Metagenome / Metatranscriptome Family F004834

Basic Information
Family ID	F004834
Family Type	Metagenome / Metatranscriptome
Number of Sequences	421
Average Sequence Length	41 residues
Representative Sequence	SFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Number of Associated Samples	129
Number of Associated Scaffolds	420

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	6.18 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	125
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Most Common Taxonomy
Group	Unclassified (99.287 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (53.444 % of family members)
Environment Ontology (ENVO)	Unclassified (88.361 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (86.223 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14%
Feature Viewer

Powered by Feature Viewer

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
All Organisms	root	All Organisms	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
cellular organisms	root	All Organisms → cellular organisms	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.29 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.48 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005335\|Ga0070666_11245468	Not Available	554	Open in IMG/M
3300005355\|Ga0070671_101039466	Not Available	718	Open in IMG/M
3300005365\|Ga0070688_101511514	Not Available	546	Open in IMG/M
3300005438\|Ga0070701_10523582	Not Available	773	Open in IMG/M
3300005467\|Ga0070706_101942176	Not Available	534	Open in IMG/M
3300005544\|Ga0070686_101395886	Not Available	587	Open in IMG/M
3300005618\|Ga0068864_100730047	Not Available	969	Open in IMG/M
3300005618\|Ga0068864_101199438	Not Available	757	Open in IMG/M
3300005618\|Ga0068864_101498524	Not Available	677	Open in IMG/M
3300005618\|Ga0068864_102120700	Not Available	568	Open in IMG/M
3300005618\|Ga0068864_102258817	Not Available	550	Open in IMG/M
3300005719\|Ga0068861_101226048	Not Available	726	Open in IMG/M
3300005841\|Ga0068863_101483610	Not Available	686	Open in IMG/M
3300005841\|Ga0068863_101644456	Not Available	651	Open in IMG/M
3300005841\|Ga0068863_102082585	Not Available	577	Open in IMG/M
3300005841\|Ga0068863_102199804	Not Available	561	Open in IMG/M
3300005841\|Ga0068863_102277164	Not Available	551	Open in IMG/M
3300005841\|Ga0068863_102465240	Not Available	529	Open in IMG/M
3300005841\|Ga0068863_102616859	Not Available	513	Open in IMG/M
3300005842\|Ga0068858_101528158	Not Available	658	Open in IMG/M
3300005842\|Ga0068858_101693024	Not Available	624	Open in IMG/M
3300005842\|Ga0068858_101838218	Not Available	598	Open in IMG/M
3300005842\|Ga0068858_102036612	Not Available	567	Open in IMG/M
3300005842\|Ga0068858_102318315	Not Available	531	Open in IMG/M
3300005843\|Ga0068860_102433795	Not Available	543	Open in IMG/M
3300005843\|Ga0068860_102696217	Not Available	515	Open in IMG/M
3300009092\|Ga0105250_10317287	Not Available	677	Open in IMG/M
3300009553\|Ga0105249_13496631	Not Available	506	Open in IMG/M
3300009980\|Ga0105135_123379	Not Available	556	Open in IMG/M
3300009989\|Ga0105131_115959	Not Available	700	Open in IMG/M
3300009992\|Ga0105120_1041380	Not Available	570	Open in IMG/M
3300010276\|Ga0134104_1085981	Not Available	552	Open in IMG/M
3300010371\|Ga0134125_12730389	Not Available	537	Open in IMG/M
3300010396\|Ga0134126_11883089	Not Available	655	Open in IMG/M
3300010397\|Ga0134124_12671569	Not Available	542	Open in IMG/M
3300010399\|Ga0134127_12310949	Not Available	617	Open in IMG/M
3300010399\|Ga0134127_13437358	Not Available	518	Open in IMG/M
3300010399\|Ga0134127_13459131	Not Available	517	Open in IMG/M
3300010400\|Ga0134122_12518760	Not Available	564	Open in IMG/M
3300010401\|Ga0134121_12792368	Not Available	534	Open in IMG/M
3300010403\|Ga0134123_13128593	Not Available	532	Open in IMG/M
3300012949\|Ga0153798_10263876	Not Available	572	Open in IMG/M
3300012949\|Ga0153798_10287282	Not Available	534	Open in IMG/M
3300014325\|Ga0163163_12768209	Not Available	547	Open in IMG/M
3300014326\|Ga0157380_11899189	Not Available	656	Open in IMG/M
3300014326\|Ga0157380_13171419	Not Available	525	Open in IMG/M
3300014968\|Ga0157379_11849857	Not Available	594	Open in IMG/M
3300015270\|Ga0182183_1077790	Not Available	537	Open in IMG/M
3300015270\|Ga0182183_1092580	Not Available	508	Open in IMG/M
3300015278\|Ga0182099_1035029	Not Available	622	Open in IMG/M
3300015278\|Ga0182099_1053348	Not Available	553	Open in IMG/M
3300015278\|Ga0182099_1056810	Not Available	543	Open in IMG/M
3300015278\|Ga0182099_1059011	Not Available	537	Open in IMG/M
3300015278\|Ga0182099_1065991	Not Available	520	Open in IMG/M
3300015280\|Ga0182100_1070773	Not Available	568	Open in IMG/M
3300015280\|Ga0182100_1091985	Not Available	517	Open in IMG/M
3300015290\|Ga0182105_1037616	Not Available	721	Open in IMG/M
3300015290\|Ga0182105_1048096	Not Available	667	Open in IMG/M
3300015290\|Ga0182105_1087675	Not Available	544	Open in IMG/M
3300015297\|Ga0182104_1067294	Not Available	621	Open in IMG/M
3300015301\|Ga0182184_1033241	Not Available	731	Open in IMG/M
3300015301\|Ga0182184_1060149	Not Available	602	Open in IMG/M
3300015301\|Ga0182184_1075434	Not Available	557	Open in IMG/M
3300015301\|Ga0182184_1100721	Not Available	503	Open in IMG/M
3300015306\|Ga0182180_1072500	Not Available	554	Open in IMG/M
3300015306\|Ga0182180_1073040	Not Available	553	Open in IMG/M
3300015306\|Ga0182180_1077951	Not Available	540	Open in IMG/M
3300015306\|Ga0182180_1079480	Not Available	536	Open in IMG/M
3300015306\|Ga0182180_1088040	Not Available	517	Open in IMG/M
3300015306\|Ga0182180_1088575	Not Available	516	Open in IMG/M
3300015306\|Ga0182180_1089559	Not Available	514	Open in IMG/M
3300015306\|Ga0182180_1089972	Not Available	513	Open in IMG/M
3300015306\|Ga0182180_1096407	Not Available	500	Open in IMG/M
3300015310\|Ga0182162_1079102	Not Available	606	Open in IMG/M
3300015310\|Ga0182162_1081601	Not Available	599	Open in IMG/M
3300015310\|Ga0182162_1090647	Not Available	576	Open in IMG/M
3300015310\|Ga0182162_1118602	Not Available	521	Open in IMG/M
3300015310\|Ga0182162_1123238	Not Available	513	Open in IMG/M
3300015311\|Ga0182182_1082386	Not Available	581	Open in IMG/M
3300015311\|Ga0182182_1083609	Not Available	578	Open in IMG/M
3300015311\|Ga0182182_1113127	Not Available	518	Open in IMG/M
3300015311\|Ga0182182_1115647	Not Available	513	Open in IMG/M
3300015312\|Ga0182168_1079653	Not Available	622	Open in IMG/M
3300015312\|Ga0182168_1105487	Not Available	558	Open in IMG/M
3300015312\|Ga0182168_1129858	Not Available	514	Open in IMG/M
3300015312\|Ga0182168_1133022	Not Available	509	Open in IMG/M
3300015313\|Ga0182164_1091351	Not Available	590	Open in IMG/M
3300015315\|Ga0182120_1071650	Not Available	650	Open in IMG/M
3300015315\|Ga0182120_1076331	Not Available	635	Open in IMG/M
3300015315\|Ga0182120_1090708	Not Available	595	Open in IMG/M
3300015316\|Ga0182121_1117342	Not Available	551	Open in IMG/M
3300015316\|Ga0182121_1127679	Not Available	532	Open in IMG/M
3300015316\|Ga0182121_1128985	Not Available	530	Open in IMG/M
3300015316\|Ga0182121_1133521	Not Available	522	Open in IMG/M
3300015317\|Ga0182136_1067384	Not Available	666	Open in IMG/M
3300015317\|Ga0182136_1076815	Not Available	635	Open in IMG/M
3300015317\|Ga0182136_1108534	Not Available	558	Open in IMG/M
3300015317\|Ga0182136_1113120	Not Available	549	Open in IMG/M
3300015317\|Ga0182136_1116989	Not Available	542	Open in IMG/M
3300015318\|Ga0182181_1024141	Not Available	851	Open in IMG/M
3300015318\|Ga0182181_1044686	Not Available	697	Open in IMG/M
3300015318\|Ga0182181_1102736	Not Available	525	Open in IMG/M
3300015320\|Ga0182165_1097620	Not Available	593	Open in IMG/M
3300015320\|Ga0182165_1113096	Not Available	560	Open in IMG/M
3300015320\|Ga0182165_1121574	Not Available	544	Open in IMG/M
3300015320\|Ga0182165_1129663	Not Available	530	Open in IMG/M
3300015320\|Ga0182165_1142132	Not Available	510	Open in IMG/M
3300015320\|Ga0182165_1142220	Not Available	510	Open in IMG/M
3300015320\|Ga0182165_1146904	Not Available	502	Open in IMG/M
3300015324\|Ga0182134_1112506	Not Available	561	Open in IMG/M
3300015324\|Ga0182134_1117891	Not Available	551	Open in IMG/M
3300015324\|Ga0182134_1118330	Not Available	550	Open in IMG/M
3300015325\|Ga0182148_1033639	Not Available	846	Open in IMG/M
3300015325\|Ga0182148_1052585	Not Available	732	Open in IMG/M
3300015325\|Ga0182148_1060241	Not Available	699	Open in IMG/M
3300015325\|Ga0182148_1069651	Not Available	665	Open in IMG/M
3300015325\|Ga0182148_1078469	Not Available	637	Open in IMG/M
3300015325\|Ga0182148_1084702	Not Available	620	Open in IMG/M
3300015325\|Ga0182148_1110949	Not Available	560	Open in IMG/M
3300015325\|Ga0182148_1119625	Not Available	544	Open in IMG/M
3300015325\|Ga0182148_1135828	Not Available	517	Open in IMG/M
3300015326\|Ga0182166_1079582	Not Available	632	Open in IMG/M
3300015326\|Ga0182166_1112042	Not Available	557	Open in IMG/M
3300015326\|Ga0182166_1114607	Not Available	552	Open in IMG/M
3300015326\|Ga0182166_1130180	Not Available	525	Open in IMG/M
3300015327\|Ga0182114_1062392	Not Available	735	Open in IMG/M
3300015327\|Ga0182114_1114965	Not Available	581	Open in IMG/M
3300015327\|Ga0182114_1125052	Not Available	561	Open in IMG/M
3300015328\|Ga0182153_1045235	Not Available	788	Open in IMG/M
3300015328\|Ga0182153_1061514	Not Available	709	Open in IMG/M
3300015328\|Ga0182153_1071150	Not Available	674	Open in IMG/M
3300015328\|Ga0182153_1074543	Not Available	663	Open in IMG/M
3300015328\|Ga0182153_1112976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	568	Open in IMG/M
3300015328\|Ga0182153_1120875	Not Available	552	Open in IMG/M
3300015328\|Ga0182153_1138979	Not Available	523	Open in IMG/M
3300015328\|Ga0182153_1140655	Not Available	520	Open in IMG/M
3300015330\|Ga0182152_1044488	Not Available	805	Open in IMG/M
3300015330\|Ga0182152_1078865	Not Available	657	Open in IMG/M
3300015330\|Ga0182152_1126316	Not Available	546	Open in IMG/M
3300015330\|Ga0182152_1137063	Not Available	528	Open in IMG/M
3300015330\|Ga0182152_1137791	Not Available	527	Open in IMG/M
3300015331\|Ga0182131_1064303	Not Available	710	Open in IMG/M
3300015331\|Ga0182131_1143358	Not Available	521	Open in IMG/M
3300015332\|Ga0182117_1123614	Not Available	577	Open in IMG/M
3300015333\|Ga0182147_1079466	Not Available	684	Open in IMG/M
3300015333\|Ga0182147_1099330	Not Available	627	Open in IMG/M
3300015333\|Ga0182147_1122667	Not Available	576	Open in IMG/M
3300015333\|Ga0182147_1134938	Not Available	554	Open in IMG/M
3300015333\|Ga0182147_1148523	Not Available	532	Open in IMG/M
3300015333\|Ga0182147_1162641	Not Available	511	Open in IMG/M
3300015334\|Ga0182132_1117656	Not Available	587	Open in IMG/M
3300015334\|Ga0182132_1132218	Not Available	559	Open in IMG/M
3300015334\|Ga0182132_1144111	Not Available	539	Open in IMG/M
3300015336\|Ga0182150_1111151	Not Available	593	Open in IMG/M
3300015336\|Ga0182150_1167119	Not Available	501	Open in IMG/M
3300015337\|Ga0182151_1111224	Not Available	593	Open in IMG/M
3300015337\|Ga0182151_1139167	Not Available	542	Open in IMG/M
3300015338\|Ga0182137_1068037	Not Available	753	Open in IMG/M
3300015338\|Ga0182137_1143139	Not Available	554	Open in IMG/M
3300015338\|Ga0182137_1175328	Not Available	506	Open in IMG/M
3300015339\|Ga0182149_1070196	Not Available	726	Open in IMG/M
3300015339\|Ga0182149_1101411	Not Available	630	Open in IMG/M
3300015339\|Ga0182149_1131784	Not Available	566	Open in IMG/M
3300015339\|Ga0182149_1146228	Not Available	541	Open in IMG/M
3300015340\|Ga0182133_1054425	Not Available	839	Open in IMG/M
3300015340\|Ga0182133_1166378	Not Available	536	Open in IMG/M
3300015348\|Ga0182115_1236067	Not Available	583	Open in IMG/M
3300015348\|Ga0182115_1252428	Not Available	561	Open in IMG/M
3300015348\|Ga0182115_1253119	Not Available	560	Open in IMG/M
3300015348\|Ga0182115_1277263	Not Available	531	Open in IMG/M
3300015348\|Ga0182115_1291226	Not Available	516	Open in IMG/M
3300015349\|Ga0182185_1217450	Not Available	579	Open in IMG/M
3300015349\|Ga0182185_1244307	Not Available	546	Open in IMG/M
3300015349\|Ga0182185_1248187	Not Available	542	Open in IMG/M
3300015349\|Ga0182185_1256678	Not Available	533	Open in IMG/M
3300015349\|Ga0182185_1263764	Not Available	525	Open in IMG/M
3300015349\|Ga0182185_1270649	Not Available	518	Open in IMG/M
3300015349\|Ga0182185_1272727	Not Available	516	Open in IMG/M
3300015350\|Ga0182163_1123324	Not Available	797	Open in IMG/M
3300015350\|Ga0182163_1133688	Not Available	767	Open in IMG/M
3300015350\|Ga0182163_1174617	Not Available	671	Open in IMG/M
3300015350\|Ga0182163_1212399	Not Available	606	Open in IMG/M
3300015350\|Ga0182163_1235850	Not Available	573	Open in IMG/M
3300015350\|Ga0182163_1269518	Not Available	533	Open in IMG/M
3300015350\|Ga0182163_1271594	Not Available	531	Open in IMG/M
3300015350\|Ga0182163_1284884	Not Available	517	Open in IMG/M
3300015350\|Ga0182163_1297264	Not Available	505	Open in IMG/M
3300015352\|Ga0182169_1202036	Not Available	649	Open in IMG/M
3300015352\|Ga0182169_1219033	Not Available	621	Open in IMG/M
3300015352\|Ga0182169_1254708	Not Available	570	Open in IMG/M
3300015352\|Ga0182169_1270072	Not Available	551	Open in IMG/M
3300015352\|Ga0182169_1292394	Not Available	526	Open in IMG/M
3300015352\|Ga0182169_1298991	Not Available	519	Open in IMG/M
3300015352\|Ga0182169_1304233	Not Available	514	Open in IMG/M
3300015352\|Ga0182169_1305605	Not Available	512	Open in IMG/M
3300015352\|Ga0182169_1313038	Not Available	504	Open in IMG/M
3300015353\|Ga0182179_1090193	Not Available	904	Open in IMG/M
3300015353\|Ga0182179_1130757	Not Available	772	Open in IMG/M
3300015353\|Ga0182179_1156559	Not Available	712	Open in IMG/M
3300015353\|Ga0182179_1156610	Not Available	712	Open in IMG/M
3300015353\|Ga0182179_1200613	Not Available	635	Open in IMG/M
3300015353\|Ga0182179_1204477	Not Available	629	Open in IMG/M
3300015353\|Ga0182179_1241051	Not Available	582	Open in IMG/M
3300015353\|Ga0182179_1241498	Not Available	581	Open in IMG/M
3300015353\|Ga0182179_1307657	Not Available	516	Open in IMG/M
3300015353\|Ga0182179_1320030	Not Available	506	Open in IMG/M
3300015354\|Ga0182167_1287984	Not Available	585	Open in IMG/M
3300017408\|Ga0182197_1085726	Not Available	625	Open in IMG/M
3300017408\|Ga0182197_1125811	Not Available	540	Open in IMG/M
3300017412\|Ga0182199_1078327	Not Available	728	Open in IMG/M
3300017412\|Ga0182199_1093570	Not Available	682	Open in IMG/M
3300017412\|Ga0182199_1197582	Not Available	510	Open in IMG/M
3300017414\|Ga0182195_1080057	Not Available	751	Open in IMG/M
3300017414\|Ga0182195_1133734	Not Available	618	Open in IMG/M
3300017414\|Ga0182195_1162167	Not Available	572	Open in IMG/M
3300017414\|Ga0182195_1173078	Not Available	557	Open in IMG/M
3300017414\|Ga0182195_1200036	Not Available	525	Open in IMG/M
3300017414\|Ga0182195_1205820	Not Available	518	Open in IMG/M
3300017414\|Ga0182195_1216361	Not Available	508	Open in IMG/M
3300017421\|Ga0182213_1166580	Not Available	623	Open in IMG/M
3300017422\|Ga0182201_1063548	Not Available	668	Open in IMG/M
3300017422\|Ga0182201_1105579	Not Available	562	Open in IMG/M
3300017422\|Ga0182201_1138199	Not Available	511	Open in IMG/M
3300017432\|Ga0182196_1123194	Not Available	547	Open in IMG/M
3300017435\|Ga0182194_1080678	Not Available	641	Open in IMG/M
3300017435\|Ga0182194_1107353	Not Available	577	Open in IMG/M
3300017439\|Ga0182200_1054461	Not Available	737	Open in IMG/M
3300017439\|Ga0182200_1058534	Not Available	720	Open in IMG/M
3300017439\|Ga0182200_1090441	Not Available	621	Open in IMG/M
3300017439\|Ga0182200_1119535	Not Available	563	Open in IMG/M
3300017439\|Ga0182200_1131917	Not Available	544	Open in IMG/M
3300017439\|Ga0182200_1166362	Not Available	500	Open in IMG/M
3300017440\|Ga0182214_1049405	Not Available	842	Open in IMG/M
3300017440\|Ga0182214_1083976	Not Available	666	Open in IMG/M
3300017440\|Ga0182214_1086901	Not Available	657	Open in IMG/M
3300017440\|Ga0182214_1125733	Not Available	559	Open in IMG/M
3300017445\|Ga0182198_1094508	Not Available	676	Open in IMG/M
3300017445\|Ga0182198_1117894	Not Available	622	Open in IMG/M
3300017445\|Ga0182198_1150096	Not Available	567	Open in IMG/M
3300017445\|Ga0182198_1173872	Not Available	535	Open in IMG/M
3300017445\|Ga0182198_1192280	Not Available	514	Open in IMG/M
3300017445\|Ga0182198_1196023	Not Available	510	Open in IMG/M
3300017447\|Ga0182215_1117574	Not Available	600	Open in IMG/M
3300017447\|Ga0182215_1125482	Not Available	583	Open in IMG/M
3300017447\|Ga0182215_1128146	Not Available	577	Open in IMG/M
3300017692\|Ga0182210_1140288	Not Available	535	Open in IMG/M
3300017693\|Ga0182216_1043515	Not Available	940	Open in IMG/M
3300017693\|Ga0182216_1053231	Not Available	876	Open in IMG/M
3300017693\|Ga0182216_1076920	Not Available	765	Open in IMG/M
3300017693\|Ga0182216_1086530	Not Available	733	Open in IMG/M
3300017693\|Ga0182216_1090436	Not Available	720	Open in IMG/M
3300017693\|Ga0182216_1125640	Not Available	634	Open in IMG/M
3300017693\|Ga0182216_1137034	Not Available	613	Open in IMG/M
3300017693\|Ga0182216_1163048	Not Available	572	Open in IMG/M
3300017693\|Ga0182216_1181388	Not Available	548	Open in IMG/M
3300017693\|Ga0182216_1182335	Not Available	547	Open in IMG/M
3300017693\|Ga0182216_1183612	Not Available	545	Open in IMG/M
3300017693\|Ga0182216_1219394	Not Available	507	Open in IMG/M
3300017693\|Ga0182216_1222361	Not Available	504	Open in IMG/M
3300017694\|Ga0182211_1114178	Not Available	635	Open in IMG/M
3300017792\|Ga0163161_11492751	Not Available	593	Open in IMG/M
3300020023\|Ga0182178_1004290	Not Available	884	Open in IMG/M
3300020023\|Ga0182178_1005493	Not Available	818	Open in IMG/M
3300020023\|Ga0182178_1008076	Not Available	716	Open in IMG/M
3300020023\|Ga0182178_1009347	Not Available	684	Open in IMG/M
3300020023\|Ga0182178_1015573	Not Available	575	Open in IMG/M
3300020023\|Ga0182178_1016048	Not Available	569	Open in IMG/M
3300026035\|Ga0207703_11718575	Not Available	603	Open in IMG/M
3300026035\|Ga0207703_11990642	Not Available	557	Open in IMG/M
3300026088\|Ga0207641_12108718	Not Available	564	Open in IMG/M
3300026095\|Ga0207676_12126967	Not Available	559	Open in IMG/M
3300028049\|Ga0268322_1052061	Not Available	518	Open in IMG/M
3300028049\|Ga0268322_1055417	Not Available	507	Open in IMG/M
3300028049\|Ga0268322_1055897	Not Available	505	Open in IMG/M
3300028050\|Ga0268328_1034456	Not Available	655	Open in IMG/M
3300028050\|Ga0268328_1035266	Not Available	650	Open in IMG/M
3300028050\|Ga0268328_1046159	Not Available	592	Open in IMG/M
3300028050\|Ga0268328_1051290	Not Available	570	Open in IMG/M
3300028050\|Ga0268328_1051540	Not Available	569	Open in IMG/M
3300028051\|Ga0268344_1007469	Not Available	733	Open in IMG/M
3300028052\|Ga0268300_1010133	Not Available	541	Open in IMG/M
3300028054\|Ga0268306_1016207	Not Available	646	Open in IMG/M
3300028054\|Ga0268306_1019420	Not Available	611	Open in IMG/M
3300028055\|Ga0268338_1009218	Not Available	810	Open in IMG/M
3300028056\|Ga0268330_1013950	Not Available	837	Open in IMG/M
3300028056\|Ga0268330_1015274	Not Available	815	Open in IMG/M
3300028056\|Ga0268330_1016157	Not Available	800	Open in IMG/M
3300028056\|Ga0268330_1022959	Not Available	716	Open in IMG/M
3300028056\|Ga0268330_1023963	Not Available	706	Open in IMG/M
3300028056\|Ga0268330_1025408	Not Available	692	Open in IMG/M
3300028056\|Ga0268330_1026043	Not Available	686	Open in IMG/M
3300028056\|Ga0268330_1027657	Not Available	672	Open in IMG/M
3300028056\|Ga0268330_1031426	Not Available	644	Open in IMG/M
3300028056\|Ga0268330_1036473	Not Available	612	Open in IMG/M
3300028056\|Ga0268330_1053903	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	531	Open in IMG/M
3300028057\|Ga0268352_1033611	Not Available	566	Open in IMG/M
3300028058\|Ga0268332_1004719	Not Available	1216	Open in IMG/M
3300028058\|Ga0268332_1023909	Not Available	766	Open in IMG/M
3300028058\|Ga0268332_1054761	Not Available	578	Open in IMG/M
3300028058\|Ga0268332_1060211	Not Available	558	Open in IMG/M
3300028058\|Ga0268332_1064699	Not Available	543	Open in IMG/M
3300028058\|Ga0268332_1067182	Not Available	535	Open in IMG/M
3300028058\|Ga0268332_1070189	Not Available	526	Open in IMG/M
3300028058\|Ga0268332_1072631	Not Available	519	Open in IMG/M
3300028058\|Ga0268332_1078074	Not Available	505	Open in IMG/M
3300028061\|Ga0268314_1032009	Not Available	608	Open in IMG/M
3300028061\|Ga0268314_1033917	Not Available	596	Open in IMG/M
3300028062\|Ga0268342_1007786	Not Available	887	Open in IMG/M
3300028062\|Ga0268342_1008144	Not Available	874	Open in IMG/M
3300028062\|Ga0268342_1022020	Not Available	638	Open in IMG/M
3300028062\|Ga0268342_1025270	Not Available	611	Open in IMG/M
3300028062\|Ga0268342_1027535	Not Available	595	Open in IMG/M
3300028062\|Ga0268342_1031906	Not Available	566	Open in IMG/M
3300028062\|Ga0268342_1032214	Not Available	564	Open in IMG/M
3300028062\|Ga0268342_1037540	Not Available	535	Open in IMG/M
3300028064\|Ga0268340_1081040	Not Available	515	Open in IMG/M
3300028139\|Ga0268355_1007406	Not Available	672	Open in IMG/M
3300028140\|Ga0268334_1011641	Not Available	594	Open in IMG/M
3300028140\|Ga0268334_1014677	Not Available	551	Open in IMG/M
3300028140\|Ga0268334_1016890	Not Available	527	Open in IMG/M
3300028142\|Ga0268347_1010419	Not Available	727	Open in IMG/M
3300028142\|Ga0268347_1015014	Not Available	653	Open in IMG/M
3300028142\|Ga0268347_1015704	Not Available	644	Open in IMG/M
3300028142\|Ga0268347_1017526	Not Available	622	Open in IMG/M
3300028142\|Ga0268347_1017905	Not Available	618	Open in IMG/M
3300028142\|Ga0268347_1021180	Not Available	588	Open in IMG/M
3300028142\|Ga0268347_1027288	Not Available	544	Open in IMG/M
3300028142\|Ga0268347_1029036	Not Available	533	Open in IMG/M
3300028142\|Ga0268347_1029039	Not Available	533	Open in IMG/M
3300028142\|Ga0268347_1035327	Not Available	500	Open in IMG/M
3300028142\|Ga0268347_1035327	Not Available	500	Open in IMG/M
3300028143\|Ga0268348_1013172	Not Available	622	Open in IMG/M
3300028144\|Ga0268345_1026289	Not Available	522	Open in IMG/M
3300028149\|Ga0268353_119986	Not Available	504	Open in IMG/M
3300028151\|Ga0268308_1009451	Not Available	757	Open in IMG/M
3300028151\|Ga0268308_1010424	Not Available	733	Open in IMG/M
3300028151\|Ga0268308_1010948	Not Available	721	Open in IMG/M
3300028151\|Ga0268308_1013016	Not Available	683	Open in IMG/M
3300028151\|Ga0268308_1013565	Not Available	675	Open in IMG/M
3300028151\|Ga0268308_1025052	Not Available	555	Open in IMG/M
3300028151\|Ga0268308_1029486	Not Available	526	Open in IMG/M
3300028151\|Ga0268308_1033608	Not Available	503	Open in IMG/M
3300028152\|Ga0268336_1020395	Not Available	574	Open in IMG/M
3300028154\|Ga0268341_1004147	Not Available	926	Open in IMG/M
3300028154\|Ga0268341_1006293	Not Available	820	Open in IMG/M
3300028154\|Ga0268341_1010043	Not Available	715	Open in IMG/M
3300028154\|Ga0268341_1014466	Not Available	642	Open in IMG/M
3300028154\|Ga0268341_1019980	Not Available	583	Open in IMG/M
3300028154\|Ga0268341_1030199	Not Available	512	Open in IMG/M
3300028154\|Ga0268341_1030947	Not Available	508	Open in IMG/M
3300028248\|Ga0268312_1017150	Not Available	650	Open in IMG/M
3300028248\|Ga0268312_1026161	Not Available	570	Open in IMG/M
3300028251\|Ga0268324_1013787	Not Available	614	Open in IMG/M
3300028251\|Ga0268324_1017116	Not Available	574	Open in IMG/M
3300028251\|Ga0268324_1020314	Not Available	545	Open in IMG/M
3300028251\|Ga0268324_1024607	Not Available	514	Open in IMG/M
3300028253\|Ga0268316_1010554	Not Available	653	Open in IMG/M
3300028253\|Ga0268316_1014199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	599	Open in IMG/M
3300028256\|Ga0268304_1008299	Not Available	614	Open in IMG/M
3300028256\|Ga0268304_1011438	Not Available	556	Open in IMG/M
3300028262\|Ga0268310_1002090	Not Available	1371	Open in IMG/M
3300028262\|Ga0268310_1005878	Not Available	1003	Open in IMG/M
3300028262\|Ga0268310_1009702	Not Available	863	Open in IMG/M
3300028262\|Ga0268310_1011790	Not Available	814	Open in IMG/M
3300028262\|Ga0268310_1018393	Not Available	710	Open in IMG/M
3300028262\|Ga0268310_1020705	Not Available	684	Open in IMG/M
3300028262\|Ga0268310_1023668	Not Available	656	Open in IMG/M
3300028262\|Ga0268310_1024580	Not Available	648	Open in IMG/M
3300028262\|Ga0268310_1029416	Not Available	612	Open in IMG/M
3300028262\|Ga0268310_1031803	Not Available	596	Open in IMG/M
3300028262\|Ga0268310_1033003	Not Available	589	Open in IMG/M
3300028262\|Ga0268310_1035811	Not Available	573	Open in IMG/M
3300028262\|Ga0268310_1042068	Not Available	542	Open in IMG/M
3300028262\|Ga0268310_1042458	Not Available	540	Open in IMG/M
3300028262\|Ga0268310_1046342	Not Available	524	Open in IMG/M
3300028262\|Ga0268310_1053122	Not Available	500	Open in IMG/M
3300028381\|Ga0268264_11974410	Not Available	593	Open in IMG/M
3300028381\|Ga0268264_12280140	Not Available	548	Open in IMG/M
3300028381\|Ga0268264_12660678	Not Available	504	Open in IMG/M
3300028464\|Ga0268302_105513	Not Available	588	Open in IMG/M
3300028465\|Ga0268301_103150	Not Available	608	Open in IMG/M
3300028466\|Ga0268321_106149	Not Available	604	Open in IMG/M
3300028468\|Ga0268317_1002962	Not Available	774	Open in IMG/M
3300028468\|Ga0268317_1010792	Not Available	535	Open in IMG/M
3300028468\|Ga0268317_1011914	Not Available	520	Open in IMG/M
3300028469\|Ga0268337_1000956	Not Available	1203	Open in IMG/M
3300028469\|Ga0268337_1001872	Not Available	991	Open in IMG/M
3300028469\|Ga0268337_1005812	Not Available	719	Open in IMG/M
3300028469\|Ga0268337_1012598	Not Available	577	Open in IMG/M
3300028469\|Ga0268337_1016845	Not Available	530	Open in IMG/M
3300028471\|Ga0268323_1015661	Not Available	559	Open in IMG/M
3300028471\|Ga0268323_1018639	Not Available	530	Open in IMG/M
3300028472\|Ga0268315_1004826	Not Available	843	Open in IMG/M
3300028472\|Ga0268315_1016061	Not Available	597	Open in IMG/M
3300028472\|Ga0268315_1017221	Not Available	584	Open in IMG/M
3300028472\|Ga0268315_1017624	Not Available	580	Open in IMG/M
3300028472\|Ga0268315_1022462	Not Available	538	Open in IMG/M
3300028472\|Ga0268315_1022743	Not Available	536	Open in IMG/M
3300028472\|Ga0268315_1023150	Not Available	533	Open in IMG/M
3300028472\|Ga0268315_1026172	Not Available	513	Open in IMG/M
3300028473\|Ga0268319_1004625	Not Available	823	Open in IMG/M
3300028473\|Ga0268319_1012358	Not Available	620	Open in IMG/M
3300028473\|Ga0268319_1016346	Not Available	570	Open in IMG/M
3300028474\|Ga0268331_1019108	Not Available	570	Open in IMG/M
3300028475\|Ga0268327_1013683	Not Available	621	Open in IMG/M
3300028527\|Ga0268335_1019267	Not Available	500	Open in IMG/M
3300028529\|Ga0268311_1003381	Not Available	969	Open in IMG/M
3300028529\|Ga0268311_1008205	Not Available	747	Open in IMG/M
3300028529\|Ga0268311_1015673	Not Available	616	Open in IMG/M
3300028529\|Ga0268311_1020575	Not Available	566	Open in IMG/M
3300028529\|Ga0268311_1020955	Not Available	563	Open in IMG/M
3300028529\|Ga0268311_1022761	Not Available	548	Open in IMG/M
3300028529\|Ga0268311_1024116	Not Available	538	Open in IMG/M
3300028529\|Ga0268311_1024946	Not Available	532	Open in IMG/M
3300028529\|Ga0268311_1026248	Not Available	524	Open in IMG/M
3300032465\|Ga0214493_1166854	Not Available	505	Open in IMG/M
3300032467\|Ga0214488_1098238	Not Available	636	Open in IMG/M
3300032698\|Ga0214485_1083216	Not Available	607	Open in IMG/M
3300032913\|Ga0314739_1081676	Not Available	598	Open in IMG/M
3300033525\|Ga0314758_1168316	Not Available	598	Open in IMG/M
3300033534\|Ga0314757_1132608	Not Available	601	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.20%
Environmental	Environmental	3.09%
Engineered	Engineered	0.71%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.20%
Terrestrial	Environmental → Terrestrial	3.09%
Bioreactor	Engineered → Bioreactor	0.71%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.94%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.65%
Soil	Environmental → Terrestrial → Soil	3.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.66%
Unclassified	Host-Associated → Plants → Unclassified	0.71%
Unclassified	Engineered → Bioreactor → Unclassified	0.71%
Roots	Host-Associated → Plants → Roots	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.94%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.65%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.19%
Loam	Environmental → Terrestrial → Soil → Loam	0.95%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.71%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.48%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.65%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.19%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.95%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.71%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.48%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.24%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	53.44%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	33.49%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	6.41%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.71%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.48%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.24%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300010276	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 15_59_3.3_214_A2 metaG	Engineered	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028149	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028465	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032698	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033525	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070666_112454681	3300005335	Switchgrass Rhizosphere	PDESFLYGPSRHVEHVWTKIPQFHRRLVGWAAATEPPAHNKSMRM*
Ga0070671_1010394661	3300005355	Switchgrass Rhizosphere	PDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATVPPAHNKSMRT*
Ga0070688_1015115141	3300005365	Switchgrass Rhizosphere	PSRHVEHVWAKIPQFHWRLVGWAGATEPPTHNKSMRTEVPISMW*
Ga0070701_105235821	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0070706_1019421761	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	RHVEHVWAKIPQFHRRLVSWAGATEPPAHNKLMRTLVAISMW*
Ga0070686_1013958861	3300005544	Switchgrass Rhizosphere	SFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPTHNKWMRT*
Ga0068864_1007300473	3300005618	Switchgrass Rhizosphere	GPSRHVEHIWAKIPQFHRRLVGWAGATEPPAHNKLMRT*
Ga0068864_1011994381	3300005618	Switchgrass Rhizosphere	LCGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRK*
Ga0068864_1014985241	3300005618	Switchgrass Rhizosphere	SRHVEHVWAKIPQFHRRIVGWAGATEPPAHNKSMRM*
Ga0068864_1021207001	3300005618	Switchgrass Rhizosphere	SRHVEHVWAKIPQFHRRLVGWAGATETPAHNKLMRT*
Ga0068864_1022588171	3300005618	Switchgrass Rhizosphere	CGPSRHVEHVWAKIPQFHRRLVGWAGATEPIAHNKYMRT*
Ga0068861_1012260481	3300005719	Switchgrass Rhizosphere	DDSFLYSPSRHVEHVWAKIPQFHRRLVGWAGETEPPAHNKSM*
Ga0068863_1014836101	3300005841	Switchgrass Rhizosphere	LDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGTTEPPAHNKSMRT*
Ga0068863_1016444562	3300005841	Switchgrass Rhizosphere	DESFLYSPSRHVEHVWAKIPQFHRRLVGWEGATEPSAHNKSMRK*
Ga0068863_1020825851	3300005841	Switchgrass Rhizosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0068863_1021998041	3300005841	Switchgrass Rhizosphere	PSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRT*
Ga0068863_1022771641	3300005841	Switchgrass Rhizosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVGWASATEPPDHNKSMRT*
Ga0068863_1024652401	3300005841	Switchgrass Rhizosphere	HVEHVWAKIPQFHRRLVGWAGAKEPPAHNKSMRM*
Ga0068863_1026168591	3300005841	Switchgrass Rhizosphere	PDDSFLYGPSRHVEHVWAEIPQFHRRLVGWAGATEPPACNKSMRT*
Ga0068858_1015281582	3300005842	Switchgrass Rhizosphere	RHVEHVWAKIPQFHQRLVGWAGATEPPAHNKSMRT*
Ga0068858_1016930241	3300005842	Switchgrass Rhizosphere	SFLYVPSRHVEHVWAKIPQFYQRLVGWSSATEPPAHNKSMRI*
Ga0068858_1018382181	3300005842	Switchgrass Rhizosphere	LYGPSRHMEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0068858_1020366121	3300005842	Switchgrass Rhizosphere	YGPSRHVEHVWAKIPQFHRRLVGWAGATETPAHNKLMRT*
Ga0068858_1023183151	3300005842	Switchgrass Rhizosphere	FLYGPSRHVEHVWVKIPQFHRRLVSWAGATEPPAHNKSMRT*
Ga0068860_1024337953	3300005843	Switchgrass Rhizosphere	FLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPTHNKSMRT*
Ga0068860_1026962171	3300005843	Switchgrass Rhizosphere	SRHVEHDWAKIPQFHRRLVGWAGATEPPAHNKSMRTLVPISMW*
Ga0105250_103172871	3300009092	Switchgrass Rhizosphere	FLYGPSRHVERVWAKIPQFHRRLVRWAGATEPPAHNKSMRT*
Ga0105249_134966311	3300009553	Switchgrass Rhizosphere	YGPSRHVEYVWAKIPQFHRRQVGWVGATEPPAHNKSMT*
Ga0105135_1233791	3300009980	Switchgrass Associated	DESFLYGPSRHVEHVWAKIPQFHRRLVSWAGATEPPALNKSMGT*
Ga0105131_1159591	3300009989	Switchgrass Associated	SFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0105120_10413802	3300009992	Switchgrass Associated	ESFLCGPSGHVEHVLVKIPQFYRRLVGWAGATEPPAHNKSMRT*
Ga0134104_10859811	3300010276	Switchgrass Degrading	SRHVEQVWAKIPRFHRRLVGWAGATEPPAHYESMRT*
Ga0134125_127303891	3300010371	Terrestrial Soil	FLYGPPRHVEHVWAKIPQFHRWLVGWAGATEPPAHNKSMRT*
Ga0134126_118830891	3300010396	Terrestrial Soil	RHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0134124_126715691	3300010397	Terrestrial Soil	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKLMRT*
Ga0134127_123109491	3300010399	Terrestrial Soil	RHVELVCAKIPMFHRRLGGWAGATEPPAHNKSMRT*
Ga0134127_134373581	3300010399	Terrestrial Soil	APDESFLYCPFRHVEHVWAKIPQFHLRLVGYAGATEPHAHNKSMRMEVPISMW*
Ga0134127_134591311	3300010399	Terrestrial Soil	LYGPSRHVEHVWAKIPQFHQRLIGWAGATEPPAHNKSMRT*
Ga0134122_125187602	3300010400	Terrestrial Soil	MNLFLYRPSRHVEHVWAKFPQFHRRLVGWAGATEPPAHNKLMR
Ga0134121_127923681	3300010401	Terrestrial Soil	YGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0134123_131285931	3300010403	Terrestrial Soil	HIGMCADESFLYGPSRHGEHGWAKITQFHQRVVGWAGATEPPAYNKSMRT*
Ga0153798_102638761	3300012949	Switchgrass Degrading	GPSRHVEHVWAKFPLFHRRLVGWAGAKEPPAYNKSMRT*
Ga0153798_102872821	3300012949	Switchgrass Degrading	GHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0163163_127682091	3300014325	Switchgrass Rhizosphere	RHVEHVWAKILQFHRSLVVRAGATAPPAQHKSMRT*
Ga0157380_118991891	3300014326	Switchgrass Rhizosphere	PDESFLYGPSRHVEHVWAKIPQFHRRLVGWEGATEPPAHNKSMRM*
Ga0157380_131714191	3300014326	Switchgrass Rhizosphere	GCALDESFLYGISRHVEHVWSKNPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0157379_118498571	3300014968	Switchgrass Rhizosphere	FLYGPSRHVEHDWAKIPQFQRRLVGWAVATEPPAHNKLMRT*
Ga0182183_10777901	3300015270	Switchgrass Phyllosphere	FLYGPSRHVEHVWAKIPQFHRMLVGWAGATVPPANNKSMRM*
Ga0182183_10925801	3300015270	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRT*
Ga0182099_10350291	3300015278	Switchgrass Phyllosphere	HVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182099_10533482	3300015278	Switchgrass Phyllosphere	HVEHAWAEIPQYRRRLVDWAGATEPPAHNISMRT*
Ga0182099_10568101	3300015278	Switchgrass Phyllosphere	RHVEHVWEKIPQFHRRLVGWAGATKPPAHNKLVRT*
Ga0182099_10590111	3300015278	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182099_10659911	3300015278	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFQQSLVGWAGATEPPAHNKSMRT*
Ga0182100_10707731	3300015280	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHWRQVGWAGATERPAHNKSMRT*
Ga0182100_10919851	3300015280	Switchgrass Phyllosphere	GHSRHVEDVWAKIPQFHRRLVGWAGATKPPAHNKLMRM*
Ga0182105_10376161	3300015290	Switchgrass Phyllosphere	ESFLYGPSRYVEHVWAKIPQFHRRLVGWAGATEPPAHNKSLRT*
Ga0182105_10480961	3300015290	Switchgrass Phyllosphere	SVLYGPSRHVEHVWAKIPQFLRRLVGWAGATEAPAHNKSMRT*
Ga0182105_10876751	3300015290	Switchgrass Phyllosphere	SFQYGPSRHVEYVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182104_10672941	3300015297	Switchgrass Phyllosphere	LDESFLYGPSAHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRT*
Ga0182184_10332411	3300015301	Switchgrass Phyllosphere	LYGPSRHVEHGWAKITQFHQRLVGWAGVSEPPAHNKSMRT*
Ga0182184_10601491	3300015301	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM*
Ga0182184_10754341	3300015301	Switchgrass Phyllosphere	LDESFLYGPSRYVLHVWAKIPQFHRRLVGCAGATEPPAHNKSMRT*
Ga0182184_11007212	3300015301	Switchgrass Phyllosphere	SRHVEHVWAKNPQFHRRLVGWAGATEPPAHNKSMRI*
Ga0182180_10725001	3300015306	Switchgrass Phyllosphere	LFGPSRHVEHVWVKTPQFQWRLVGWAGAIEPPAHNKSMRTYVPISMW*
Ga0182180_10730401	3300015306	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHKSMRT*
Ga0182180_10779511	3300015306	Switchgrass Phyllosphere	SRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM*
Ga0182180_10794801	3300015306	Switchgrass Phyllosphere	SFLCGPSRHVEHVWAKIPQFHRRLVGWAGATEPIAHNKYMRT*
Ga0182180_10880401	3300015306	Switchgrass Phyllosphere	GCAPNESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPGHNKSMRT*
Ga0182180_10885751	3300015306	Switchgrass Phyllosphere	YVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182180_10895591	3300015306	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVCAKIPQFHRRLVGWACATEPPAHNKSMKTYVLISMW*
Ga0182180_10899721	3300015306	Switchgrass Phyllosphere	HVEHVWVKIPQFHRRLVGWAGATEPLAHNKSMRT*
Ga0182180_10964072	3300015306	Switchgrass Phyllosphere	DESLLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHSKSMRT*
Ga0182162_10791021	3300015310	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVSWAGATEPPAHNKSTRT*
Ga0182162_10816011	3300015310	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWGKIPQYHRRLVSWAAATEPRAHNKSMRT*
Ga0182162_10906471	3300015310	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSM*
Ga0182162_11186021	3300015310	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM*
Ga0182162_11232381	3300015310	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFRRRLVGWAGAKEPPAHNKSMRM*
Ga0182182_10823861	3300015311	Switchgrass Phyllosphere	FLFGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKLMRT*
Ga0182182_10836091	3300015311	Switchgrass Phyllosphere	GPSRHVEHDWAKIPQFHRRLVGWAVATELPAHNKSMRT*
Ga0182182_11131271	3300015311	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPAAHNKLMRT*
Ga0182182_11156471	3300015311	Switchgrass Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGATEPPTHNKSMRT*
Ga0182168_10796531	3300015312	Switchgrass Phyllosphere	SRHVEHVWAKIPQFHRRLVGWAGATEPTAHNKYMRT*
Ga0182168_11054871	3300015312	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWAKILQFHRRLVRWAGATEPPAQHKSMRT*
Ga0182168_11298581	3300015312	Switchgrass Phyllosphere	DESSLYGPSRHVEHVWVKIPQFHWRLVGWAGATEPPAHNKSMRT*
Ga0182168_11330221	3300015312	Switchgrass Phyllosphere	SFLYGPSRHVEHVWAKIPQFLRRLVGWAGATDPPAHNKSMRT*
Ga0182164_10913511	3300015313	Switchgrass Phyllosphere	SFLYGPSRHVEHVWAKIPQFHRRQVGWAGATEPPAHNKSMRM*
Ga0182120_10716502	3300015315	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFHQRQVGWAGATEPPAHNKSMRT*
Ga0182120_10763311	3300015315	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGATEPPDHNKLMRT*
Ga0182120_10907081	3300015315	Switchgrass Phyllosphere	FLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRM*
Ga0182121_11173421	3300015316	Switchgrass Phyllosphere	PYESFLYGPSRHVEHIWAKIPQVRRRLIGWEGATEPPAHNKSMRT*
Ga0182121_11276791	3300015316	Switchgrass Phyllosphere	LYSPSRHVEHVWAKIPQFHRRLVGWAGATDPIAHNKYMRT*
Ga0182121_11289851	3300015316	Switchgrass Phyllosphere	YGPSRHVEHGWAKIPQFHRRLVGWAGTTEPPAHNKSLRT*
Ga0182121_11335211	3300015316	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSLRT*
Ga0182136_10673841	3300015317	Switchgrass Phyllosphere	GPSRHVEHVWAKFPQFCRRLVSWAGATEPPTHNKSMRM*
Ga0182136_10768151	3300015317	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPANNKSMRT*
Ga0182136_11085341	3300015317	Switchgrass Phyllosphere	GPSRHVGHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182136_11131201	3300015317	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPRFHRRLVGWAGAIEPPAHNESMRT*
Ga0182136_11169891	3300015317	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFHRRLVRWAGATVPRAHNKSMRM*
Ga0182181_10241411	3300015318	Switchgrass Phyllosphere	VPDDSFLYGPSRHVEHVWAKIPQFHRSLVGWAGATEPPPHNKSMRT
Ga0182181_10446861	3300015318	Switchgrass Phyllosphere	SRLVKHVLPKIPQFHRMLVSCAGATEPPAHNKSMIT*
Ga0182181_11027361	3300015318	Switchgrass Phyllosphere	PSRHVEHVWGKIPQFHRRLIGWAAAIEPPAHNKMMRM*
Ga0182165_10976201	3300015320	Switchgrass Phyllosphere	HVEHVWAKIPQFLRRLVGWAGATEPPAQLKSMRT*
Ga0182165_11130961	3300015320	Switchgrass Phyllosphere	PSRYVEHVWAKIPQFHWRLVGWAGATEPPAHNKSLRTYVPISMW*
Ga0182165_11215741	3300015320	Switchgrass Phyllosphere	RHVEHVGAKIPQFHQRLVGWAVATEPPAQNKSIRT*
Ga0182165_11296631	3300015320	Switchgrass Phyllosphere	ALDESFLCGPSRHVEHVWAKIPQFHRRLVGWAGDTEPPAHNKSMRT*
Ga0182165_11421321	3300015320	Switchgrass Phyllosphere	HVEHVWAKIPQFHRRLVGWACATEPPAHNKSMRT*
Ga0182165_11422201	3300015320	Switchgrass Phyllosphere	FLYGPSRHVEHVWAKIPQFHQRLVGWAAATEPPAHNKSMRM*
Ga0182165_11469041	3300015320	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFYRRLVGWAGATETPAHNKLMRT*
Ga0182134_11125061	3300015324	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVGWACATEPPAHNKSMRM*
Ga0182134_11178911	3300015324	Switchgrass Phyllosphere	APDESFLYGPSRHMEHVWAKIPQFHRRLVGWAGATEPTDHNKSMRTYVPISMW*
Ga0182134_11183301	3300015324	Switchgrass Phyllosphere	SRHVEHDWAKIPLFHRSLVGWAGATEPPAHNKSMRT*
Ga0182148_10336391	3300015325	Switchgrass Phyllosphere	LYGPSRHVEHVWAKIPPFHRRLVGWAGATEPPAHNKSMRM*
Ga0182148_10525851	3300015325	Switchgrass Phyllosphere	ESFLCGPSRHVEHVWAKIPQFHLRLVGWAGAIEPPAPNKFMGK*
Ga0182148_10602411	3300015325	Switchgrass Phyllosphere	YGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM*
Ga0182148_10696511	3300015325	Switchgrass Phyllosphere	LCGPSRHVEHVWAKIPQFHLRLVGWAGAIEPPAPNKFMRT*
Ga0182148_10784691	3300015325	Switchgrass Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGATEPPAQNKTMRT*
Ga0182148_10847021	3300015325	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWVGATEPPAHNKSMRT*
Ga0182148_11109491	3300015325	Switchgrass Phyllosphere	APDESFLYGPSRYVEHVWAKIPQFHRRLVGWAGATGPPAHKKSVRT*
Ga0182148_11196251	3300015325	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRT*
Ga0182148_11358282	3300015325	Switchgrass Phyllosphere	SRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRP*
Ga0182166_10795821	3300015326	Switchgrass Phyllosphere	LYGPSRHVEQVWAKIPQFHRRLVGWVGATERPAHNKSLRT*
Ga0182166_11120421	3300015326	Switchgrass Phyllosphere	AIEGCEPDESFLYGPSRHVEHGWAKITHFHQRIVGWVGATEPPAHNKSMRT*
Ga0182166_11146072	3300015326	Switchgrass Phyllosphere	VPDESLLYGPSRHVEHVWAKIPLFHRRLVGWAGATEPPAHN
Ga0182166_11301801	3300015326	Switchgrass Phyllosphere	HVEHVWAKIPQFHRRLDGWEGATEPPAHNKSMRT*
Ga0182114_10623921	3300015327	Switchgrass Phyllosphere	SFLFGPSRHVEYVWAKIPQFHRRLVGWVGATEPPAHNKSMRT*
Ga0182114_11149651	3300015327	Switchgrass Phyllosphere	LYGPSRHVEHVWGKIPQYHRRLVSWAAAIEPPAHNKSMRT*
Ga0182114_11250521	3300015327	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHQRLVGWAGAKEPPAHNKSMRM*
Ga0182153_10452351	3300015328	Switchgrass Phyllosphere	QYGPSRHVEHVWAKIPQCHRRLVGFAGATEPPAHNKSMGK*
Ga0182153_10615141	3300015328	Switchgrass Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSIRM*
Ga0182153_10711501	3300015328	Switchgrass Phyllosphere	RHVEHVWAKIPQFHLRLVGWGGATEPHAHNKSMRI*
Ga0182153_10745431	3300015328	Switchgrass Phyllosphere	VPDKSSLYGPSRYVDHVWAKFPQFHRRLVGCAGATEPPAHNKSMR
Ga0182153_11129761	3300015328	Switchgrass Phyllosphere	VPDESFLFVPSRHVEHVWVKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182153_11208751	3300015328	Switchgrass Phyllosphere	DEPFLYGPSRHVEHVWAKIPQFHRRLVGWAGATERPAHNKSMRT*
Ga0182153_11389791	3300015328	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHQRLVGWVGATKPPAHNKSMRT*
Ga0182153_11406551	3300015328	Switchgrass Phyllosphere	APNESFLYGPSRHVEHVWAKFPQFRLKLVGWAGATEPPAYSKSMRM*
Ga0182152_10444881	3300015330	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVSWAGATEPPAHNKSMRT*
Ga0182152_10788651	3300015330	Switchgrass Phyllosphere	HVEHVWAKIPQFHRRLVGWAGPTEPPAHSKSMRT*
Ga0182152_11263161	3300015330	Switchgrass Phyllosphere	RHVEHVSAKIPQFHRRLVGWAGATEPPAHNKSMRM*
Ga0182152_11370631	3300015330	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWVKIPQFHRRLVGWAGATEPPAHNESMRT*
Ga0182152_11377911	3300015330	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHWRLVGWAAATEPPAHNKSMRM*
Ga0182131_10643031	3300015331	Switchgrass Phyllosphere	PSRHVEHDWAKIPQFHWRLVAWAGATEPPAHNKSMRT*
Ga0182131_11433581	3300015331	Switchgrass Phyllosphere	PSRHVEYVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182117_11236141	3300015332	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKFPQFHRRLVGWAGATEPPAYSKSMRM*
Ga0182147_10794661	3300015333	Switchgrass Phyllosphere	GPSRHVEQVWAKIPQFYRRLIGWASATEPPAHNKSMRIYVHISML*
Ga0182147_10993301	3300015333	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKILQFHRRLVGWAGATEPPAQHKSMRT*
Ga0182147_11226671	3300015333	Switchgrass Phyllosphere	NESFLYGPSRHMEHVWAKIPQFHQRLVGWAGVTEPPAHNK*
Ga0182147_11349381	3300015333	Switchgrass Phyllosphere	PDESFLYGPSRHVEHDLAKIPQFHQRLVGWASVTEPPAHNKSMRT*
Ga0182147_11485231	3300015333	Switchgrass Phyllosphere	SFLYRPSRQVEHVLAKIPQFHWRLVGWAGATEPPAHNKSMRT*
Ga0182147_11626411	3300015333	Switchgrass Phyllosphere	HVEHVWAKIPQFHRRLVGWAGPTEPPAHNKSMRT*
Ga0182132_11176561	3300015334	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHQSLVGWAGATEPPAHNKSMRT*
Ga0182132_11322181	3300015334	Switchgrass Phyllosphere	GPSRYVEHVWAKIPQFHWRLVGWAGATEPPAHNKSLRTYVPISMW*
Ga0182132_11441111	3300015334	Switchgrass Phyllosphere	YGPSKHVEHVWAKIPQFHRRLVGWAGATEPSAHNK*
Ga0182150_11111511	3300015336	Switchgrass Phyllosphere	FLYGPSRHVEHIWAKIPQFHRRLVGWAGATEPPAHNKLMRT*
Ga0182150_11671191	3300015336	Switchgrass Phyllosphere	RHVEHVWAKIPQFHRRIVGWAGATEPPAHNKSMRT*
Ga0182151_11112242	3300015337	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHWRLVGWAGATEPPAHNKLMRM*
Ga0182151_11391672	3300015337	Switchgrass Phyllosphere	HVEYVWAKIPQFHRRLVGWARATEPPAHNKSIRT*
Ga0182137_10680371	3300015338	Switchgrass Phyllosphere	DESFLYGPSRHVEHVCAKIPQFHRRVVGWAGAIEPPAHHKSMRT*
Ga0182137_11431391	3300015338	Switchgrass Phyllosphere	ESFQYGPSRHVEHVWAKIPQFHRRLVGWAGATEPHAHNKSMRTYVPISMW*
Ga0182137_11753281	3300015338	Switchgrass Phyllosphere	LYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAQLKSMRM*
Ga0182149_10701961	3300015339	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIGPPAHNKSMRT*
Ga0182149_11014111	3300015339	Switchgrass Phyllosphere	FLYGPSRYVEHVWAKIPQFHRRLVGWAGATEPPAHNKSLRT*
Ga0182149_11317841	3300015339	Switchgrass Phyllosphere	RHVEHVWAKIPQFHQRLVGWAGAKEPPAHNKSMRM*
Ga0182149_11462281	3300015339	Switchgrass Phyllosphere	DESFLYGHSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHHKSMRT*
Ga0182133_10544251	3300015340	Switchgrass Phyllosphere	PSRHVEHVWVEIPQFHRRLVGWAGATEPPAHIKSMRTLVPISMR*
Ga0182133_11663781	3300015340	Switchgrass Phyllosphere	FLCGPSRHVEHVWATIPQFHWRLVGWAGATEQTAYNKYMRTIINI*
Ga0182115_12360671	3300015348	Switchgrass Phyllosphere	GPSRHVEHVWPKIPQFHRRLVGWAGATEPPAHNKSMGT*
Ga0182115_12524281	3300015348	Switchgrass Phyllosphere	VPDDSLLYSPSRHVEHVWAKIIQFHRSLVGWAGATEPPA
Ga0182115_12531191	3300015348	Switchgrass Phyllosphere	DESFLYGPSRHVENVWAKIPQFHRRLVGGAGATEPPAHGKSMRM*
Ga0182115_12772631	3300015348	Switchgrass Phyllosphere	VLDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPP
Ga0182115_12912261	3300015348	Switchgrass Phyllosphere	YGPSRHVEHVWEKFPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182185_12174501	3300015349	Switchgrass Phyllosphere	VLDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKL
Ga0182185_12443071	3300015349	Switchgrass Phyllosphere	QDESFLYGPSRHVEYVWANFPQFHQRLVGWAGATEPPAYNKSMRT*
Ga0182185_12481871	3300015349	Switchgrass Phyllosphere	ESLLYCRSRDVEHVWATIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182185_12566781	3300015349	Switchgrass Phyllosphere	FLYGPSRHVEYVWAKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182185_12637641	3300015349	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWADATEPPAHNKSMRT*
Ga0182185_12706491	3300015349	Switchgrass Phyllosphere	HVEHVWGKIPQYHRRLVSWAAATEPPAHNKSMRT*
Ga0182185_12727272	3300015349	Switchgrass Phyllosphere	SRHVEHVWPKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182163_11233241	3300015350	Switchgrass Phyllosphere	GPSRNVEHVWAKIPQFHRRLVGWAGAKEPPAHNKSMRM*
Ga0182163_11336881	3300015350	Switchgrass Phyllosphere	MNLFLYGPSRHVEHVWAKIPQFHQRLVGWAGATEPPAHN
Ga0182163_11746171	3300015350	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKLPQFHWRLVGWAGATEPPAHNKSMRMHVPISMW*
Ga0182163_12123991	3300015350	Switchgrass Phyllosphere	YGPSRHMEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRTLVPNSMW*
Ga0182163_12358501	3300015350	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWAKIPPFHRRLVGWAGATESPAHNKSMRT*
Ga0182163_12695182	3300015350	Switchgrass Phyllosphere	LYGPSRHVEHVLAKIPQFHWRLVGWAGATEPPAHNKSMIT*
Ga0182163_12715941	3300015350	Switchgrass Phyllosphere	DESFLYGPSRHVENVWAKIPQCHQRLVDGAGATEPPAHDKSMRT*
Ga0182163_12848841	3300015350	Switchgrass Phyllosphere	RHVELVWAKIHLFHRRLVGWAGATEPPAHNKSMRT*
Ga0182163_12972641	3300015350	Switchgrass Phyllosphere	LYSPSKHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM*
Ga0182169_12020361	3300015352	Switchgrass Phyllosphere	SFLYGPSRHVEHVWAKIPQFHRRLVSWAGATEPPAHNKSMRT*
Ga0182169_12190331	3300015352	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWVGATERPAHNKSMRT*
Ga0182169_12547081	3300015352	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGATESPAHNKSMRM*
Ga0182169_12700721	3300015352	Switchgrass Phyllosphere	VSDESFLCGPSRHVEHVWAKIPQFHQRLVGWAGATEPPAHNQSMRT*
Ga0182169_12923942	3300015352	Switchgrass Phyllosphere	GPSRHVEHVWVEIPQFHRRLVGWAGATEPSAHNKSMRK*
Ga0182169_12989911	3300015352	Switchgrass Phyllosphere	SRHVEHVWAKIPQFRRRLVGWAGAKEPPAHNKSMRM*
Ga0182169_13042331	3300015352	Switchgrass Phyllosphere	HVEHVWAKIPQFHRKLVGWAGAIEPPAPNKFMRT*
Ga0182169_13056051	3300015352	Switchgrass Phyllosphere	PLEHVWAKNPQFHRRLVGWAGATEPPAHNKSMRI*
Ga0182169_13130381	3300015352	Switchgrass Phyllosphere	SFLCGPSRHVQHVWAKIPQFHRRIVGWAGATEPPAHNKSMIIYVPISMW*
Ga0182179_10901931	3300015353	Switchgrass Phyllosphere	YGPSRHVEHVWEKIPQFHQRLVGWAGATEPPAHNKSMRT*
Ga0182179_11307571	3300015353	Switchgrass Phyllosphere	LYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPDHNKLMRT*
Ga0182179_11565591	3300015353	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWAGTTERPAHNKSMRT*
Ga0182179_11566101	3300015353	Switchgrass Phyllosphere	RHVEHIWEKFPQFHRRLVGWAGATEPPAYNKSMRT*
Ga0182179_12006131	3300015353	Switchgrass Phyllosphere	PDESFLFGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNRSMRT*
Ga0182179_12044772	3300015353	Switchgrass Phyllosphere	LYGPSRHVEHVWAKILQFHRRLVGWAGATEPPAQHKSMRT*
Ga0182179_12410511	3300015353	Switchgrass Phyllosphere	ESFLYCPSRHVEHVWAKIPQFHRRLVGWAGATEPPGHNKLMRT*
Ga0182179_12414981	3300015353	Switchgrass Phyllosphere	DDSFLYGPSRHVEHVWVEIPQFHRRLVGWAGATVPPAHNKSMRT*
Ga0182179_13076571	3300015353	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATDPPAHNKSMRT*
Ga0182179_13200301	3300015353	Switchgrass Phyllosphere	PDESFLYAPSRHVEHVWAKIPQFHQRQVGWAGATKPPSHNKSMRT*
Ga0182167_12879841	3300015354	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWPKIPQFHRRLVGWAGATEPPAHNKSMRT*
Ga0182197_10857261	3300017408	Switchgrass Phyllosphere	CDPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182197_11258111	3300017408	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKLMRT
Ga0182199_10783271	3300017412	Switchgrass Phyllosphere	VLDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNK
Ga0182199_10935701	3300017412	Switchgrass Phyllosphere	APDESFLYGPSRYVEHVWAKIPQFHRRLVGWAGATEPPAHNKSLRT
Ga0182199_11975821	3300017412	Switchgrass Phyllosphere	ESFLYDPSRHVEHVWAKIPQFHQRLVGWAGATEPPAHNKSMRM
Ga0182195_10800571	3300017414	Switchgrass Phyllosphere	MNLFLYGPSRHMEYVWAKFPQFHRRLVGWAGATEPPAHNKLMR
Ga0182195_11337342	3300017414	Switchgrass Phyllosphere	SRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182195_11621671	3300017414	Switchgrass Phyllosphere	CPSRHVEHVWAKIPQFHRRLVGWAGATEPPVHNKLMRT
Ga0182195_11730781	3300017414	Switchgrass Phyllosphere	MENVWEKFPQFHRRLVGWAGATEPPAHNKSMRTLVPNSMW
Ga0182195_12000361	3300017414	Switchgrass Phyllosphere	FLCGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAYNKSMRM
Ga0182195_12058202	3300017414	Switchgrass Phyllosphere	PDESFLYGPSRHVEHDWAKIPQFHRRLVGWAVATEPPAHNKSMRT
Ga0182195_12163611	3300017414	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPTHNKSMRT
Ga0182213_11665801	3300017421	Switchgrass Phyllosphere	PSRHIEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182201_10635481	3300017422	Switchgrass Phyllosphere	RHVEHVWAKIPQFYRRLVGWASATEPPAHNKSMRI
Ga0182201_11055792	3300017422	Switchgrass Phyllosphere	GPSRHVENVWAKIPQFHRRLVGGAGATEPRAHGKSMRM
Ga0182201_11381991	3300017422	Switchgrass Phyllosphere	RHVEHVWTKIPQFHRRLVGWAGATEPPAHNKSMRM
Ga0182196_11231941	3300017432	Switchgrass Phyllosphere	RHVEHVCAKIPQFHRRLVGWAGAIEPPSHNKSMRT
Ga0182194_10806781	3300017435	Switchgrass Phyllosphere	FLYGPSRHVEYVWAKIPQFHQRLVGWAGATQPPAHNKSMRT
Ga0182194_11073531	3300017435	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPQFHWRLVGWAGAKVPPAHNKSMRT
Ga0182200_10544611	3300017439	Switchgrass Phyllosphere	PSRHVEHVWAEIHQFHRRLVGWAGATEPPTHIKSMRT
Ga0182200_10585341	3300017439	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATETPAHNKLMRT
Ga0182200_10904411	3300017439	Switchgrass Phyllosphere	VPDESFLCGPSRHVDYVWAKIPQFHWRLVGWAGAKEPPAHN
Ga0182200_11195351	3300017439	Switchgrass Phyllosphere	YGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRT
Ga0182200_11319171	3300017439	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWAKIPQFHQRLVGWAGATEPPAQHKSMRT
Ga0182200_11663622	3300017439	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHQRLVGWADATEPPAHNKLM
Ga0182214_10494051	3300017440	Switchgrass Phyllosphere	DESFLYGPSTHVEHVWVKIPQFHRRLVGWAGAIEPPAHNKSMRTLVPISMW
Ga0182214_10839761	3300017440	Switchgrass Phyllosphere	FLYGPSRHVEHVWTKIPQFHRRLVGWAGAIEPPAHNKSMRM
Ga0182214_10869011	3300017440	Switchgrass Phyllosphere	APYESFLYGPSRYVEHVWAKIPQFHRRLVGWAGATEPPAHNKSLRTSVPISMW
Ga0182214_11257331	3300017440	Switchgrass Phyllosphere	FLYGPSRHVEHVWAKIPQFHRRLVGWAGATVPPANNKSMRT
Ga0182198_10945082	3300017445	Switchgrass Phyllosphere	VEYVWAKIPQFHRRLVGWAGATKPPAHNKSIRTLVPISMW
Ga0182198_11178942	3300017445	Switchgrass Phyllosphere	APDESFIYGPSRHVEHVWAKIPQFHRRLVGWAGATETPAHNKLMRT
Ga0182198_11500961	3300017445	Switchgrass Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSIRM
Ga0182198_11738721	3300017445	Switchgrass Phyllosphere	ESFLYGPSRHVEHVWAKFPQFHRRLVGWAGATEPPAHNKLMRT
Ga0182198_11922801	3300017445	Switchgrass Phyllosphere	FLYGPSRHVEHDWAKIPQFQSRLVGWAGATEPPAQHKLKRT
Ga0182198_11960231	3300017445	Switchgrass Phyllosphere	SRHVEHVWAKIPQFHWRLVGWAGAIEPPAHNKLLRT
Ga0182215_11175741	3300017447	Switchgrass Phyllosphere	PDESFLYGPSRHVEHVWGKIPQYHRRLVSWAAATEPPAHNKSMRT
Ga0182215_11254821	3300017447	Switchgrass Phyllosphere	YGPSRHVEYVWAKIPQFHRRLIGWAGAIEPPTHNKSMRT
Ga0182215_11281461	3300017447	Switchgrass Phyllosphere	SRHVEHVWAKFPQFHQRLVGWAGATEPPAYNKSMRT
Ga0182210_11402881	3300017692	Switchgrass Phyllosphere	SRHVEHVWVKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182216_10435151	3300017693	Switchgrass Phyllosphere	MYGPSRHVEYVWAKIPQFHRRLVGWAGATEPPAHNKSIR
Ga0182216_10532311	3300017693	Switchgrass Phyllosphere	GPSRHMKHVWAKIPQFHRRLVGWAGATVPPSNDKSMRT
Ga0182216_10769201	3300017693	Switchgrass Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGATEAPAHYKLMRT
Ga0182216_10865301	3300017693	Switchgrass Phyllosphere	FVYGPSRHVEHVWAKIPQFQRRLVGCAGATEPPAHNKSMRT
Ga0182216_10904361	3300017693	Switchgrass Phyllosphere	ISLQAFAPDESFLCDPSRHVEHVWAKIPQFHWRLVGWAGATEPTAHNKSMRT
Ga0182216_11256402	3300017693	Switchgrass Phyllosphere	SFLYGPSRHVEHVWAEIPLFHRRLVSWAGATEPPAHNKSMRT
Ga0182216_11370341	3300017693	Switchgrass Phyllosphere	FLFGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKLMRT
Ga0182216_11630481	3300017693	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWVKIPQFHRRLVGWAGATEPPAHNKSMIT
Ga0182216_11813881	3300017693	Switchgrass Phyllosphere	ALSIALQGSAPDESFLYGRSRHVEHVWRKIPLFHRRLVGWAGAKEPPAQNKSMRT
Ga0182216_11823351	3300017693	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAEIPQFHWRLVGWAGVTEPPAHNKSMRT
Ga0182216_11836121	3300017693	Switchgrass Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPAAHNKLMRT
Ga0182216_12193941	3300017693	Switchgrass Phyllosphere	LYGPSRHMEHVWAKFPQFHRRLVGWAGATEPPAHSKLMRI
Ga0182216_12223611	3300017693	Switchgrass Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATETPAHNKLMRT
Ga0182211_11141781	3300017694	Switchgrass Phyllosphere	HVEHVWAKIPQFHWRLVGWAGATEPPAHNKSMRTLVPLSMW
Ga0163161_114927511	3300017792	Switchgrass Rhizosphere	DDFFLYCPSRHVEHVWVEIPQFHRRLVGWAGATEPPAHIKSMRT
Ga0182178_10042901	3300020023	Switchgrass Phyllosphere	PDESFLYGLSRHVEHVWENFPQFHRRLVGWAGAIEPPAYNKSMRT
Ga0182178_10054931	3300020023	Switchgrass Phyllosphere	ESFLYGPYRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182178_10080762	3300020023	Switchgrass Phyllosphere	PDDSFLYVPSRHVEHVWAEIHQFHRRLVGWAGAIEPPTHIKSMRT
Ga0182178_10093471	3300020023	Switchgrass Phyllosphere	APVESFLYSPFGHVEHVWPKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0182178_10155731	3300020023	Switchgrass Phyllosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPDHNKSMRT
Ga0182178_10160481	3300020023	Switchgrass Phyllosphere	SRHVEHVWEKIPQFYQRLVGWVDATEPPAHNKSMRM
Ga0207703_117185751	3300026035	Switchgrass Rhizosphere	ESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKLMRT
Ga0207703_119906421	3300026035	Switchgrass Rhizosphere	APDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAQLKSMRM
Ga0207641_121087181	3300026088	Switchgrass Rhizosphere	DESFLYGPSRHVEHVWTKIPQFHRRLVGWAGATEPPAHNKSTRT
Ga0207676_121269671	3300026095	Switchgrass Rhizosphere	PDDSFLYGPSRHVEHVWAEIHQFHRRLVGWAGATEPPTHIKSMRT
Ga0268322_10520611	3300028049	Phyllosphere	ESLIYGPSRLVEHVRAKIPQFHQRLVGWAGATEPPAHNKSI
Ga0268322_10554171	3300028049	Phyllosphere	RHVEHVWAKFPQFHQRLFGWAGATEPPAHNKSMTK
Ga0268322_10558971	3300028049	Phyllosphere	VLDESFLYGPSRHVEHGWAKIPQFHRRLVGWAGTTEPP
Ga0268328_10344561	3300028050	Phyllosphere	RHVEHVWAKIPQFHRSLVGWAGATEPPAHNKSMRTLVPISMW
Ga0268328_10352661	3300028050	Phyllosphere	FMYGPSRHVEHVWAKIPQFHRRLVGWAGTTEPPAHNKLMRT
Ga0268328_10461591	3300028050	Phyllosphere	DEPFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRTLVTISMW
Ga0268328_10512901	3300028050	Phyllosphere	SPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268328_10515401	3300028050	Phyllosphere	ESFLYGPPRHVEHVWAKIPRFHRRLVGWAGAIEPPAHNESMRT
Ga0268344_10074691	3300028051	Phyllosphere	YGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKLMRT
Ga0268300_10101331	3300028052	Phyllosphere	MNIFLYGPSRHVEHVWAKFPQFHRRLVGWAGATEPP
Ga0268306_10162071	3300028054	Phyllosphere	RHVEHVWAKIPQFHQSLVGWAGATEPPAHNKSMRT
Ga0268306_10194201	3300028054	Phyllosphere	YGPSRYVEHVWAKIPQFHRRLVGWAGATEPPAHNKSLRT
Ga0268338_10092181	3300028055	Phyllosphere	SRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM
Ga0268330_10139501	3300028056	Phyllosphere	LDESLLYGPSRHVEHVWAKIPQFCRRLVGWAGAIEPPAHNKLMRT
Ga0268330_10152741	3300028056	Phyllosphere	GPSSLVEHVWAKISQFHWRLVGWAGATGQPAHNKLMRT
Ga0268330_10161571	3300028056	Phyllosphere	YGPSRHVEYFLAKIPYFNRRLVGGAGATEPRAHGKSMRM
Ga0268330_10229591	3300028056	Phyllosphere	ESFLFGPSRHAEYVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268330_10239631	3300028056	Phyllosphere	VPDESLLYGPSRHVEHVWAKIPLFHRRLVGWAGATEPPAH
Ga0268330_10254081	3300028056	Phyllosphere	DESFLCGPSLHVEHVWAKIPQFHWRLVGWAGATEPPAHNKSMRTYVPISMW
Ga0268330_10260431	3300028056	Phyllosphere	PDESFLYGPSRHVEHVWEKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268330_10276571	3300028056	Phyllosphere	VLDESFLYGPSRHVEHGWAKIPQFHRRLVGWAGTTEPPTHNK
Ga0268330_10314261	3300028056	Phyllosphere	RHVEHVWVKTPQFQWRLVGWAGAIEPPAHNKSMRTYVPISMW
Ga0268330_10364731	3300028056	Phyllosphere	LLYGPSTHVEHVWAKFPQFHRRLVGWAGATEPPAHNKSMRTLVPISMW
Ga0268330_10539031	3300028056	Phyllosphere	VTDESFLYGPSRHVEHVWAKFPLFHRRLVGWAGATEPPAHNKS
Ga0268352_10336111	3300028057	Phyllosphere	RHVEHVWAKIPQFHRRLIGWEGATEPPAHNKSMRT
Ga0268332_10047191	3300028058	Phyllosphere	PDESFVYGPSRHVEHVWAKISQFHRRLVGWAGATEPPAHNKSMRT
Ga0268332_10239092	3300028058	Phyllosphere	SRHVEHVWAEIPQFHWRLVGWAGVTEPPAHNKLIRM
Ga0268332_10547611	3300028058	Phyllosphere	ESFLFGPSRHVEYVWAKIPQFHRRLVGWAGVTEPPAHNKSMRT
Ga0268332_10602111	3300028058	Phyllosphere	DESCLYGPSRHVEHVWAKIPQFYRRLVGWADATEPPAHNKSMRM
Ga0268332_10646992	3300028058	Phyllosphere	FLCGPSGHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRK
Ga0268332_10671822	3300028058	Phyllosphere	ESFLYSPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM
Ga0268332_10701891	3300028058	Phyllosphere	VPDESSLYGPSRHVEHVWVKIPQFHWRLVGWAGATEPP
Ga0268332_10726311	3300028058	Phyllosphere	FLYGPSRHVEHVWAKIPQFHQRLVGWAGVTEPPAHNK
Ga0268332_10780741	3300028058	Phyllosphere	ESLLYGPSRHMEHDWAKIPQFHRRLVGWAGATEPSAHNKSMRT
Ga0268314_10320091	3300028061	Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGAKEPPAHNKSMRM
Ga0268314_10339171	3300028061	Phyllosphere	CAPDESFLYGPSRHVEHVWAKIPQFHWRLVGWAGAIEPPAHNKSLRT
Ga0268342_10077861	3300028062	Phyllosphere	SFLYGPSRHVEHVWAKIPQFHRRLVGWAGATGPPTHNKWMRT
Ga0268342_10081441	3300028062	Phyllosphere	GPSRHVEHVWAKIAQFHFRLVRWAGATEPPAHNKSMRT
Ga0268342_10220201	3300028062	Phyllosphere	FLCGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRT
Ga0268342_10252701	3300028062	Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKLMRT
Ga0268342_10275351	3300028062	Phyllosphere	GPSRHVEHDWAKIPQFHRRLVGWAGATEPPAHNKSIRM
Ga0268342_10319061	3300028062	Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFHWRLVGWAGATVPPAHNKSMRM
Ga0268342_10322141	3300028062	Phyllosphere	GPFRHVEHVWAKIPQFQRRLFGWVGATEPPAHNKSMRT
Ga0268342_10375401	3300028062	Phyllosphere	LYGPSRHVEHVWAEIHQFHRRLVGWAGATEPPTHIKSMRTYVPISMR
Ga0268340_10810401	3300028064	Phyllosphere	SRHVEYVWAKIPQFHRRLVGWAGATEPPAHNESMST
Ga0268355_10074061	3300028139	Phyllosphere	SYGPSRHVEHDWAKIPQFHRRLVGWAGATEPPDHNKLMRT
Ga0268334_10116411	3300028140	Phyllosphere	GPSRHVEHVWAKIPQFHRRLVGWAGATEPPTHNKSMRT
Ga0268334_10146771	3300028140	Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRP
Ga0268334_10168901	3300028140	Phyllosphere	YGPSRHVEHVWAKIPQFHRRLVGWAAATEPPAHNKSMRM
Ga0268347_10104191	3300028142	Phyllosphere	ESFLYGPSRHVEHVWAKTPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268347_10150141	3300028142	Phyllosphere	LYGPSRHVEHVWGKIPQYHRRLVSWAVATEPPAHNKSMRT
Ga0268347_10157041	3300028142	Phyllosphere	RHVEHVWAKIPLFHWRLVGWAGATEPPAHNKSMRT
Ga0268347_10175261	3300028142	Phyllosphere	VRDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGITEPP
Ga0268347_10179051	3300028142	Phyllosphere	PSRHVEHVWAKIPQFRRRLVGWAGAKEPPAHNKSMRM
Ga0268347_10211801	3300028142	Phyllosphere	LYGPPRHVEHVWAKIPQFHRRLVGWAGTTEPPAHNKSMRT
Ga0268347_10272881	3300028142	Phyllosphere	GPSRHVEHICAKIPLFHRRLVGWTGATEPPAHNKSMRT
Ga0268347_10290361	3300028142	Phyllosphere	SFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268347_10290391	3300028142	Phyllosphere	ESFLYGPSRHVEHVWVKIPQFHRRLVGWAGATEPPSHNKSMRT
Ga0268347_10353271	3300028142	Phyllosphere	PSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKSMRMLVPISMW
Ga0268347_10353272	3300028142	Phyllosphere	MEHVWAKISQFHRRLVGWAGATEPPAHNKSMRTYVAISMWLG
Ga0268348_10131721	3300028143	Phyllosphere	GPSRHVEHIWAKIPQFHRRLVGWAGATEPPAHNKLMRT
Ga0268345_10262891	3300028144	Phyllosphere	FLYGPSRHVEHVWAKNPQFHRRLVGWAGATEPPAHNKSMRM
Ga0268353_1199861	3300028149	Phyllosphere	YGPSRHVEHVWAKFPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268308_10094511	3300028151	Phyllosphere	DESFLYSPSRHVEHGWAKIPLFHRRLVGWVGATEPPAHNKSMRT
Ga0268308_10104241	3300028151	Phyllosphere	ALPGCAPDESFLYGPSRHVEHVWAKIPQFHLRLVGWAGATEPPGHNKSMRT
Ga0268308_10109481	3300028151	Phyllosphere	SFLYGPSRHVEHDWAKIPQFHWRLVGWAGAPEPPTHNKSMRT
Ga0268308_10130161	3300028151	Phyllosphere	RHVEHVLAKIPQFHWRLVGWAGATEPPAHNKSMRT
Ga0268308_10135651	3300028151	Phyllosphere	ESFQYGPSRHVEYVWAKIPQFHRRLVGWAGATEPPAHIKSMRT
Ga0268308_10250521	3300028151	Phyllosphere	PSRHVEHVWAKIPQFHQRLVGWAGATEPPAHNKSMRM
Ga0268308_10294861	3300028151	Phyllosphere	HVEHVWEKFPQFHWRLVGWAGATEPPAHNKSMRTLVPNSMW
Ga0268308_10336081	3300028151	Phyllosphere	APDESIIYGPSRHVEHVWAKIPQFHQRLVGWAVATEPPAHNKSMRT
Ga0268336_10203951	3300028152	Phyllosphere	VLDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGTTEPPAHNKSMR
Ga0268341_10041471	3300028154	Phyllosphere	YGPSRHVEHVWVKFRQFHRRLVGWAGATEPPARNESMRM
Ga0268341_10062931	3300028154	Phyllosphere	PDESFLYGPSRHVEHVWAKIRQFHRRLVGWAGATEPPAHNKSMRT
Ga0268341_10100431	3300028154	Phyllosphere	YGPSRLVEYVWAKIPQFHLRLVGWAGATGPPAHNKSMRR
Ga0268341_10144661	3300028154	Phyllosphere	ESFLYSPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268341_10199801	3300028154	Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGATEPPAHIKSMRK
Ga0268341_10301991	3300028154	Phyllosphere	YIPSRHVEHVWAKIPQFHRRIVGWAGATEPPAHNKSMRM
Ga0268341_10309471	3300028154	Phyllosphere	LYGPSRLVEHAWAKIPQFHWRLVGWAGATEPPAHNKSMRT
Ga0268312_10171502	3300028248	Phyllosphere	HVEHVWAEIPQFHRRLVGWAGATEPPAHIKSMRTLVPISMR
Ga0268312_10261611	3300028248	Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATVPPANNKSMRT
Ga0268324_10137871	3300028251	Phyllosphere	PDESFLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM
Ga0268324_10171161	3300028251	Phyllosphere	SFLYGPSRHVEYVWAKIPQFHRRLVGWAGATEPPAHNKSMRM
Ga0268324_10203141	3300028251	Phyllosphere	PSRHVEHVWAKNPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268324_10246071	3300028251	Phyllosphere	RPVEHVWAKNPQFHRRLVGWAGATEPPAHNKSMRI
Ga0268316_10105542	3300028253	Phyllosphere	PDESSVYGPRCVEHVWAKIPQFHRRLVGWAGATVSPAHYKSMRTSVPISMW
Ga0268316_10141992	3300028253	Phyllosphere	VPDESFLFVPSRHVEHVWVKIPQFHRRLVGWAGATEPP
Ga0268304_10082991	3300028256	Phyllosphere	FLYGPSRHVEHVWGKIPQYHRRLVSWAAATEPRAHNKSMRT
Ga0268304_10114381	3300028256	Phyllosphere	SRHVEHVWAKIPQFHRRLVGWAAATEPPAHNKSMRM
Ga0268310_10020901	3300028262	Phyllosphere	SLIYGSSRHVEHVWAKILQFHRRLVGWAGATEPPAQHKSMRT
Ga0268310_10058781	3300028262	Phyllosphere	PDESYLYGPSRHMEHVSAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268310_10097022	3300028262	Phyllosphere	FLYGPSRHVEHVWVKIPKFHRRLVGWAGATEPPGHNKSMRP
Ga0268310_10117901	3300028262	Phyllosphere	APDESFLHGPSRYVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268310_10183931	3300028262	Phyllosphere	LYGPSRHVGHVWAKIPQFHRRLVGWAGAIEPPAHNKSIRT
Ga0268310_10207051	3300028262	Phyllosphere	VLDESFLYGPSRHVEHVWAKIPQFHQRLVGWAGATEPP
Ga0268310_10236681	3300028262	Phyllosphere	LCGPSRHVEYVGAKIPQFHRRLVGWAVATEPPAHNKSIRT
Ga0268310_10245801	3300028262	Phyllosphere	GPSRHVEHVWAKIPQFYWRLVGWACATAPPAHNKSMRM
Ga0268310_10294161	3300028262	Phyllosphere	SIIYGPSRHVEHVWAKIPQFHQRLFGWAGATEPPAHNKSMRTEVPISMW
Ga0268310_10318032	3300028262	Phyllosphere	DESFLYGPSRHAEHVWAKIPQFQRRLVGWAGATEPPSHNKSMRM
Ga0268310_10330031	3300028262	Phyllosphere	LYGPSRHVEHVWAKIPQFHRRLVGWAGVTEPPAQHKSMRT
Ga0268310_10358112	3300028262	Phyllosphere	RHVEHVWAKIRLFHRRLIGWAGATEPPAHNKSMRT
Ga0268310_10420681	3300028262	Phyllosphere	RHVEHVGRKIPQFQRRLVGWAGATEPPAHNKSIRT
Ga0268310_10424582	3300028262	Phyllosphere	ESFLFGPFRHVEHVWAKIPQFHRRLVGWAGATEPPAHNRSMRT
Ga0268310_10463421	3300028262	Phyllosphere	FLYGPSRHVEHVWVKIPQFQRRLVGWAGATEPPAHNKSMRT
Ga0268310_10531221	3300028262	Phyllosphere	VWAKIPQFHRRLVGWAGATEPPAHNKSMRMYVPISMW
Ga0268264_119744101	3300028381	Switchgrass Rhizosphere	PSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMII
Ga0268264_122801401	3300028381	Switchgrass Rhizosphere	CDPSRHVEHVGAKIPQFHQRLVGWAVATEPPAQNKSIRT
Ga0268264_126606781	3300028381	Switchgrass Rhizosphere	RHVEHVWAKFPQFHQRQVGWAGATEPLAHNKSMRT
Ga0268302_1055131	3300028464	Phyllosphere	NESFLYGPSRHVDHVWGKIPQFHRKLVGWAGATEPPAHNKSMRT
Ga0268301_1031501	3300028465	Phyllosphere	SFLYGPSEHVEHVCAKIPQFHWRLVGWAGATEPAAHNKSMRIYVPISMW
Ga0268321_1061491	3300028466	Phyllosphere	VLDESFLYGPSRHVEHVWAKIPQFYRRLVGWAGATEPPA
Ga0268317_10029621	3300028468	Phyllosphere	ESFLYGPSRHVEHVWAKIPQFHRRLVGWAGAIEPPAHNKLMRM
Ga0268317_10107921	3300028468	Phyllosphere	LYGPSRHVEHVWAKIPQFHRRLVGWAGKTEPPAHNKSMRT
Ga0268317_10119141	3300028468	Phyllosphere	DESFLYGSTRHVEHVWAKIPQFHRRLVSWAGATEPPAHNKSMRT
Ga0268337_10009561	3300028469	Phyllosphere	ESFRCGPSRHVEHVWAKIPQYHRRLKSWAGATEPPAHNKSMRTLVPISMW
Ga0268337_10018721	3300028469	Phyllosphere	LYSPSRHVEHVWAKIPQFHRRLVGWVGVTEPPAHNKSMRT
Ga0268337_10058121	3300028469	Phyllosphere	APDESFIYGPSRHVEHVWAQIPQFHRRLVGWAGATEPPAHNKSM
Ga0268337_10125981	3300028469	Phyllosphere	SPSKHVEHVWTKIPQFHRRLVGWAGATEPPAHNNSMRT
Ga0268337_10168451	3300028469	Phyllosphere	APDESFLYGPSRHVEHFWAKIPQFHQRLVGWAGITEPPAHNKSMRT
Ga0268323_10156611	3300028471	Phyllosphere	ESFLYGPSTHVEHVWVKIPQFHQRLVGWAGAIEPPAHNKSMRTLVPISMW
Ga0268323_10186391	3300028471	Phyllosphere	PSRHVEHVWSKIHQFHRRLVSWVGATEPPTHNKSMRT
Ga0268315_10048261	3300028472	Phyllosphere	MNHFLYGPSRYKEHVWAKFPQFHRRLVGWVGATEPP
Ga0268315_10160611	3300028472	Phyllosphere	SRHVEYVWAKIPQFHRRLVGWAGATEPPAHNKSMRT
Ga0268315_10172211	3300028472	Phyllosphere	VSDESFLCGPSRHVEHVWAKIPQFHQRLVGWAGATEPPAHNKSMR
Ga0268315_10176241	3300028472	Phyllosphere	VPDESFLYGPSRHVKHVWAKIPQFHRRLVGWAGAIEPPAHNKLMRT
Ga0268315_10224621	3300028472	Phyllosphere	LYGPSRHVEHVWAKIPQFRRRLVGWAGAKEPPAHNKSMRM
Ga0268315_10227431	3300028472	Phyllosphere	SFLYGPSRHVEHVWAKIPQFHRRLVGWVGATEPPGHNKSMRT
Ga0268315_10231501	3300028472	Phyllosphere	RHVEHVWAKIPQFHRRLVGWAGATEPPAHNKLMRT
Ga0268315_10261721	3300028472	Phyllosphere	GPFIHVEYVWAKIPQFHWRLVGWAGVTGPPAHNKSMRR
Ga0268319_10046251	3300028473	Phyllosphere	FLYGPSRHVEHVWEKIPQFHRRLVGWAGATVPPAHNKSMRM
Ga0268319_10123581	3300028473	Phyllosphere	VPDEPFLYGPSRHVEHVWTKIPQFYRRLVGWADATEPPAHNKSMRT
Ga0268319_10163461	3300028473	Phyllosphere	RHVEHVWAKFPQFHWRLVGWAGATEPPAHNKSMRM
Ga0268331_10191081	3300028474	Phyllosphere	FLYGPSRHVEHVWVKIPQFHRRLVGWAGATVPPAHNKSMRM
Ga0268327_10136831	3300028475	Phyllosphere	DESFLYGPSRHVEHVWAKIPQFHRRLVGWASATEPPDHNKSMRT
Ga0268335_10192671	3300028527	Phyllosphere	LYGPSRHVEHVWAKIPQFHWRLVGWASATEPPDHNKSMRT
Ga0268311_10033812	3300028529	Phyllosphere	QGCAPDESFLCGPSRHVEHVWAKIPQFHWRLVSWAGATEPPAHNKSIRT
Ga0268311_10082051	3300028529	Phyllosphere	LYGPSRHVEHVWAKIPQFRQRLVGWAGAKEPPAHNKSMRM
Ga0268311_10156732	3300028529	Phyllosphere	YGPSRHVEHVWAKIPQFHRRLVGRAGATDPLAHNKSMRT
Ga0268311_10205751	3300028529	Phyllosphere	GPSRHVEHVWAKIAQFHRRLVGWAGATEPPAHNKSMRM
Ga0268311_10209551	3300028529	Phyllosphere	LSRHVEHVWENFPQFHRRLVGWAGAIEPPAYNKSMRT
Ga0268311_10227611	3300028529	Phyllosphere	PDEPFLCGPSRHVEHVWAKIPQFHRRLVGWAGATEPIAHNKYMRT
Ga0268311_10241161	3300028529	Phyllosphere	SKQVEHVWAKIPQFHRRLVGWLGETEPPAHNKSMRT
Ga0268311_10249461	3300028529	Phyllosphere	LYIPSRHVEHVWAKFPQFRRRLVGWAGATEPPAHNKSMRT
Ga0268311_10262481	3300028529	Phyllosphere	PSRHIEHVWVKIPQFHWRLVGWAGATEPPAHNKSMIM
Ga0214493_11668541	3300032465	Switchgrass Phyllosphere	ALDESFLYGPSRYVEHVWAKIPQFHRRIVGWAGATDPPAHNKSMS
Ga0214488_10982381	3300032467	Switchgrass Phyllosphere	FLYGPSRHVEHVWAKIPQFHRRLVGWAGATEPPAHNKSMRM
Ga0214485_10832161	3300032698	Switchgrass Phyllosphere	LFLPSRHVEHFWSKIPQFHRMLVGSAGATEPPAHNK
Ga0314739_10816761	3300032913	Switchgrass Phyllosphere	GPSRHVEHIWAKIPQFHRRLVGWAGATEPPAHNKSIRT
Ga0314758_11683161	3300033525	Switchgrass Phyllosphere	PSRHVVHVWAKIPQFHRRLVGGAGATEPPAHNKSMRT
Ga0314757_11326081	3300033534	Switchgrass Phyllosphere	YGPSRHVEHVWAKIPQFHLRLVGWAGATEPPAHNKSM

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F004834

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign