NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F004811

Metagenome / Metatranscriptome Family F004811

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004811
Family Type Metagenome / Metatranscriptome
Number of Sequences 423
Average Sequence Length 40 residues
Representative Sequence MNFLYAAYTATWIIHITYLGILVRRYQRLRSEIEELKKK
Number of Associated Samples 270
Number of Associated Scaffolds 423

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 84.13 %
% of genes near scaffold ends (potentially truncated) 17.02 %
% of genes from short scaffolds (< 2000 bps) 76.12 %
Associated GOLD sequencing projects 244
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.400 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.948 % of family members)
Environment Ontology (ENVO) Unclassified
(33.570 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.790 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.73%    β-sheet: 0.00%    Coil/Unstructured: 46.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 423 Family Scaffolds
PF01578Cytochrom_C_asm 34.04
PF07238PilZ 31.44
PF03379CcmB 3.55
PF00005ABC_tran 2.60
PF06739SBBP 1.89
PF03100CcmE 0.95
PF00069Pkinase 0.71
PF12969DUF3857 0.47
PF00158Sigma54_activat 0.47
PF08308PEGA 0.47
PF00793DAHP_synth_1 0.47
PF01979Amidohydro_1 0.47
PF05193Peptidase_M16_C 0.47
PF01964ThiC_Rad_SAM 0.47
PF16889Hepar_II_III_N 0.24
PF05960DUF885 0.24
PF00483NTP_transferase 0.24
PF12838Fer4_7 0.24
PF05649Peptidase_M13_N 0.24
PF08241Methyltransf_11 0.24
PF02518HATPase_c 0.24
PF07638Sigma70_ECF 0.24
PF10282Lactonase 0.24
PF02321OEP 0.24
PF13304AAA_21 0.24
PF13460NAD_binding_10 0.24
PF16640Big_3_5 0.24
PF03941INCENP_ARK-bind 0.24
PF04389Peptidase_M28 0.24
PF01740STAS 0.24
PF13620CarboxypepD_reg 0.24
PF02771Acyl-CoA_dh_N 0.24
PF03483B3_4 0.24
PF03551PadR 0.24
PF13418Kelch_4 0.24
PF02604PhdYeFM_antitox 0.24
PF00719Pyrophosphatase 0.24
PF08032SpoU_sub_bind 0.24

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 423 Family Scaffolds
COG2386ABC-type transport system involved in cytochrome c biogenesis, permease componentPosttranslational modification, protein turnover, chaperones [O] 3.55
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.84
COG2332Cytochrome c biogenesis protein CcmEPosttranslational modification, protein turnover, chaperones [O] 0.95
COG04224-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiCCoenzyme transport and metabolism [H] 0.47
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.47
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.24
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.24
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.24
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.24
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.24
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.24
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.24
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.24
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.24
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.24
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.24


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.40 %
UnclassifiedrootN/A2.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig116576All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium837Open in IMG/M
2162886011|MRS1b_contig_4018967All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300000559|F14TC_104944945All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300001356|JGI12269J14319_10012206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6776Open in IMG/M
3300001545|JGI12630J15595_10004083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3172Open in IMG/M
3300001593|JGI12635J15846_10696103All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300001661|JGI12053J15887_10432599All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300001867|JGI12627J18819_10004294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5349Open in IMG/M
3300002908|JGI25382J43887_10436243All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300004063|Ga0055483_10302342All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300004080|Ga0062385_10809398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfosporosinus → Desulfosporosinus orientis614Open in IMG/M
3300004092|Ga0062389_101560772All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300004152|Ga0062386_100127564All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1972Open in IMG/M
3300004156|Ga0062589_100172497All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1519Open in IMG/M
3300004157|Ga0062590_100043429All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2423Open in IMG/M
3300004479|Ga0062595_100078525All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300004479|Ga0062595_100182335All Organisms → cellular organisms → Bacteria → Acidobacteria1272Open in IMG/M
3300004479|Ga0062595_101579059All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300004633|Ga0066395_11007878All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300004635|Ga0062388_100001878All Organisms → cellular organisms → Bacteria9143Open in IMG/M
3300005167|Ga0066672_10187743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1313Open in IMG/M
3300005167|Ga0066672_10392711All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300005167|Ga0066672_10994996All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300005171|Ga0066677_10011409All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3865Open in IMG/M
3300005171|Ga0066677_10281394All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300005175|Ga0066673_10002592All Organisms → cellular organisms → Bacteria6702Open in IMG/M
3300005175|Ga0066673_10271691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae985Open in IMG/M
3300005176|Ga0066679_10578429All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300005180|Ga0066685_10118264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1783Open in IMG/M
3300005332|Ga0066388_104454339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter713Open in IMG/M
3300005338|Ga0068868_100473683All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1093Open in IMG/M
3300005367|Ga0070667_101738836All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005434|Ga0070709_10097979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1948Open in IMG/M
3300005434|Ga0070709_10312963All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300005434|Ga0070709_11206812All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005436|Ga0070713_100166738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1970Open in IMG/M
3300005439|Ga0070711_101484563All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300005445|Ga0070708_100012992All Organisms → cellular organisms → Bacteria6803Open in IMG/M
3300005445|Ga0070708_100164083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2071Open in IMG/M
3300005445|Ga0070708_101039969All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300005446|Ga0066686_10181759All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300005526|Ga0073909_10716530All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005529|Ga0070741_10000295All Organisms → cellular organisms → Bacteria190401Open in IMG/M
3300005529|Ga0070741_10000674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae117558Open in IMG/M
3300005529|Ga0070741_10020077All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10590Open in IMG/M
3300005536|Ga0070697_100000470All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter30775Open in IMG/M
3300005536|Ga0070697_100075002All Organisms → cellular organisms → Bacteria2780Open in IMG/M
3300005536|Ga0070697_101172819All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005536|Ga0070697_101969587All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005536|Ga0070697_101979970All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300005538|Ga0070731_10110930All Organisms → cellular organisms → Bacteria1817Open in IMG/M
3300005538|Ga0070731_10225870All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300005538|Ga0070731_10930119All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300005541|Ga0070733_10116959All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1711Open in IMG/M
3300005541|Ga0070733_10877294All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005547|Ga0070693_101312963All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005548|Ga0070665_100015701All Organisms → cellular organisms → Bacteria7607Open in IMG/M
3300005548|Ga0070665_100122089All Organisms → cellular organisms → Bacteria2607Open in IMG/M
3300005554|Ga0066661_10824481All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005555|Ga0066692_10005079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5771Open in IMG/M
3300005556|Ga0066707_10149129All Organisms → cellular organisms → Bacteria → Acidobacteria1481Open in IMG/M
3300005556|Ga0066707_10308992All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1035Open in IMG/M
3300005559|Ga0066700_10613913All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter757Open in IMG/M
3300005563|Ga0068855_101468706All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300005566|Ga0066693_10223560All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005598|Ga0066706_10379613All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300005841|Ga0068863_101763578All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005841|Ga0068863_102436361All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005921|Ga0070766_10803571All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300005921|Ga0070766_10954838All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005952|Ga0080026_10059396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1014Open in IMG/M
3300005983|Ga0081540_1115137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1127Open in IMG/M
3300006032|Ga0066696_10325623All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300006041|Ga0075023_100035029All Organisms → cellular organisms → Bacteria1500Open in IMG/M
3300006041|Ga0075023_100219317All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300006046|Ga0066652_100267940All Organisms → cellular organisms → Bacteria → Acidobacteria1503Open in IMG/M
3300006046|Ga0066652_100695702All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300006046|Ga0066652_101058699All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300006047|Ga0075024_100172297All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300006050|Ga0075028_100087012All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300006050|Ga0075028_100667556All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300006050|Ga0075028_100677494All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006052|Ga0075029_100013028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4599Open in IMG/M
3300006052|Ga0075029_100274200All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300006052|Ga0075029_100577311All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae749Open in IMG/M
3300006052|Ga0075029_100968692All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300006059|Ga0075017_100146579All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300006163|Ga0070715_10691097All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300006173|Ga0070716_100028415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3013Open in IMG/M
3300006173|Ga0070716_100298895All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300006173|Ga0070716_101499534All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300006174|Ga0075014_100282828All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300006175|Ga0070712_101841057All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006176|Ga0070765_100293130All Organisms → cellular organisms → Bacteria1502Open in IMG/M
3300006176|Ga0070765_100382406All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300006237|Ga0097621_101017844All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300006354|Ga0075021_10217261All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300006354|Ga0075021_10462752All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300006358|Ga0068871_102125233All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006755|Ga0079222_10573295All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300006755|Ga0079222_11118679All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300006755|Ga0079222_11949563All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300006791|Ga0066653_10788098All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300006800|Ga0066660_10675052All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300006800|Ga0066660_11593064All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006804|Ga0079221_11556680All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300006852|Ga0075433_10000112All Organisms → cellular organisms → Bacteria → Acidobacteria40085Open in IMG/M
3300006854|Ga0075425_100892825All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300006871|Ga0075434_101456610All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300007076|Ga0075435_100369929All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300007076|Ga0075435_101580721All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300007258|Ga0099793_10610285All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300007265|Ga0099794_10101862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1434Open in IMG/M
3300007788|Ga0099795_10259342All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300009012|Ga0066710_101715082All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300009012|Ga0066710_104269779All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300009038|Ga0099829_10001893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui11829Open in IMG/M
3300009038|Ga0099829_10004658All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium8212Open in IMG/M
3300009038|Ga0099829_10092294All Organisms → cellular organisms → Bacteria → Acidobacteria2341Open in IMG/M
3300009038|Ga0099829_10261625All Organisms → cellular organisms → Bacteria → Acidobacteria1413Open in IMG/M
3300009038|Ga0099829_11154598All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300009038|Ga0099829_11369445All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300009088|Ga0099830_10991994All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300009089|Ga0099828_10001072All Organisms → cellular organisms → Bacteria17766Open in IMG/M
3300009089|Ga0099828_10005307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9215Open in IMG/M
3300009089|Ga0099828_10463567All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300009090|Ga0099827_10252260All Organisms → cellular organisms → Bacteria → Acidobacteria1483Open in IMG/M
3300009098|Ga0105245_10903457All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300009098|Ga0105245_11546153All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300009098|Ga0105245_12421218All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300009137|Ga0066709_100013750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7653Open in IMG/M
3300009137|Ga0066709_104498921All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300009176|Ga0105242_11685592All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300009177|Ga0105248_10137944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2751Open in IMG/M
3300009520|Ga0116214_1300841All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300009553|Ga0105249_10358800All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300010046|Ga0126384_11800993All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300010048|Ga0126373_10000039All Organisms → cellular organisms → Bacteria134948Open in IMG/M
3300010048|Ga0126373_10944649All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300010048|Ga0126373_11500525All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300010333|Ga0134080_10535902All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300010358|Ga0126370_11804900All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300010373|Ga0134128_11018558All Organisms → cellular organisms → Bacteria → Acidobacteria915Open in IMG/M
3300010376|Ga0126381_101201430All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300010379|Ga0136449_100925040All Organisms → cellular organisms → Bacteria → Acidobacteria1417Open in IMG/M
3300010397|Ga0134124_10435900All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300011119|Ga0105246_10045588All Organisms → cellular organisms → Bacteria → Acidobacteria2986Open in IMG/M
3300011120|Ga0150983_11129960All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300011269|Ga0137392_10091784All Organisms → cellular organisms → Bacteria → Acidobacteria2377Open in IMG/M
3300011269|Ga0137392_10109921All Organisms → cellular organisms → Bacteria → Acidobacteria2185Open in IMG/M
3300011444|Ga0137463_1103132All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300011998|Ga0120114_1107429All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300012096|Ga0137389_10455755All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300012189|Ga0137388_10135998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2159Open in IMG/M
3300012201|Ga0137365_10880684All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300012202|Ga0137363_10070834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2564Open in IMG/M
3300012208|Ga0137376_10535949All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300012209|Ga0137379_10548262All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300012209|Ga0137379_11358859All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300012285|Ga0137370_10546183All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300012359|Ga0137385_10487435All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300012359|Ga0137385_11529458All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300012361|Ga0137360_10054532All Organisms → cellular organisms → Bacteria2895Open in IMG/M
3300012361|Ga0137360_10665856All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300012361|Ga0137360_11345873All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300012362|Ga0137361_10412426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1241Open in IMG/M
3300012362|Ga0137361_11040473All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300012363|Ga0137390_10174384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2137Open in IMG/M
3300012363|Ga0137390_10621312All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300012917|Ga0137395_10810928All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300012922|Ga0137394_10270940All Organisms → cellular organisms → Bacteria → Acidobacteria1452Open in IMG/M
3300012924|Ga0137413_10209678All Organisms → cellular organisms → Bacteria1315Open in IMG/M
3300012929|Ga0137404_10456199All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300012929|Ga0137404_10803831All Organisms → cellular organisms → Bacteria → Acidobacteria854Open in IMG/M
3300012930|Ga0137407_10045810All Organisms → cellular organisms → Bacteria3523Open in IMG/M
3300012930|Ga0137407_12331413All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300012944|Ga0137410_10333059All Organisms → cellular organisms → Bacteria → Acidobacteria1209Open in IMG/M
3300012944|Ga0137410_10659300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter869Open in IMG/M
3300012944|Ga0137410_11430128All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300012944|Ga0137410_11637819All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300012955|Ga0164298_10586654All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300012960|Ga0164301_11071836All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300012960|Ga0164301_11694713All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300012986|Ga0164304_10323977All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300012987|Ga0164307_10247676All Organisms → cellular organisms → Bacteria → Acidobacteria1242Open in IMG/M
3300013297|Ga0157378_10440840All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1291Open in IMG/M
3300013770|Ga0120123_1126465All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300014166|Ga0134079_10126437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1006Open in IMG/M
3300014498|Ga0182019_10082898All Organisms → cellular organisms → Bacteria → Acidobacteria1928Open in IMG/M
3300014502|Ga0182021_11193277All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis917Open in IMG/M
3300015052|Ga0137411_1355318All Organisms → cellular organisms → Bacteria → Acidobacteria1745Open in IMG/M
3300015193|Ga0167668_1070851All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300015241|Ga0137418_10937976All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300015264|Ga0137403_10378146All Organisms → cellular organisms → Bacteria → Acidobacteria1299Open in IMG/M
3300015358|Ga0134089_10488625All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300016319|Ga0182033_11148502All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300017822|Ga0187802_10325881All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300017823|Ga0187818_10019270All Organisms → cellular organisms → Bacteria2922Open in IMG/M
3300017823|Ga0187818_10385810All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300017927|Ga0187824_10000057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae16304Open in IMG/M
3300017930|Ga0187825_10001747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6676Open in IMG/M
3300017930|Ga0187825_10056563All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300017932|Ga0187814_10198150All Organisms → cellular organisms → Bacteria → Acidobacteria754Open in IMG/M
3300017933|Ga0187801_10070370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1294Open in IMG/M
3300017936|Ga0187821_10036346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1747Open in IMG/M
3300017939|Ga0187775_10099735All Organisms → cellular organisms → Bacteria → Acidobacteria973Open in IMG/M
3300017939|Ga0187775_10400164Not Available567Open in IMG/M
3300017947|Ga0187785_10277931All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300017948|Ga0187847_10164185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1213Open in IMG/M
3300017948|Ga0187847_10734150All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300017959|Ga0187779_10000059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae80484Open in IMG/M
3300017959|Ga0187779_10014661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4478Open in IMG/M
3300017961|Ga0187778_10487150All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300017961|Ga0187778_10488494All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300017966|Ga0187776_10069656All Organisms → cellular organisms → Bacteria2036Open in IMG/M
3300017966|Ga0187776_10385481Not Available934Open in IMG/M
3300017966|Ga0187776_11303788Not Available549Open in IMG/M
3300017972|Ga0187781_10048675All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2917Open in IMG/M
3300017972|Ga0187781_10413608All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300017974|Ga0187777_10998416All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300017975|Ga0187782_10150095All Organisms → cellular organisms → Bacteria → Acidobacteria1733Open in IMG/M
3300018007|Ga0187805_10038902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2130Open in IMG/M
3300018007|Ga0187805_10039320All Organisms → cellular organisms → Bacteria2118Open in IMG/M
3300018027|Ga0184605_10274683All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300018058|Ga0187766_10810075All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300018060|Ga0187765_11032051All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300018062|Ga0187784_10531480All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300018064|Ga0187773_10713191All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300018085|Ga0187772_10091047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1950Open in IMG/M
3300018086|Ga0187769_10079568All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2326Open in IMG/M
3300018086|Ga0187769_10096845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2115Open in IMG/M
3300018086|Ga0187769_10107765All Organisms → cellular organisms → Bacteria → Acidobacteria2008Open in IMG/M
3300018088|Ga0187771_10056403All Organisms → cellular organisms → Bacteria → Acidobacteria3074Open in IMG/M
3300018088|Ga0187771_10456851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1079Open in IMG/M
3300018088|Ga0187771_10967894All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300018090|Ga0187770_10407408All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300018431|Ga0066655_10691987All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300018431|Ga0066655_11117819All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300018433|Ga0066667_10009458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4590Open in IMG/M
3300018468|Ga0066662_10002804All Organisms → cellular organisms → Bacteria → Acidobacteria8265Open in IMG/M
3300018468|Ga0066662_10304791All Organisms → cellular organisms → Bacteria → Acidobacteria1341Open in IMG/M
3300018482|Ga0066669_10843729All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300018482|Ga0066669_12148973All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300019284|Ga0187797_1619882All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300019785|Ga0182022_1361438All Organisms → cellular organisms → Bacteria → Acidobacteria1508Open in IMG/M
3300019789|Ga0137408_1080690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1310Open in IMG/M
3300019870|Ga0193746_1021649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis669Open in IMG/M
3300019877|Ga0193722_1121084All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300019879|Ga0193723_1056282All Organisms → cellular organisms → Bacteria → Acidobacteria1150Open in IMG/M
3300019881|Ga0193707_1000082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24081Open in IMG/M
3300019881|Ga0193707_1057342All Organisms → cellular organisms → Bacteria → Acidobacteria1230Open in IMG/M
3300019881|Ga0193707_1075842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1038Open in IMG/M
3300019882|Ga0193713_1205100All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300019885|Ga0193747_1005626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3037Open in IMG/M
3300019888|Ga0193751_1059578All Organisms → cellular organisms → Bacteria → Acidobacteria1602Open in IMG/M
3300020004|Ga0193755_1083873All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300020021|Ga0193726_1176635All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300020140|Ga0179590_1181722All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300020170|Ga0179594_10159506All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300020579|Ga0210407_10142004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1847Open in IMG/M
3300020579|Ga0210407_10304722All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1244Open in IMG/M
3300020580|Ga0210403_10256042All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300020580|Ga0210403_11027887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis644Open in IMG/M
3300020580|Ga0210403_11064875All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300020581|Ga0210399_11032022All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300020581|Ga0210399_11138032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae623Open in IMG/M
3300020583|Ga0210401_10614426All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300020583|Ga0210401_10879109All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300021088|Ga0210404_10854935All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300021168|Ga0210406_10005335All Organisms → cellular organisms → Bacteria13509Open in IMG/M
3300021168|Ga0210406_10606661All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300021170|Ga0210400_10186134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1684Open in IMG/M
3300021170|Ga0210400_11027810All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300021344|Ga0193719_10080653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1414Open in IMG/M
3300021344|Ga0193719_10328500All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300021358|Ga0213873_10109395All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300021362|Ga0213882_10043347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1766Open in IMG/M
3300021377|Ga0213874_10135449All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300021403|Ga0210397_10241533All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1307Open in IMG/M
3300021420|Ga0210394_10001085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae46492Open in IMG/M
3300021432|Ga0210384_10007365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11613Open in IMG/M
3300021432|Ga0210384_11061902All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300021478|Ga0210402_10566333All Organisms → cellular organisms → Bacteria → Acidobacteria1054Open in IMG/M
3300021479|Ga0210410_11167395All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300021559|Ga0210409_10512059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1064Open in IMG/M
3300021559|Ga0210409_10977631All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300021559|Ga0210409_11343468All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300021560|Ga0126371_10060483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3653Open in IMG/M
3300021560|Ga0126371_10061369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3629Open in IMG/M
3300022531|Ga0242660_1053420All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300022756|Ga0222622_10693333All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300024288|Ga0179589_10496524All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300025711|Ga0207696_1080849All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300025899|Ga0207642_10481922All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300025899|Ga0207642_10502109All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300025906|Ga0207699_10212344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1317Open in IMG/M
3300025906|Ga0207699_11185507All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300025910|Ga0207684_10091851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2587Open in IMG/M
3300025912|Ga0207707_11262931All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300025915|Ga0207693_10946428All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300025922|Ga0207646_10454411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1156Open in IMG/M
3300025934|Ga0207686_11242842All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025939|Ga0207665_10106431All Organisms → cellular organisms → Bacteria → Acidobacteria1965Open in IMG/M
3300025939|Ga0207665_10464626All Organisms → cellular organisms → Bacteria → Acidobacteria973Open in IMG/M
3300025961|Ga0207712_10352872All Organisms → cellular organisms → Bacteria → Acidobacteria1223Open in IMG/M
3300026023|Ga0207677_10726497All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300026142|Ga0207698_11694025All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300026217|Ga0209871_1055296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis757Open in IMG/M
3300026296|Ga0209235_1152640All Organisms → cellular organisms → Bacteria → Acidobacteria915Open in IMG/M
3300026301|Ga0209238_1074983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1185Open in IMG/M
3300026313|Ga0209761_1065865All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300026313|Ga0209761_1108876All Organisms → cellular organisms → Bacteria → Acidobacteria1369Open in IMG/M
3300026314|Ga0209268_1182047All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300026317|Ga0209154_1003661All Organisms → cellular organisms → Bacteria → Acidobacteria8312Open in IMG/M
3300026332|Ga0209803_1245034All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300026354|Ga0257180_1048658All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300026354|Ga0257180_1053389All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300026555|Ga0179593_1165158All Organisms → cellular organisms → Bacteria → Acidobacteria1981Open in IMG/M
3300027565|Ga0209219_1013889All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300027667|Ga0209009_1014185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1903Open in IMG/M
3300027680|Ga0207826_1213410All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300027701|Ga0209447_10166554All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300027706|Ga0209581_1000004All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1127213Open in IMG/M
3300027821|Ga0209811_10007763All Organisms → cellular organisms → Bacteria → Acidobacteria3435Open in IMG/M
3300027846|Ga0209180_10095606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1689Open in IMG/M
3300027862|Ga0209701_10020199All Organisms → cellular organisms → Bacteria4342Open in IMG/M
3300027862|Ga0209701_10061298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2396Open in IMG/M
3300027862|Ga0209701_10489397All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300027869|Ga0209579_10130639All Organisms → cellular organisms → Bacteria → Acidobacteria1335Open in IMG/M
3300027869|Ga0209579_10164954All Organisms → cellular organisms → Bacteria → Acidobacteria1183Open in IMG/M
3300027869|Ga0209579_10636218All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300027882|Ga0209590_10056326All Organisms → cellular organisms → Bacteria2213Open in IMG/M
3300027894|Ga0209068_10014403All Organisms → cellular organisms → Bacteria3796Open in IMG/M
3300027894|Ga0209068_10383034All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300027894|Ga0209068_10758346All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300027895|Ga0209624_10492856All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300027911|Ga0209698_10067741All Organisms → cellular organisms → Bacteria3061Open in IMG/M
3300027915|Ga0209069_10008279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5130Open in IMG/M
3300027915|Ga0209069_10473575All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300028047|Ga0209526_10002889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis11641Open in IMG/M
3300028047|Ga0209526_10613638All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis695Open in IMG/M
3300028380|Ga0268265_10654602All Organisms → cellular organisms → Bacteria → Acidobacteria1010Open in IMG/M
3300028381|Ga0268264_12512395All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300028536|Ga0137415_10567398All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300028792|Ga0307504_10086651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae972Open in IMG/M
3300028800|Ga0265338_10113217All Organisms → cellular organisms → Bacteria → Acidobacteria2180Open in IMG/M
3300029636|Ga0222749_10508825All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300029990|Ga0311336_11135772All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300030991|Ga0073994_11793898All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300031094|Ga0308199_1047654All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
(restricted) 3300031150|Ga0255311_1073076All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
(restricted) 3300031248|Ga0255312_1204332All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300031682|Ga0318560_10821326All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031716|Ga0310813_11081801All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300031720|Ga0307469_10451150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1113Open in IMG/M
3300031720|Ga0307469_11225252All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300031740|Ga0307468_100016663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3103Open in IMG/M
3300031740|Ga0307468_100344689All Organisms → cellular organisms → Bacteria → Acidobacteria1107Open in IMG/M
3300031879|Ga0306919_10484299All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300031962|Ga0307479_10006239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10938Open in IMG/M
3300031962|Ga0307479_11058827All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300031962|Ga0307479_11275261All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300031996|Ga0308176_10616301All Organisms → cellular organisms → Bacteria → Acidobacteria1117Open in IMG/M
3300032160|Ga0311301_10571560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1643Open in IMG/M
3300032163|Ga0315281_10075873All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3969Open in IMG/M
3300032180|Ga0307471_100189845All Organisms → cellular organisms → Bacteria → Acidobacteria2040Open in IMG/M
3300032180|Ga0307471_100728605All Organisms → cellular organisms → Bacteria → Acidobacteria1157Open in IMG/M
3300032180|Ga0307471_101026813All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M
3300032180|Ga0307471_101047037All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300032180|Ga0307471_103101816All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300032205|Ga0307472_100468867All Organisms → cellular organisms → Bacteria → Acidobacteria1076Open in IMG/M
3300032205|Ga0307472_100567397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae994Open in IMG/M
3300032205|Ga0307472_101578255All Organisms → cellular organisms → Bacteria → Acidobacteria644Open in IMG/M
3300032261|Ga0306920_100411057All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2012Open in IMG/M
3300032770|Ga0335085_10001693All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae44853Open in IMG/M
3300032770|Ga0335085_10007977All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae16254Open in IMG/M
3300032770|Ga0335085_10015561All Organisms → cellular organisms → Bacteria → Acidobacteria11028Open in IMG/M
3300032770|Ga0335085_10024162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8581Open in IMG/M
3300032770|Ga0335085_10278136All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1996Open in IMG/M
3300032770|Ga0335085_12030878All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300032783|Ga0335079_10000524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia43899Open in IMG/M
3300032783|Ga0335079_10004189All Organisms → cellular organisms → Bacteria16586Open in IMG/M
3300032783|Ga0335079_10013559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia9314Open in IMG/M
3300032783|Ga0335079_10018489All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7965Open in IMG/M
3300032783|Ga0335079_10023937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6996Open in IMG/M
3300032783|Ga0335079_10036324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5658Open in IMG/M
3300032783|Ga0335079_10077825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3770Open in IMG/M
3300032783|Ga0335079_10079851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3719Open in IMG/M
3300032783|Ga0335079_10321752All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1683Open in IMG/M
3300032783|Ga0335079_10455954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1370Open in IMG/M
3300032783|Ga0335079_10604882All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300032783|Ga0335079_11096995Not Available806Open in IMG/M
3300032805|Ga0335078_10003603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia23044Open in IMG/M
3300032805|Ga0335078_10438032All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300032805|Ga0335078_10882458All Organisms → cellular organisms → Bacteria → Acidobacteria1077Open in IMG/M
3300032805|Ga0335078_11058944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae953Open in IMG/M
3300032805|Ga0335078_11180147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter886Open in IMG/M
3300032828|Ga0335080_10009558All Organisms → cellular organisms → Bacteria10139Open in IMG/M
3300032828|Ga0335080_10141207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2668Open in IMG/M
3300032828|Ga0335080_10858458All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300032829|Ga0335070_10001967All Organisms → cellular organisms → Bacteria23877Open in IMG/M
3300032829|Ga0335070_10006800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13441Open in IMG/M
3300032829|Ga0335070_10182085All Organisms → cellular organisms → Bacteria → Acidobacteria2108Open in IMG/M
3300032829|Ga0335070_10209980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1933Open in IMG/M
3300032829|Ga0335070_11238914All Organisms → cellular organisms → Bacteria → Acidobacteria684Open in IMG/M
3300032829|Ga0335070_12132760All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300032892|Ga0335081_10000914All Organisms → cellular organisms → Bacteria47264Open in IMG/M
3300032893|Ga0335069_10817109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1049Open in IMG/M
3300033158|Ga0335077_10635724All Organisms → cellular organisms → Bacteria → Acidobacteria1108Open in IMG/M
3300033158|Ga0335077_11350743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter689Open in IMG/M
3300033158|Ga0335077_12088237All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300033433|Ga0326726_10197474All Organisms → cellular organisms → Bacteria → Acidobacteria1856Open in IMG/M
3300033433|Ga0326726_10468856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1201Open in IMG/M
3300033433|Ga0326726_11005662All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300034090|Ga0326723_0142917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1049Open in IMG/M
3300034090|Ga0326723_0578143All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.96%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.55%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.36%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.13%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.18%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.18%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.18%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.18%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.18%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.71%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.47%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.47%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.47%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.47%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.47%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.47%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.24%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.24%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.24%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.24%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.24%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.24%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.24%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.24%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.24%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.24%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.24%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.24%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.24%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.24%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.24%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.24%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.24%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2162886011Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001545Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019785Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019870Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025711Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_018779202140918007SoilMNFLYAAYAATWIIHLVYVVTLVRRYGRVKNDLDELKRK
MRS1b_0141.000016302162886011Miscanthus RhizosphereMNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK
INPhiseqgaiiFebDRAFT_10201112033300000364SoilMNFLYTAYAAVWIVHVAYAFTXXRRYSXLSREIEDLKKK*
F14TC_10494494523300000559SoilMKSETFLYAAYAATWLIHVLYLGTLVRRYSRVKQEIKELERLKR*
JGI1027J11758_1291897833300000789SoilMNFLYTAYAAVWIVHVAYAFTLVRRYSXLSREIEDLKKK*
JGI12269J14319_1001220653300001356Peatlands SoilLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK*
JGI12630J15595_1000408333300001545Forest SoilMNFLYAAYTATWIIHITYLGILVQRYERLRSEIEELKKK*
JGI12635J15846_1069610323300001593Forest SoilMKFLYAAYAATWIIHISYLAYLLRRYARLRNEIQELNQK*
JGI12053J15887_1043259913300001661Forest SoilMNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEEL
JGI12627J18819_1000429463300001867Forest SoilMTYLYAAYAATWVIHIAYLASLLRRYTRLRKEIEELRRK*
JGI25382J43887_1043624323300002908Grasslands SoilMNFLYAAYAATWIIHIIYLSILFRRYTRLRSEIEELKKR*
Ga0055483_1030234223300004063Natural And Restored WetlandsMTDTSYLYAAYAATWIIHITYLWIVARRYKRLQSRVQELKKRS*
Ga0062385_1080939813300004080Bog Forest SoilMSENANVYLYAAYAATWIIHIGYLTTIARRYAKLRREIKSLNKK*
Ga0062389_10156077223300004092Bog Forest SoilMNFLYAAYAATWIIHITYLGTLVRRYQRLNREIEELKKR*
Ga0062386_10012756443300004152Bog Forest SoilMNFLYAAYAATWIIHIIYLGTLVRRYQRLNREIEELKKK*
Ga0062589_10017249723300004156SoilMKSETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR*
Ga0062590_10004342933300004157SoilMNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELKRK*
Ga0062595_10007852533300004479SoilMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK*
Ga0062595_10018233523300004479SoilMNFLYAAYAATWIIHIAYLGILVRRYQRLRKEIDELKKSG*
Ga0062595_10157905923300004479SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKR*
Ga0066395_1100787823300004633Tropical Forest SoilMSFLYVAYAATWIIHIAYLTLLVRRYQRLRDEIQEMKKEQE*
Ga0062388_10000187833300004635Bog Forest SoilMNFLYTAYAAVWIIHLGYLGTLVRRYKRVRREIAEMNRK*
Ga0066672_1018774323300005167SoilMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK*
Ga0066672_1039271123300005167SoilMKFLYAAYAATWIIHISYLAFLLRRFTRLRNEIQELNQK*
Ga0066672_1099499613300005167SoilMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNQK*
Ga0066677_1001140953300005171SoilMKFLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR*
Ga0066677_1028139413300005171SoilMNFLYAAYTATWVIHITYLGILVRRYKRLQSEIEELKKKS*
Ga0066673_1000259243300005175SoilMNFLYAAYTATWVIHITYLAILVRRYKRLQSEIEELKKSKG*
Ga0066673_1027169123300005175SoilMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNRK*
Ga0066679_1057842923300005176SoilMKFLYAAYSATWIIHISYLAFVLRRYIRLRNKILELNQK*
Ga0066685_1011826423300005180SoilMNFLYAAYAATWIIHISYLATLLLRYRRLRKQIEELRRSQ*
Ga0066388_10445433923300005332Tropical Forest SoilMSFLSLAYAATWIIHIAYLTLLVRRYQRLRDEIQEMKNEQE*
Ga0068868_10047368323300005338Miscanthus RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKNTN*
Ga0070667_10173883623300005367Switchgrass RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKTN*
Ga0070709_1009797933300005434Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYTATWLIHITYLSVLVRRYKRLQREIEDLKGQTVRR*
Ga0070709_1031296333300005434Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYTATWIIHVTYLGILVRRYQRLRKEIEHLKRTEPRS*
Ga0070709_1120681223300005434Corn, Switchgrass And Miscanthus RhizosphereMNFLYIAYAATWLIHITYLGVLVRRYQRLRHEIDELKRSKS*
Ga0070713_10016673823300005436Corn, Switchgrass And Miscanthus RhizosphereMSYLYAAYAATWIIHIFYLSTILSRAKRVRKEAEELKRK*
Ga0070711_10148456313300005439Corn, Switchgrass And Miscanthus RhizosphereIFLYAAYGVTWTIHIVYLGTLVGRYLLARIEADELKKQN*
Ga0070708_10001299233300005445Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYAATWIIHITYLGILVRRYQRLRSEIDELKKGKLA*
Ga0070708_10016408333300005445Corn, Switchgrass And Miscanthus RhizosphereMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIRELNQK*
Ga0070708_10103996913300005445Corn, Switchgrass And Miscanthus RhizosphereMKFLYAAYAATWIIHICYLASLLRRYIRLRNKIQELDQK*
Ga0066686_1018175923300005446SoilMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELTRK*
Ga0073909_1071653013300005526Surface SoilPELTMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK*
Ga0070741_10000295813300005529Surface SoilMNFLYAAYAVTWVIHIGYLTTLVRRYARLKKEIAELKK*
Ga0070741_10000674373300005529Surface SoilMTFLYAAYAATWVIHIVYLGTVLSRYTKVRKEFDELKRKKI*
Ga0070741_1002007773300005529Surface SoilMTYLYAAYAATWLIHITYLGILARRYARLKKEIESLQKKSV*
Ga0070697_10000047073300005536Corn, Switchgrass And Miscanthus RhizosphereMSYLYAAYAATWIIHITYLTIIVRRYGRLRKEIEELRRK*
Ga0070697_10007500233300005536Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYTATWLIHIGYLGILVRRYKRLQKTIQDVDRK*
Ga0070697_10117281913300005536Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRLRKEIDELKKSN*
Ga0070697_10196958723300005536Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYTATWIIHISYLVFLLRRYTRLSREIQELNQK*
Ga0070697_10197997013300005536Corn, Switchgrass And Miscanthus RhizosphereVSYLFAAYAATWIIHITYLGTLVRRYSRLRREIEELKKP*
Ga0070731_1011093033300005538Surface SoilMNFLYTAYAATWIIHIAYLGTLVRRYQRLSREIEELKK*
Ga0070731_1022587023300005538Surface SoilMNFLYAAYTATWIIHIAYLGTLVRRYQRLSREIVEMKKK*
Ga0070731_1093011923300005538Surface SoilGTAERPMTYLYAAYAATWIIHIFYLSTIVSRAKKVRKEAEELKRK*
Ga0070733_1011695923300005541Surface SoilMTYLYAAYAATWVIHVSYLGWLARRYVRLRQEIDELKKK*
Ga0070733_1087729423300005541Surface SoilMNYLYAAYAATWIIHVGYLTILARRYARLRKEIDDLAKK*
Ga0070693_10131296313300005547Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYTATWIIHITYLGILVQRYRRLRAEIEELQKKN*
Ga0070665_10001570133300005548Switchgrass RhizosphereMNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK*
Ga0070665_10012208933300005548Switchgrass RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKMK*
Ga0066661_1082448123300005554SoilMKFLYAAYAATWIIHISYLAFVLRRFTRLRNEIQELNQK*
Ga0066692_1000507943300005555SoilVKFLYAAYAATWIIHILYLGSLVRRYATLRREIDELNRK*
Ga0066707_1014912943300005556SoilHDRASECKMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELTRK*
Ga0066707_1030899223300005556SoilVNFLYAAYAATWIIHILYLASLVRRYSRLRNEIEELKRK*
Ga0066700_1061391323300005559SoilMSYLYAAYAATWIIHITYLTIIVRRYARLQKEIEELRRK*
Ga0068855_10146870613300005563Corn RhizosphereTRRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKNTN*
Ga0066693_1022356013300005566SoilAYTATWVIHITYLAILVRRYKRLQSEIEELKKSKG*
Ga0066706_1037961333300005598SoilAAYAATWIIHISYLAFLLRRFTRLRNEIQELNQK*
Ga0068863_10039531623300005841Switchgrass RhizosphereMNFLYTAYAAVWIVHVAYAFTLMRRYSRLSREIEDLKKK*
Ga0068863_10176357823300005841Switchgrass RhizosphereLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK*
Ga0068863_10243636123300005841Switchgrass RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKIK*
Ga0070766_1080357123300005921SoilMNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEELKKK*
Ga0070766_1095483823300005921SoilMTFLYAAYAATWIIHITYLSTLVRRYKRLQREIEELQK*
Ga0080026_1005939623300005952Permafrost SoilMNFLYAAYAATWIIHITYLGTLVRRYQRLSHEIEELKKK*
Ga0081540_111513733300005983Tabebuia Heterophylla RhizosphereMNFLYIAYAAVWIIHVLYLVTLVRRYSRLRKEINELKSK*
Ga0066696_1032562323300006032SoilMTYLYAAYAATWIIHITYLGILARRYARLKKDIESLQKK*
Ga0075023_10003502923300006041WatershedsMNFLYAAYAATWIIHIAYLGILVRRYQRVSREIDELKKK*
Ga0075023_10021931723300006041WatershedsMNYLYAAYSATWIIHITYLGVLVLRYRRLQREIENLRKGNPALGN*
Ga0066652_10026794033300006046SoilMNLLYAAYAATWIIHISYLATLLLRYRRLRKQIEELRRSQ*
Ga0066652_10069570223300006046SoilMNFLYAAYTATWIIHIAYLGILVRRYQCLRNEIEELKTKKST*
Ga0066652_10105869923300006046SoilMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELSQK*
Ga0075024_10017229723300006047WatershedsMNFLYAAYTATWIIHISYLSVLVLRYRRLQREIENLRKGNPALGN*
Ga0075028_10008701223300006050WatershedsMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDEMKKVGGSN*
Ga0075028_10066755623300006050WatershedsMNFLYAAYAATWIIHIACLGILVRRYQRVSREIDELKKK*
Ga0075028_10067749413300006050WatershedsMIYLYAAYAATWIIHITYLGILARRYSRLRKEIQELKK*
Ga0075029_10001302833300006052WatershedsMNFLYAAYAATWIIHIAYLASVVNRYGRLKKELNNLKGK*
Ga0075029_10027420023300006052WatershedsMNFLDAAYTATWIIHITYLAVLVRRYQRLRSEIEELKKK*
Ga0075029_10057731123300006052WatershedsMTYLHAAYAATWIIHVAYLGWLARRYSRLRREIDELKKK*
Ga0075029_10096869223300006052WatershedsMNFLYAAYTATWIIHITYLGTLVRRYQRLSREIEELKKK*
Ga0075017_10014657923300006059WatershedsMNFLYAAYTATWIIHIAYLGILVQRYKRLQRGIEELRKTKPGA*
Ga0070715_1069109723300006163Corn, Switchgrass And Miscanthus RhizosphereRTPELSMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK*
Ga0070716_10002841543300006173Corn, Switchgrass And Miscanthus RhizosphereMSYLYAAFAATWIIHIVYLATLVRRYAQLRKEIEELKRK*
Ga0070716_10029889513300006173Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKTS*
Ga0070716_10149953413300006173Corn, Switchgrass And Miscanthus RhizosphereMTYLYAAYAATWIIHVVYLGSLVTRYIRLRQEMSE
Ga0075014_10028282823300006174WatershedsMNFLYAAYAATWIIHISYLGILARRYKRLQREIEELQKR*
Ga0070712_10184105713300006175Corn, Switchgrass And Miscanthus RhizosphereMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEELQK*
Ga0070765_10029313023300006176SoilMNFLYAAYTATWIIHITYLVILARRYKRLRSEIEQLKKK*
Ga0070765_10038240623300006176SoilMNFLYAAYTATWIIHITYLGTLVRRYHRLSGEIEELKKK*
Ga0097621_10101784423300006237Miscanthus RhizosphereSETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR*
Ga0075021_1021726123300006354WatershedsMNFLYAAYTATWVIHIAYLSILVQRYRRLQREMEELKKK*
Ga0075021_1046275213300006354WatershedsMNYLYAAYSATWIIHITYLGVLVLRYRRLQREIENLRKGNP
Ga0068871_10212523323300006358Miscanthus RhizosphereLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK*
Ga0079222_1057329513300006755Agricultural SoilMNFLYAAYTATWVIHIVYLGILVRRYSRLRKEVDELNKK*
Ga0079222_1111867923300006755Agricultural SoilMNFLYAAYTATWVIHIFYLGILVRRYQRLRREIESLNLKR*
Ga0079222_1194956323300006755Agricultural SoilMNFLYAAYASTWIIHISYLAILLRRYIRLRNQIQELNQK*
Ga0066653_1078809823300006791SoilMKFLYAAYAATWIIHISYLAFLLRRYTPLRNEIQELNQR*
Ga0066660_1067505213300006800SoilMKFLYAAYTATWIIHISYLAVVLRRYIRLRNKIQELNQK*
Ga0066660_1159306423300006800SoilARCAMNFLYAAYAATWLIHIGYLATIATRAMRLRREIDDLNRRSS*
Ga0079221_1155668023300006804Agricultural SoilMNFLYAAYTATWLIHITYLSVLVRRYKRLQREIEELKGQTVRR*
Ga0075433_1000011233300006852Populus RhizosphereMNFLYAAYAATWIIHICYLVILLVGYRRVRKQIEELRRGQ*
Ga0075425_10089282513300006854Populus RhizosphereEHAMKFLYAAYAATWIIHILYLAALVRRYASLRREIDELKRK*
Ga0075434_10145661023300006871Populus RhizosphereMSFLYAAYTATWIIHISYLAALVLRYRRLQKQIEELCKGR*
Ga0075435_10036992923300007076Populus RhizosphereMKFLYAAYAATWIIHILYLAALVRRYASLRREIDELKRK*
Ga0075435_10158072123300007076Populus RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRLRNEIEEIKTKKSN*
Ga0099793_1061028523300007258Vadose Zone SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKK*
Ga0099794_1010186213300007265Vadose Zone SoilMKFLYAAYTATWIIHLSYLAFVLRRYIRLRNKIQELNQK*
Ga0099795_1025934223300007788Vadose Zone SoilMNFLYAAYAATWIIHIVYLGTRVRRYQRLSREIDELKKK*
Ga0066710_10171508223300009012Grasslands SoilMNFLYAAYTATWVIHITYLAILVRRYKRLQSEIEELKKSKG
Ga0066710_10426977913300009012Grasslands SoilMNFLYAAYTATWLIHIGYLGILVRRYKRLQKAIQDVDRK
Ga0099829_1000189333300009038Vadose Zone SoilMNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGN*
Ga0099829_1000465823300009038Vadose Zone SoilMNFLYAAYTATWIIHITYLGILVRRYQRLRNEIEEMKKAEGGN*
Ga0099829_1009229423300009038Vadose Zone SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLSRQIDELKKK*
Ga0099829_1026162523300009038Vadose Zone SoilMTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK*
Ga0099829_1115459823300009038Vadose Zone SoilMNFLYAAYAATWIIHITYLGILARRYTRLRSEIEELKKK*
Ga0099829_1136944523300009038Vadose Zone SoilFLYAAYTATWVIHITYLGILVRRFQRLQHEIEALKKTGSST*
Ga0099830_1099199423300009088Vadose Zone SoilMNFLYAAYTATWIIHITYLGTLVRRYQRLSREIAELKKK*
Ga0099828_10001072173300009089Vadose Zone SoilMNFLNAAYAATWIIHITYLGILVRRYQRLRSEIDELKKGKLA*
Ga0099828_1000530723300009089Vadose Zone SoilMNFLYAAYAATWIIHITYLGILVRRYTRLRSEIEELKKR*
Ga0099828_1046356713300009089Vadose Zone SoilGFAMTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK*
Ga0099827_1025226023300009090Vadose Zone SoilMNLLYAAYAATWIIHIAYLGTLVRRYQRLSREIDELRKK*
Ga0105245_1090345713300009098Miscanthus RhizosphereTRRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKIK*
Ga0105245_1154615313300009098Miscanthus RhizosphereMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDE
Ga0105245_1242121813300009098Miscanthus RhizosphereTRRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKTN*
Ga0066709_10001375053300009137Grasslands SoilMKSLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR*
Ga0066709_10449892123300009137Grasslands SoilMNFLYAAYVATWIIHISYLTTLFLRYRRLRKQIEELQRSQ*
Ga0105242_1168559223300009176Miscanthus RhizosphereMNFLYAAYTATWIIHITYLGILVQRYRRLRAEIEELQKKRTSA*
Ga0105248_1013794423300009177Switchgrass RhizosphereMNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELKRN*
Ga0116214_130084123300009520Peatlands SoilMSYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK*
Ga0105249_1035880013300009553Switchgrass RhizosphereTYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR*
Ga0126384_1149912913300010046Tropical Forest SoilMNFLYTAYAAVWIIHVAYAFTLVRRYSRLSRDIEELKKK*
Ga0126384_1180099313300010046Tropical Forest SoilMTYLYAAYAATWIIHIAYLSTLVRRYSRLKREIEELKKR*
Ga0126373_10000039133300010048Tropical Forest SoilMKFLYAAYAATWLIHITYLLTVARRYARLKREIQDLKRDLR*
Ga0126373_1094464923300010048Tropical Forest SoilMKFLYAAYAATWIIHITYLVSVVRRYARLKREIEELKQK*
Ga0126373_1150052513300010048Tropical Forest SoilMTYLYAAYAATWIIHISYLGWMAMRYGRLKSEIQELRKER*
Ga0134080_1053590223300010333Grasslands SoilMKFLYSAYTATWIIHISYLAFVLRRYIRLRNKIQELSQK*
Ga0126370_1180490013300010358Tropical Forest SoilMNFLYAAYVATWAIHIGYLITLVRRYGRVKREIAQLKK*
Ga0134128_1101855823300010373Terrestrial SoilMNYLYTAYAAVWIIHIVYLSSVARRYSRLRDEIKNLGKK*
Ga0126381_10120143023300010376Tropical Forest SoilMNFLYAAYAATWIIHVGYLATLLRRYSRLKREIQELKK*
Ga0136449_10092504033300010379Peatlands SoilMNATRYLYAAYAATWIIHIAYLWTVARRYQRLRETIDKLKRK*
Ga0134124_1043590023300010397Terrestrial SoilMNFLYAAYGVTWLIHIGYLTTLLRRYSRLKKEIAELKK*
Ga0105246_1004558833300011119Miscanthus RhizosphereMNFLYAAYAATWIIHIVYRGTLVRRYQRLSKEIAELKK*
Ga0150983_1112996023300011120Forest SoilMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEALQK*
Ga0137392_1009178433300011269Vadose Zone SoilMNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGT*
Ga0137392_1010992123300011269Vadose Zone SoilMNFLYAAYTATWIIHITYLGILVSRYRRLRNEIEEMKKAEGGN*
Ga0137463_110313223300011444SoilMNFLYAAYTATWIIHIAYLGILVRRYQRLSKEIAELKK*
Ga0120114_110742913300011998PermafrostMSFLYAAYAATWIIHISYLAFLLRRYTRLRNEIKELNQK*
Ga0137389_1045575523300012096Vadose Zone SoilMNFLYAAYTATWIIHITYLGNLVRRYHRLSREIEELKKK*
Ga0137388_1013599823300012189Vadose Zone SoilMNFLYAAYTATWIIHITYLGILVRRYQRLRNEIEEMKNAEGGN*
Ga0137365_1088068423300012201Vadose Zone SoilMKFLYAAYAATWIIHISYLAIILRRYGRLRNQIQELNQK*
Ga0137363_1007083433300012202Vadose Zone SoilMNYLYAAYSATWIIHITYLSILVQRYRRVQREIEELKKGKPALGN*
Ga0137376_1053594923300012208Vadose Zone SoilMKFLYAAYAATWIIHISYLTFLLRRYTHLKREIQELNQK*
Ga0137379_1054826223300012209Vadose Zone SoilMNFLYAAYTATWVIHITYLGILLRRYQRLQREMEALKKAGSST*
Ga0137379_1135885913300012209Vadose Zone SoilMKFLYAAYAATWIIHISYLTFLLRRFTRLRNEIQELNQK*
Ga0137378_1024697913300012210Vadose Zone SoilTYLYAAYTATWVIHIAYVGLLVSRYSKLRRDIRELNERK*
Ga0137370_1054618323300012285Vadose Zone SoilMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNRK
Ga0137385_1048743523300012359Vadose Zone SoilMKFLYAAYTDTWIIHISYLAFVLRRYIRLRNKIQELNQK*
Ga0137385_1152945813300012359Vadose Zone SoilMNFLYAAYTATWVIHITYLGILLRRYQRLQREMEALKKA*
Ga0137360_1005453213300012361Vadose Zone SoilARSPEPTMNFLYAAYAATWIIHIVYLGTLVRRYQHLSREIDELKKK*
Ga0137360_1066585623300012361Vadose Zone SoilMNFLYAAYTATWVIHITYLGILVRRYQRLQHEIEALKKAGSST*
Ga0137360_1134587313300012361Vadose Zone SoilMNFLYAAYAATWIIHIAYLGTLVRRYQRLSREIDELKKREAG
Ga0137361_1041242623300012362Vadose Zone SoilMKFLYAAYVATWIIHISYLAYLLRRYARLRNEIQELNHK*
Ga0137361_1104047313300012362Vadose Zone SoilPTMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKK*
Ga0137390_1017438413300012363Vadose Zone SoilMNGYLLAAYAATWIIHITYLGILARRYTRLRSEIEELKKK*
Ga0137390_1062131213300012363Vadose Zone SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKQ*
Ga0137395_1081092823300012917Vadose Zone SoilGHAVKFLYAAYAATWIIHILYLGSLVRRYATLRREIEELNRK*
Ga0137394_1027094013300012922Vadose Zone SoilLSEGAMNFLYAAYAATWIIHISYLVSLFRRYTRLRNEIQQLNQK*
Ga0137413_1020967833300012924Vadose Zone SoilMNYLYTAYAATWIIHIVYLGSLVRRYSRLRKEIDELKRSK*
Ga0137404_1045619923300012929Vadose Zone SoilMNFLYAAYTATWIIHITYLGILVRRYQRLSKEIAELKK*
Ga0137404_1080383113300012929Vadose Zone SoilMNFLYAAYTATWVIHIIYLGILVRRYQRLQREIESLNLKR*
Ga0137407_1004581033300012930Vadose Zone SoilMNFLYAAYAATWIIHITYLGILVLRYQRLKVEIEELKK*
Ga0137407_1233141313300012930Vadose Zone SoilMNFLYAAYTATWVIHITYLGILVRRYQRLRREIEILNLKR*
Ga0137410_1033305933300012944Vadose Zone SoilMNFLYAAYAATWIIHITYLGILVRRYQRVSREIDELKKR*
Ga0137410_1065930023300012944Vadose Zone SoilMNFLYAAYAATWIIHIVYLSILASKYSRLRKEIDELNKK*
Ga0137410_1143012823300012944Vadose Zone SoilMNFLYAAYTATWVIHITYLGILVRRYQRLQHEIEVLKKAGSST*
Ga0137410_1163781923300012944Vadose Zone SoilMNYLYTAYAATWIIHIIYLGSLVRRYARLRKEIDELNKK*
Ga0164298_1058665413300012955SoilMNFLYAAYTATWIIHITYLGILVQRYRRLRAEIDELQKKN*
Ga0164301_1107183623300012960SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEVAELKK*
Ga0164301_1169471313300012960SoilMTFLYAAYAATWVIHISYLAFVLRRYIRLRSEIKELNQK*
Ga0153916_1061517423300012964Freshwater WetlandsMKFMYAAYIATWVVHIVYLGILTRGYRRLRAEVEESRKQ*
Ga0164304_1032397723300012986SoilNFLYAAYTATWIIHITYLGILVQRYRRLRAEIDELQKKN*
Ga0164307_1024767623300012987SoilMNFLYAGYAATWIIHIVYLGTLVRRYQRLSKEIAELKK*
Ga0157378_1044084013300013297Miscanthus RhizosphereMNFLYAAYTATWLIHITYLSVLVRRYKRLQGEIEELKGQTVRR*
Ga0120123_112646513300013770PermafrostMNFLYAAYTATWIIHITYLGILVRRYQRLNKEIEELRKK*
Ga0134079_1012643723300014166Grasslands SoilMKFLYAAYTTTWIIHISYLAFVLRRYIRLRNKIQELSQK*
Ga0182019_1008289833300014498FenMNFLYAAYAATWIIHLVYVVTLVRRYGRVKSDLDELKRK*
Ga0182021_1119327723300014502FenMNYLYAAYAATWTIHIIYLGTLALRYSRLRKEIEELSKK*
Ga0137411_135531823300015052Vadose Zone SoilMNFLYAAYAATWIIHITYLGILVRRYQRLRSEIDELKKGSWHKH*
Ga0167668_107085123300015193Glacier Forefield SoilMNFLYAAYAATWIIHIAYLSTLVRRYRRLQKDIEAVNKM*
Ga0137418_1093797613300015241Vadose Zone SoilGSPARLRGCAMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNQK*
Ga0137403_1037814623300015264Vadose Zone SoilMNFLYAAYTATWIIHIAYLGILVRRYQRLRNEIEELKTKKST*
Ga0134089_1048862513300015358Grasslands SoilSECKMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK*
Ga0132258_1022452733300015371Arabidopsis RhizosphereMNFLYIAYAAVWIVHVAYAFTLMRRYSRLSREIEDLKKK*
Ga0182033_1114850223300016319SoilAKECGAMNYLYAAYTATWVIHITYLATLVRRYSKLRREIAELKKD
Ga0187802_1032588123300017822Freshwater SedimentMSYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK
Ga0187818_1001927033300017823Freshwater SedimentMNYLYAAYAATWIIHISYLGVLVRRYTRLRHEIEELKKQ
Ga0187818_1038581023300017823Freshwater SedimentMTYLYAAYAATWIIHIAYLGTLVRRYTRLRNEIEELKRK
Ga0187824_1000005773300017927Freshwater SedimentMNFLYAAYAATWIIHITYLGILVRRYQRLNKEIEELRKR
Ga0187825_1000174733300017930Freshwater SedimentMNFLYAAYAATWIIHITYLGILVRRYQRLNKEIEELRKK
Ga0187825_1005656333300017930Freshwater SedimentMNFLYAAYAATWIIHITYLSILVRRYKRLQREIEELKKK
Ga0187814_1019815013300017932Freshwater SedimentMKFLYAAYAATWIIHITYLTTVVRRYARLKREIEDLGGK
Ga0187801_1007037033300017933Freshwater SedimentMSYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKR
Ga0187821_1003634633300017936Freshwater SedimentMNFLYAAYAATWIIHITYLSILVRRYKRLQREIEEL
Ga0187775_1009973523300017939Tropical PeatlandMNYLYAAYAATWIVHITYLSIVSRRYARLRKELEELKKS
Ga0187775_1040016423300017939Tropical PeatlandMKYLYAAYAATWIIHIIYLTTVVRRYARLKREIEDLGGK
Ga0187785_1027793123300017947Tropical PeatlandMNFLYAAYTATWIIHIAYLGILVQRYRKLRSEIEELKRGGS
Ga0187847_1016418533300017948PeatlandMNYLYAAYAATWIIHIGYLTILARRYARLRKEIDDLKKSPM
Ga0187847_1073415023300017948PeatlandMNYLYAAYAATWIIHVGYLTILARKYSRLRKEIDELEKK
Ga0187779_10000059223300017959Tropical PeatlandMKFLYAAYAATWIIHIMYLTTVVRRYARLKREIEDLGGK
Ga0187779_1001466153300017959Tropical PeatlandMSYLYAAYVITWLIHIGYLGTLVRRYSRLRNEMEELKRQQ
Ga0187778_1048715013300017961Tropical PeatlandMKFLYAAYAATWIIHITYLTTLVRRYARLKREVGNLEGSRG
Ga0187778_1048849423300017961Tropical PeatlandMNGYLYSAYAATWIIHIFYLGVLVRRYSRLRREIEELKRK
Ga0187776_1006965623300017966Tropical PeatlandMTFLYAAYAAVWIIHLVYVANLVRRYTRLRKEIEEIGK
Ga0187776_1038548123300017966Tropical PeatlandMNAIKFLYAAYAATWIIHILYLGSLVRRYSRLRRELDELKK
Ga0187776_1130378813300017966Tropical PeatlandTMKYLYAAYAATWIIHIIYLTTVVRRYARLKREIADLGKK
Ga0187781_1004867533300017972Tropical PeatlandMSYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRKK
Ga0187781_1041360813300017972Tropical PeatlandRHDGIWSLAMSYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKK
Ga0187777_1099841613300017974Tropical PeatlandMNFLYAAYTATWLIHITYLVTLVRRYQRLQKEIEEL
Ga0187782_1015009523300017975Tropical PeatlandMSYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKK
Ga0187805_1003890223300018007Freshwater SedimentMTYLYAAYAATWIIHVAYLGWLARGYVRLRQEVDDLKKK
Ga0187805_1003932033300018007Freshwater SedimentMTYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK
Ga0184605_1027468323300018027Groundwater SedimentMKFLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR
Ga0187766_1081007523300018058Tropical PeatlandMNFLYAAYSATWIIHITYLVSLFRRYKRLRKEIEELNK
Ga0187765_1103205123300018060Tropical PeatlandMNFLYAAYSATWIIHITYLASLFRRYKRLRKEIEELNK
Ga0187784_1053148023300018062Tropical PeatlandMNYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRKK
Ga0187773_1071319123300018064Tropical PeatlandMNPYLYAAYAATWIIHVFYLGILVRRYTRLRNEIEELKRK
Ga0187772_1009104713300018085Tropical PeatlandMNAYLYSAYAATWIIHIFYLSVLVRRYSRLRREIDELKRK
Ga0187769_1007956843300018086Tropical PeatlandMTYLYAAYAATWVIHIAYLGSLVRRYTRLRKEIEELAKK
Ga0187769_1009684533300018086Tropical PeatlandMSYLFAAYAATWIIHIAYLGWLARRYARLRREIDELRKK
Ga0187769_1010776533300018086Tropical PeatlandGSPRRAMSYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRKK
Ga0187771_1005640323300018088Tropical PeatlandMNYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKK
Ga0187771_1045685123300018088Tropical PeatlandMNAIKFLYAAYAATWIIHSLYLGSLVHRYRRLRRELEDLKK
Ga0187771_1096789423300018088Tropical PeatlandMNYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKR
Ga0187770_1040740823300018090Tropical PeatlandMSYLFAAYAATWIIHIAYLGWLARRYARLRREIDELKKK
Ga0066655_1069198723300018431Grasslands SoilMNFLYAAYAATWIIHIVYLSSLAMKYRRLEHEIEELRRKQ
Ga0066655_1111781923300018431Grasslands SoilMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELTRK
Ga0066667_1000945823300018433Grasslands SoilMNFLYAAYAATWIIHISYLATLLLRYRRLRKQIEELRRSQ
Ga0066662_1000280443300018468Grasslands SoilVKFLYAAYAATWIIHILYLGSLVRRYATLRREIDELNRK
Ga0066662_1030479133300018468Grasslands SoilMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNQK
Ga0066669_1084372913300018482Grasslands SoilMNFLYIAYAATWLIHITYLGVLVRRYQRLRHEIDELKRSKS
Ga0066669_1214897323300018482Grasslands SoilMNFLYAAYTATWIIHIAYLGILVRRYQCLRNEIEELKTKKST
Ga0187797_161988213300019284PeatlandGSPRRAMSYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRRK
Ga0182022_136143823300019785FenMNYLYAAYAATWTIHIIYLGTLALRYSRLRKEIEELSKK
Ga0137408_108069023300019789Vadose Zone SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKK
Ga0193746_102164923300019870SoilMNFLYIAYAATWLIHITYLGVLVRRYQHLRHEIEELKRSKS
Ga0193722_112108423300019877SoilMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK
Ga0193723_105628223300019879SoilMNFLYAAYTATWIIHIAYLGILVRRYQRLRNEIGAIAAAC
Ga0193707_1000082223300019881SoilMNFLYAAYSATWIIHIIYLVILVRRYHSLRNEIDELKKGKPTPGH
Ga0193707_105734223300019881SoilMSFLYAAYAATWVIHVIYLGSLVRRYVRLRKDVEELRRK
Ga0193707_107584223300019881SoilMKFLYAAYAATWIIHIGYLAYLLRRYTRLRNEILKLNQK
Ga0193713_120510013300019882SoilMNFLYAAYTATWIIHIAYLGILVRRYQRLRNEIEELKTKKST
Ga0193747_100562653300019885SoilMNFLYAAYSATWIIHITYLVILVRRYHNLRSEIDELKKGEPAPGH
Ga0193751_105957823300019888SoilMSFLYAAYAATWIIHISYLAYLLRRYARLRHEIQKLNQK
Ga0193755_108387323300020004SoilMNFLYAAYTATWLIHIGYLGILVRRYKRLQKAIQDLDRK
Ga0193726_117663523300020021SoilMNPYLCAAYVATWMIHITYLGILARRYWRLQREIEQLKPPPPNSIP
Ga0179590_118172223300020140Vadose Zone SoilMNFLYAAYAATWIIHIVYLGTLVRRYQHLSREIDELKKK
Ga0179594_1015950623300020170Vadose Zone SoilMNYLYTAYAATWIIHIVYLGSLVRRYSRLRKEIDELNKK
Ga0210407_1014200423300020579SoilMNFLYAAYTATWIIHITYLGTLVRRYHRLSGEIEELKKK
Ga0210407_1030472223300020579SoilMNFLYAAYTATWVIHIAYLSILVQRYRHLQREIEDLKKKPGLGS
Ga0210403_1025604223300020580SoilMTYLYAAYAATWIIHIAYLGWLARRYSRLRQEIDELNKK
Ga0210403_1102788723300020580SoilMNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEELKKK
Ga0210403_1106487523300020580SoilMNYLYTAYTVTWLIHITYLATLVRRYSKLRREIAELKKD
Ga0210399_1103202223300020581SoilMTYLYAAYAATWIIHIAYLATLLSRYTRLRDEMQDLKNTPAK
Ga0210399_1113803223300020581SoilMNFLYAAYTATWVIHIVYLGTLLQRYRHLRSEIEELKRK
Ga0210401_1061442613300020583SoilMNFLYAAYTATWIIHITYLVILARRYKRLRSEIEQPKKK
Ga0210401_1087910913300020583SoilMNFLYAAYAATWIIHVGYLTTLVRRYSRLKREIEELKKK
Ga0210404_1085493513300021088SoilMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEAL
Ga0210406_1000533563300021168SoilMNYLYAAYTATWVIHIAYLTTLVRRYSRLRREIAELKKD
Ga0210406_1060666113300021168SoilMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEALHK
Ga0210400_1018613433300021170SoilMTFLYAAYAATWIIHITYLSTLVRRYKRLQREIEALQK
Ga0210400_1102781013300021170SoilMNFLYAAYTATWIIHLTYLGTLVRRYHRLSREIEELKKK
Ga0193719_1008065323300021344SoilMKFLYAAYAATWIIHIGYLAYLLRRYTRLRNEIQKLNQK
Ga0193719_1032850023300021344SoilMNFLYAAYTATWIIHIAYLGILVRRYQRLWNEIEELKTKKST
Ga0213873_1010939513300021358RhizosphereMIYLYAAYAATWTIHITYLAWVLLRYRRLRREIYELRKAAR
Ga0213882_1004334733300021362Exposed RockMIYLYAAYAATWTIHITYLAWVLLRYRRLRREIYELRKAVR
Ga0213874_1013544923300021377Plant RootsMTYLYAAYAATWIIHLGYLAWLGSRYARLRKEIEELKR
Ga0210397_1024153323300021403SoilMNFLYAAYTATWIIHITYLVILARRYKRLRSEIEQLKKK
Ga0210394_10001085143300021420SoilMTYLYAAYAATWIIHIAYLATLLSRYTRLRNEIRDLKSAREN
Ga0210384_1000736523300021432SoilMTFLYAAYAATWIIHITYLSTLVRRYKRLQREIEELQK
Ga0210384_1106190213300021432SoilARTPEPTMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKR
Ga0210402_1056633313300021478SoilMNFLYAAYTATWIIHITYLGILARRYQRLRREVEQLKRSSN
Ga0210410_1116739523300021479SoilTMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEALHK
Ga0210409_1051205923300021559SoilMNFLYAAYTATWIIHITYLGMLVRRYQRLKDDIEELKK
Ga0210409_1097763123300021559SoilVNFLYVAYTATWIIHIVYLGILVERYRRLRSEIEELQRK
Ga0210409_1134346813300021559SoilMNFLYAAYAATWIIHVGYLTTLVRRYSRLKREIEDLKKK
Ga0126371_1006048323300021560Tropical Forest SoilMKFLYAAYAATWLIHITYLLTVARRYARLKREIQDLKRDLR
Ga0126371_1006136923300021560Tropical Forest SoilMKFLYAAYAATWLIHIAYLVTVARRYARLKREIQDLNRDLR
Ga0242660_105342023300022531SoilMNFLYAAYTATWIIHITYVVILARRYKRLRSEIDQLKKK
Ga0222622_1069333313300022756Groundwater SedimentMNFLYAAYTATWIIHIGYLAFLLRRYARLRNKIQELNQK
Ga0179589_1049652423300024288Vadose Zone SoilMNFLYAAYTATWIIHIAYLRILVRRYQRLRNEIEELQKAKPSTE
Ga0207696_108084923300025711Switchgrass RhizosphereMKSETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR
Ga0207642_1048192223300025899Miscanthus RhizosphereMNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELKRK
Ga0207642_1050210913300025899Miscanthus RhizosphereMNFLYAAYAATWIIHIVYLGTLVRRYQRLIKEIAELKK
Ga0207699_1021234413300025906Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYTATWLIHITYLSVLVRRYKRLQREIEDLKGQTV
Ga0207699_1118550713300025906Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDE
Ga0207684_1009185123300025910Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK
Ga0207707_1126293123300025912Corn RhizosphereMNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEVAELKK
Ga0207693_1094642813300025915Corn, Switchgrass And Miscanthus RhizosphereMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEELQK
Ga0207646_1045441123300025922Corn, Switchgrass And Miscanthus RhizosphereMTFLYAAYAATWLIHILYLGILVRRYSRLRNEIEQARK
Ga0207686_1124284213300025934Miscanthus RhizosphereMNFLYAAYTATWIIHITYLGILVQRYRRLRAEIEELQKKRTSA
Ga0207665_1010643123300025939Corn, Switchgrass And Miscanthus RhizosphereMSYLYAAYAATWIIHITYLTIIVRRYARLQKEIEELRRK
Ga0207665_1046462623300025939Corn, Switchgrass And Miscanthus RhizosphereMNFLYAAYAATWIIHISYLGTLVRRYQRLSREIDELRKK
Ga0207712_1035287233300025961Switchgrass RhizosphereETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR
Ga0207677_1072649713300026023Miscanthus RhizosphereNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK
Ga0207698_1169402523300026142Corn RhizosphereMNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELK
Ga0209871_105529623300026217Permafrost SoilMNFLYAAYAATWIIHITYLGTLVRRYQRLSHEIEELKKK
Ga0209235_115264023300026296Grasslands SoilMTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK
Ga0209238_107498333300026301Grasslands SoilMNFLYAAYTATWLIHIGYLGILVRRYKRLRKAIQDIDRK
Ga0209761_106586533300026313Grasslands SoilFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK
Ga0209761_110887633300026313Grasslands SoilKMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK
Ga0209268_118204723300026314SoilMNFLYAAYAATWIIHISYLATLLLRYRRLRKQIEELR
Ga0209154_100366173300026317SoilVKVLYAAYAATWIIHILYLGSLVRRYATLRREIDELNRK
Ga0209803_124503423300026332SoilMKFLYAAYAATWIIHISYLAFLLRRFTRLRNEIQELNQK
Ga0257180_104865813300026354SoilMNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGT
Ga0257180_105338923300026354SoilMNFLYAAYTATWIIHITYLGILVRRYQRLRNEIEEMKKAEGGN
Ga0179593_116515833300026555Vadose Zone SoilMNFLYAAYAATWVIHVGYLTTLLRRYSRLKREIEELKKK
Ga0209219_101388923300027565Forest SoilMNFLYAAYTATWIIHITYLGILVRRYQRLRSEIEELKKK
Ga0209009_101418523300027667Forest SoilMNFLYTAYTATWIIHITYLGILVRRYKRLRSEIDQLKKK
Ga0207826_121341013300027680Tropical Forest SoilMNYLYAAYAATWIIHISYLATLVVRYNKLKREIADLKVK
Ga0209447_1016655413300027701Bog Forest SoilMNFLYTAYAAVWIIHLGYLGTLVRRYKRVRREIAEMNRK
Ga0209581_10000048843300027706Surface SoilMNFLYAAYAATWAIHIAYLVTLGLRYARLKREIEDMGRKGR
Ga0209811_1000776333300027821Surface SoilMNFLYAAYAATWIIHIAYLATLVSRYSRLKREIEELKK
Ga0209180_1009560623300027846Vadose Zone SoilMNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGN
Ga0209701_1002019933300027862Vadose Zone SoilMNFLYAAYAATWIIHITYLGILVRRYTRLRSEIEELKKR
Ga0209701_1006129843300027862Vadose Zone SoilMKFLYAAYAATWIIHILYLAALVRRYASLRREIDELKRK
Ga0209701_1048939723300027862Vadose Zone SoilMNFLYAAYTATWIIHITYLGTLVRRYQRLSREIAELKKK
Ga0209579_1013063933300027869Surface SoilMNFLYAAYTATWIIHIAYLGTLVRRYQRLSREIVEMKKK
Ga0209579_1016495423300027869Surface SoilMNFLYTAYAATWIIHIAYLGTLVRRYQRLSREIEELKK
Ga0209579_1063621823300027869Surface SoilTGTAERPMTYLYAAYAATWIIHIFYLSTIVSRAKKVRKEAEELKRK
Ga0209590_1005632633300027882Vadose Zone SoilAMTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK
Ga0209068_1001440323300027894WatershedsMNYLYAAYSATWIIHITYLGVLVLRYRRLQREIENLRKGNPALGN
Ga0209068_1038303423300027894WatershedsMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDEMKKVGGSN
Ga0209068_1075834623300027894WatershedsMNFLYAAYTATWIIHITYLGTLVRRYQRLSREIEELKKK
Ga0209624_1049285623300027895Forest SoilMNFLYAAYATTWIIHVGYLTTLVRRYSRLKREIEDLKK
Ga0209698_1006774143300027911WatershedsMNFLDAAYTATWIIHITYLAVLVRRYQRLRSEIEELKKK
Ga0209069_1000827973300027915WatershedsMNFLYAAYAATWIIHIAYLGILVRRYQRVSREIDELKKK
Ga0209069_1047357523300027915WatershedsMNFLYAAYTATWIIHISYLSVLVLRYRRLQREIENLRKGNPALGN
Ga0209526_1000288953300028047Forest SoilMNFLYAAYTATWIIHITYLGILVQRYERLRSEIEELKKK
Ga0209526_1061363823300028047Forest SoilMNFLYAAYTATWIIHITYLGILVQRYARLRSEIEELKKK
Ga0268265_1065460223300028380Switchgrass RhizosphereIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR
Ga0268264_1251239513300028381Switchgrass RhizosphereRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKTN
Ga0137415_1056739823300028536Vadose Zone SoilSATWLIHIAYLVILVRRYQRLRKEIDEIRKEKGGA
Ga0307504_1008665133300028792SoilMNFLYAAYTATWIIHITYLGILVRRYTRLRSEIEELKKR
Ga0265338_1011321733300028800RhizosphereMNFLYAAYAATWIIHIGYLTTLVRRYSRLKREIDELKKK
Ga0222749_1050882513300029636SoilMNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEELKEK
Ga0311336_1113577223300029990FenMNYLYASYAATWTIHIIYLGTLALRYSRLRKEIEELSKK
Ga0073994_1179389823300030991SoilMNFLYAAYGATWVIHIVYLGSLLRRYLRLRKEMKELDDQMSGGD
Ga0308199_104765413300031094SoilFLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR
(restricted) Ga0255311_107307613300031150Sandy SoilMNFLYAAYTATWIIHITYLGILVRRYQRLNKEIEELKKK
(restricted) Ga0255312_120433213300031248Sandy SoilMNFLYAAYAATWIIHITYLGILVRRYQRMNKEIEELRKK
Ga0318560_1082132623300031682SoilECGAMNYLYAAYTATWVIHITYLATLVRRYSKLRREIAELKKD
Ga0310813_1108180113300031716SoilMNYLYAAYAATWIIHIAYLVILTRGYQNAKQDIEELNRESGQAQ
Ga0307469_1045115023300031720Hardwood Forest SoilMSYLYAAYAATWIIHITYLTIIVRRYGRLRKEIEELRRK
Ga0307469_1122525213300031720Hardwood Forest SoilMNFLYAAYSATWIIHIVYLGTLVRRYQRLSREIEELKKK
Ga0307468_10001666333300031740Hardwood Forest SoilMNFLYSAYAATWIIHISYLAFLLRRYIRLRNKIQEFNQK
Ga0307468_10034468913300031740Hardwood Forest SoilMNFLYAAYAATWIIHIAYLGILVRRYQRLRKEIDELKKSG
Ga0306919_1048429923300031879SoilMNYLYAAYTATWVIHITYLATLVRRYSKLRREIAELKKD
Ga0307479_1000623923300031962Hardwood Forest SoilMNFLYAAYTATWIIHIAYLSILVQRYRHLQREIEDLKKKPGLGA
Ga0307479_1105882713300031962Hardwood Forest SoilMTYLYAAYAATWIIHIAYLASLVRRYTRLRKEVEALRRK
Ga0307479_1127526123300031962Hardwood Forest SoilMNFLYAAYAATWMIHITYLGILVRRYQRLNKEIEELRKK
Ga0308176_1061630123300031996SoilMNFLYAAYAVTWIIHIGYLTTLVRRYSQLKREINELKRG
Ga0311301_1057156023300032160Peatlands SoilMNATRYLYAAYAATWIIHIAYLWTVARRYQRLRETIDKLKRK
Ga0315281_1007587333300032163SedimentMNFLDAAYIATWLIHIAYLTTLVGRFKKLRQEIGQLPRK
Ga0307471_10018984533300032180Hardwood Forest SoilMNFLYAAYTATWIIHIIYLGILVSRYRRLRNEIEELRKAEKNK
Ga0307471_10072860523300032180Hardwood Forest SoilMNGYLLAAYAATWIIHITYLGILVSRYRRLRNEIEDLKKAEGSK
Ga0307471_10102681323300032180Hardwood Forest SoilMKFPMSYLYAAYAATWIIHIAYLGTLVRRYTRLRNEITELRRN
Ga0307471_10104703723300032180Hardwood Forest SoilMNFLYAAYAATWIIHIAYLSILVQRYRHLQREIEDLKKKPAPGA
Ga0307471_10310181623300032180Hardwood Forest SoilMNFLYAAYTATWLIHIGYLGILVRRYKRLQKTIQDVDRK
Ga0307472_10046886723300032205Hardwood Forest SoilMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEGLQK
Ga0307472_10056739723300032205Hardwood Forest SoilMNFLYAAYTATWLIHIMYLGILVQRYRRLRSEIEELKRK
Ga0307472_10157825523300032205Hardwood Forest SoilMTYLYAAYAATWIIHIAYLGTLALRYSRLRKEIQELKK
Ga0306920_10041105733300032261SoilMSYLYAAYAATWIIHIFYLSTILTRAKRVRKEADELKRK
Ga0335085_10001693383300032770SoilMNFLYAAYAATWIIHIAYLGTLVRRYQRLSKEIAELKK
Ga0335085_1000797783300032770SoilMNFLYAAYAATWIIHIGYLTTLVRRYARLKKEVDEMRRPGRG
Ga0335085_1001556153300032770SoilMNFLYAAYTATWIIHITYLTILVRRYKRLRQKIEQLGKE
Ga0335085_1002416263300032770SoilMNYLYTAYAATWLIHLTYVGYLVRRYVRLRKEIDELGK
Ga0335085_1027813633300032770SoilMSFLHAAYAATWIIHITYLGILVRRYTRLRKKIQELGKN
Ga0335085_1203087823300032770SoilMSYLYAAYTATWIIHITYLTIVLRRYARLRRELEDLKK
Ga0335079_10000524313300032783SoilMTYLYAAYAATWIIHIAYLSTLALRYKRLRDQVRELKAHSDE
Ga0335079_10004189153300032783SoilMNFLYAAYAATWIIHITYLAILMRRYSRLRDEIEVLKKQK
Ga0335079_1001355933300032783SoilMNFLYAAYTATWLIHITYAVTLVRRYQRLRKEIEELKLNR
Ga0335079_1001848933300032783SoilMNYLFAAYAATWIIHVFYLTTLVRRYSRLRKEIEDLQRK
Ga0335079_1002393743300032783SoilMNFLYAAYAATWIIHITYLSILVRRYARLRKKIEELGR
Ga0335079_1003632433300032783SoilMNFLYAAYAATWLIHIGYLVTLARRYARLRGKIRELAKR
Ga0335079_1007782553300032783SoilMNFLYAAYTATWIIHITYLASLFRRYNRLRKEIEELKK
Ga0335079_1007985133300032783SoilMSYLYAAYAATWIIHIVYLASVVRRYGRLKKEMDDLKGK
Ga0335079_1032175233300032783SoilMTFLYAAYAAVWIIHLVYVVNLVRRYTRLRKEIEEIGK
Ga0335079_1045595413300032783SoilVNYLYAAYAVTWLIHISYLGTLVRRHNRLKREIAELKKD
Ga0335079_1060488233300032783SoilMTYLYAAYAATWIIHIAYLTLLARRYNRVRRELEELKKK
Ga0335079_1109699523300032783SoilMSYLYAAYAATWIIHLAYIGTLVRRYMRLRGELNQARSK
Ga0335078_10003603143300032805SoilMNFLYTAYAAAWIIHLVYVAHLVRRYVRLRKEIEELGK
Ga0335078_1043803233300032805SoilEEFSMNFLYAAYAATWIIHITYLSILVRRYARLRKKIEELGR
Ga0335078_1088245823300032805SoilMNYLYAAYAVTWLIHVTYLGTLVRRHNRLKREIAELKKD
Ga0335078_1105894433300032805SoilMNFLYAAYAATWIIHITYLSILVRRYARLRKKIEELG
Ga0335078_1118014723300032805SoilMNFLYAAYTATWIIHITYLASLFRRYKRLRKEIEELKK
Ga0335080_1000955843300032828SoilMNYLYTAYSATWIIHLVYVGYLVRRYMRLRKEIGELGK
Ga0335080_1014120733300032828SoilMKFLYAAYAATWIIHIAYLATIARRYTKLRDKMAELKKKA
Ga0335080_1085845823300032828SoilMNFLYTAYAAVWIIHLAYVGHLVRRYVRLRKEIDELGK
Ga0335070_10001967193300032829SoilMNYYLYAAYAATWIIHIAYLSIVSRRYSRLRKELQELKKS
Ga0335070_1000680093300032829SoilMNFLHAAYVATWIIHICYLGTLVRRYSRLRKDIQELNKK
Ga0335070_1018208533300032829SoilMIYFYAAYAATWIIHITYLSIVLRRYSRLRKELEELKKP
Ga0335070_1020998013300032829SoilMNFLYAAYAATWIIHIVYLGTLVRRYQRLNREIKELKKA
Ga0335070_1123891413300032829SoilMNYLYAAYAATWIIHIAYLGTIVQRYGRLKRELDELQRK
Ga0335070_1213276023300032829SoilYAAYAATWIIHIVYLGSVAMKYRKLQREIEELRRKQ
Ga0335081_10000914133300032892SoilMNFLYAAYTATWLIHITYAVTLVRRYQRLRKEIDELKDRQP
Ga0335069_1081710923300032893SoilMNFLYAAYAATWIIHILYLGTLVRRYQRLNREIKELKKAGGSN
Ga0335077_1063572413300033158SoilMNFLYAAYAATWIIHITYLTTLVRRYSRLRKEIDELGKK
Ga0335077_1135074323300033158SoilMNFLYAAYTATWLIHIAYLTTLVRRYKRLRKEIQELKKD
Ga0335077_1208823723300033158SoilMNYLYAAYAATWIIHIGYLTTLVRRYARLKKEIQELKGM
Ga0326726_1019747423300033433Peat SoilMNFLYAAYAATWIIHITYLTILVRRYSRLRKDIEELGKK
Ga0326726_1046885623300033433Peat SoilMNFLYAAYTATWIIHITYLGILVRRYRRLSKEIGELKKGR
Ga0326726_1100566223300033433Peat SoilMTYLYAAYAATWIIHVSYLSILVRRYTRLRREIDELKRK
Ga0326723_0142917_221_3463300034090Peat SoilMMNFLYAAYTATWIIHITYLGILVRRYRRLSKEIGELKKGR
Ga0326723_0578143_337_4593300034090Peat SoilMNFLYAAYTATWIIHITYLGILVRRYRRLSKEIEELKKGR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.