSRRGERISVFLFALAVLAVFVGVAFAAGYALGRILL |
| Ga0307408_1022894642 | 3300031548 | Rhizosphere | MSRVRDRLSVFAFAGLLLALFVGLAFAAGYALGKILL |
| Ga0318573_100484842 | 3300031564 | Soil | MTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL |
| Ga0318573_101793143 | 3300031564 | Soil | SLPTCLTTGEMHTMTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRILL |
| Ga0307374_1000404525 | 3300031670 | Soil | MTRPGERISVFLFALFLLALFVALAFAAGYGLGRILL |
| Ga0307374_104323781 | 3300031670 | Soil | MHTMSRSGERISVLLFALFILALFVGLAFAAGYGLGRILL |
| Ga0307373_102848192 | 3300031672 | Soil | MSRSGERISVLLFALFILALFVGLAFAAGYGLGRILL |
| Ga0318574_103002571 | 3300031680 | Soil | MHTMTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRILL |
| Ga0318496_104477841 | 3300031713 | Soil | AVSPCRPRREGLKLHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGKVLL |
| Ga0318502_101478654 | 3300031747 | Soil | LTMTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL |
| Ga0318492_104632301 | 3300031748 | Soil | LPISHPTTEMLTMTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL |
| Ga0306925_101134724 | 3300031890 | Soil | MLTMTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL |
| Ga0318551_103044721 | 3300031896 | Soil | MLTMTRPRERISVFLFALFLLGLFIALTFAAGYVLGRILL |
| Ga0308175_1008937432 | 3300031938 | Soil | MTRPGERISVLFFALVVLVLFVGLAFAVGYAVGRLLL |
| Ga0308175_1023274042 | 3300031938 | Soil | MTRSRERIVVFSFALFLLVLFVVLAFAAGYGVGRILL |
| Ga0308175_1028081781 | 3300031938 | Soil | MSRPGDRLSVLFFAIVLLVLFVGLAFAAGYALGRVLL |
| Ga0308174_101535613 | 3300031939 | Soil | MTRARERITVFCFALFLLVLFVALAFAAGYGVGRILL |
| Ga0308174_101700823 | 3300031939 | Soil | MRTMTRPGERISVFLFALLLLVLFVGLAFAAGYGIG |
| Ga0308174_104266942 | 3300031939 | Soil | MSRPGERISVFLFALFLLALFVGLAFAVGYVIGRMLL |
| Ga0308174_106095922 | 3300031939 | Soil | MTRARERITVFLFALLLLVVFVGLAFAAGYGIGRILL |
| Ga0310912_113541222 | 3300031941 | Soil | RPRERISVFVFAFFLLALFVGLAFAAGYLLGRILL |
| Ga0308176_101872114 | 3300031996 | Soil | TMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL |
| Ga0308176_103655721 | 3300031996 | Soil | ISRPTSEMHTMNRPGERISVFLFALFLLVLFVGLAFAAGYGIGRILL |
| Ga0308176_106031032 | 3300031996 | Soil | MTRARERITVFLFAVLLLVAFIVLAFAAGYGIGRILL |
| Ga0308176_113700002 | 3300031996 | Soil | MSRPGDRISVFLFALFLLVLFVGLAFAAGYGIGRILL |
| Ga0308176_122799041 | 3300031996 | Soil | MTRARERITVFCFALFLLALFVGLAFAAGYGVGKILL |
| Ga0318562_107547482 | 3300032008 | Soil | MTRPRERISVFLFALFLLGLFIALTFAAGYVLGRILL |
| Ga0318556_102263583 | 3300032043 | Soil | TYRRTSEMLTMTRPRERISVFLFALFLLGLFIALTFAAGYVLGRILL |
| Ga0308173_100395365 | 3300032074 | Soil | MHTMSRPGERISVFLFALFLLALFVGLAFAVGYVIGRMLL |
| Ga0307471_1024431402 | 3300032180 | Hardwood Forest Soil | MLTMSRSSDRISVFLFALFLVVAFVVVAFAAGYGVGKILL |
| Ga0307472_1016607382 | 3300032205 | Hardwood Forest Soil | MSRSSERITVFLFALFLLAAFVALAFAAGYGLGKILL |
| Ga0306920_1040697371 | 3300032261 | Soil | GEMHTMSRRGERISVFLFALAVLAVFVGVAFAAGYALGRILL |
| Ga0335085_104606072 | 3300032770 | Soil | MTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRMLL |
| Ga0335085_108990612 | 3300032770 | Soil | MSRSRERISVTLFALFLLALFIAVAFAVGYGVGRM |
| Ga0335085_118577162 | 3300032770 | Soil | LSRARERITVFLFALFLLVLFVVLAFAAGYGIGRMLL |
| Ga0335082_103472871 | 3300032782 | Soil | LPISPRTSEMTAGMPTMSRSRERIVVTLFAFLLLVLFVGLAFAAGYGLGRILL |
| Ga0335082_114210702 | 3300032782 | Soil | MSRSGERISVLLFALFLLVLFVGLAFAAGYGLGRILL |
| Ga0335080_106112712 | 3300032828 | Soil | MTRSRERITVTLFALLLLALFVVLAFAAGYGVGRMLL |
| Ga0335081_105354161 | 3300032892 | Soil | RATGEMPITMTGTRERISVTLFALFLLALFVGLAFAAGYGVGRMLL |
| Ga0335069_103377872 | 3300032893 | Soil | MSRSGDRISVLLFALFLLVLFVGLAFAAGYGLGRILL |
| Ga0335069_107197023 | 3300032893 | Soil | MHTMTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRMLL |
| Ga0335069_112777551 | 3300032893 | Soil | LPISHLPTEMLTMTRPSERISVFLFAIALLALFVGLTFAAGYLLGKILL |
| Ga0335069_121258012 | 3300032893 | Soil | LSRARERITVFVFALFLLLLFVTLAFAAGYGIGRMLL |
| Ga0335075_101159216 | 3300032896 | Soil | MSRARERITVFLFALFLLVLFVALAFAAGYGIGRMLV |
| Ga0335075_101565093 | 3300032896 | Soil | MTRPGDRISVFVFAFVLLALFVAFTFAAGYVVGRMLL |
| Ga0335071_100497675 | 3300032897 | Soil | MHTMSRSGDRISVLLFALFLLVLFVGLAFAAGYGLGRILL |
| Ga0335071_101730753 | 3300032897 | Soil | MTRSRERISVTLFALFLLALFVVLAFAVGYGVGTILL |
| Ga0314868_008042_310_432 | 3300033758 | Peatland | MHTMTRRGERIGVFLFALAMLAIFVGAAFAVGYAVGRILL |
| Ga0314862_0002005_1166_1288 | 3300033803 | Peatland | MHTMTRRGERIGVFLFALAMLAIFVGAAFAAGYAVGRILL |
| Ga0314864_0029460_343_477 | 3300033805 | Peatland | MTGEMHTMTRRGERIGVFLFALAMLAIFVGAAFAAGYAVGRILL |
| Ga0326723_0591695_27_149 | 3300034090 | Peat Soil | MHTMTRRGERISVFLFALAVLAVFVGAAFAAGYALGRILL |
| Ga0370501_0005922_2998_3111 | 3300034195 | Untreated Peat Soil | MSRSSERISVLLFALFILVLFVGLAFAAGYGLGRILL |
| Ga0372943_0001055_4147_4260 | 3300034268 | Soil | MTRARERISVFLFAFALLALFVGLAFAAGYGLGRILL |
| Ga0372943_0025446_2212_2325 | 3300034268 | Soil | MSRSGDRLSVLLFALFLLALFVGLAFAAGYGLGRILL |
| Ga0372946_0138936_21_161 | 3300034384 | Soil | MTGTTEMLTMSRSSDRISVFLFALFLLVAFVVIAFAAGYGLGRILL |
| ⦗Top⦘ |