| Basic Information | |
|---|---|
| Family ID | F004811 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 423 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MNFLYAAYTATWIIHITYLGILVRRYQRLRSEIEELKKK |
| Number of Associated Samples | 270 |
| Number of Associated Scaffolds | 423 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.13 % |
| % of genes near scaffold ends (potentially truncated) | 17.02 % |
| % of genes from short scaffolds (< 2000 bps) | 76.12 % |
| Associated GOLD sequencing projects | 244 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.400 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.948 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.570 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.790 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 423 Family Scaffolds |
|---|---|---|
| PF01578 | Cytochrom_C_asm | 34.04 |
| PF07238 | PilZ | 31.44 |
| PF03379 | CcmB | 3.55 |
| PF00005 | ABC_tran | 2.60 |
| PF06739 | SBBP | 1.89 |
| PF03100 | CcmE | 0.95 |
| PF00069 | Pkinase | 0.71 |
| PF12969 | DUF3857 | 0.47 |
| PF00158 | Sigma54_activat | 0.47 |
| PF08308 | PEGA | 0.47 |
| PF00793 | DAHP_synth_1 | 0.47 |
| PF01979 | Amidohydro_1 | 0.47 |
| PF05193 | Peptidase_M16_C | 0.47 |
| PF01964 | ThiC_Rad_SAM | 0.47 |
| PF16889 | Hepar_II_III_N | 0.24 |
| PF05960 | DUF885 | 0.24 |
| PF00483 | NTP_transferase | 0.24 |
| PF12838 | Fer4_7 | 0.24 |
| PF05649 | Peptidase_M13_N | 0.24 |
| PF08241 | Methyltransf_11 | 0.24 |
| PF02518 | HATPase_c | 0.24 |
| PF07638 | Sigma70_ECF | 0.24 |
| PF10282 | Lactonase | 0.24 |
| PF02321 | OEP | 0.24 |
| PF13304 | AAA_21 | 0.24 |
| PF13460 | NAD_binding_10 | 0.24 |
| PF16640 | Big_3_5 | 0.24 |
| PF03941 | INCENP_ARK-bind | 0.24 |
| PF04389 | Peptidase_M28 | 0.24 |
| PF01740 | STAS | 0.24 |
| PF13620 | CarboxypepD_reg | 0.24 |
| PF02771 | Acyl-CoA_dh_N | 0.24 |
| PF03483 | B3_4 | 0.24 |
| PF03551 | PadR | 0.24 |
| PF13418 | Kelch_4 | 0.24 |
| PF02604 | PhdYeFM_antitox | 0.24 |
| PF00719 | Pyrophosphatase | 0.24 |
| PF08032 | SpoU_sub_bind | 0.24 |
| COG ID | Name | Functional Category | % Frequency in 423 Family Scaffolds |
|---|---|---|---|
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 3.55 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.84 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.47 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.24 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.24 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.24 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.24 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.24 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.24 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.24 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.24 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.24 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.24 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.24 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.40 % |
| Unclassified | root | N/A | 2.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig116576 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 837 | Open in IMG/M |
| 2162886011|MRS1b_contig_4018967 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300000559|F14TC_104944945 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300001356|JGI12269J14319_10012206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6776 | Open in IMG/M |
| 3300001545|JGI12630J15595_10004083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3172 | Open in IMG/M |
| 3300001593|JGI12635J15846_10696103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300001661|JGI12053J15887_10432599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300001867|JGI12627J18819_10004294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5349 | Open in IMG/M |
| 3300002908|JGI25382J43887_10436243 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300004063|Ga0055483_10302342 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300004080|Ga0062385_10809398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Peptococcaceae → Desulfosporosinus → Desulfosporosinus orientis | 614 | Open in IMG/M |
| 3300004092|Ga0062389_101560772 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300004152|Ga0062386_100127564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1972 | Open in IMG/M |
| 3300004156|Ga0062589_100172497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1519 | Open in IMG/M |
| 3300004157|Ga0062590_100043429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2423 | Open in IMG/M |
| 3300004479|Ga0062595_100078525 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300004479|Ga0062595_100182335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300004479|Ga0062595_101579059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300004633|Ga0066395_11007878 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300004635|Ga0062388_100001878 | All Organisms → cellular organisms → Bacteria | 9143 | Open in IMG/M |
| 3300005167|Ga0066672_10187743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1313 | Open in IMG/M |
| 3300005167|Ga0066672_10392711 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005167|Ga0066672_10994996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300005171|Ga0066677_10011409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3865 | Open in IMG/M |
| 3300005171|Ga0066677_10281394 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005175|Ga0066673_10002592 | All Organisms → cellular organisms → Bacteria | 6702 | Open in IMG/M |
| 3300005175|Ga0066673_10271691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 985 | Open in IMG/M |
| 3300005176|Ga0066679_10578429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300005180|Ga0066685_10118264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1783 | Open in IMG/M |
| 3300005332|Ga0066388_104454339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 713 | Open in IMG/M |
| 3300005338|Ga0068868_100473683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1093 | Open in IMG/M |
| 3300005367|Ga0070667_101738836 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005434|Ga0070709_10097979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1948 | Open in IMG/M |
| 3300005434|Ga0070709_10312963 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005434|Ga0070709_11206812 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005436|Ga0070713_100166738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1970 | Open in IMG/M |
| 3300005439|Ga0070711_101484563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005445|Ga0070708_100012992 | All Organisms → cellular organisms → Bacteria | 6803 | Open in IMG/M |
| 3300005445|Ga0070708_100164083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2071 | Open in IMG/M |
| 3300005445|Ga0070708_101039969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005446|Ga0066686_10181759 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300005526|Ga0073909_10716530 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005529|Ga0070741_10000295 | All Organisms → cellular organisms → Bacteria | 190401 | Open in IMG/M |
| 3300005529|Ga0070741_10000674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 117558 | Open in IMG/M |
| 3300005529|Ga0070741_10020077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10590 | Open in IMG/M |
| 3300005536|Ga0070697_100000470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 30775 | Open in IMG/M |
| 3300005536|Ga0070697_100075002 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
| 3300005536|Ga0070697_101172819 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005536|Ga0070697_101969587 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005536|Ga0070697_101979970 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300005538|Ga0070731_10110930 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300005538|Ga0070731_10225870 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300005538|Ga0070731_10930119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300005541|Ga0070733_10116959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1711 | Open in IMG/M |
| 3300005541|Ga0070733_10877294 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005547|Ga0070693_101312963 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005548|Ga0070665_100015701 | All Organisms → cellular organisms → Bacteria | 7607 | Open in IMG/M |
| 3300005548|Ga0070665_100122089 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300005554|Ga0066661_10824481 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005555|Ga0066692_10005079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5771 | Open in IMG/M |
| 3300005556|Ga0066707_10149129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1481 | Open in IMG/M |
| 3300005556|Ga0066707_10308992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1035 | Open in IMG/M |
| 3300005559|Ga0066700_10613913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 757 | Open in IMG/M |
| 3300005563|Ga0068855_101468706 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005566|Ga0066693_10223560 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005598|Ga0066706_10379613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300005841|Ga0068863_101763578 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300005841|Ga0068863_102436361 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005921|Ga0070766_10803571 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005921|Ga0070766_10954838 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300005952|Ga0080026_10059396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1014 | Open in IMG/M |
| 3300005983|Ga0081540_1115137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1127 | Open in IMG/M |
| 3300006032|Ga0066696_10325623 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300006041|Ga0075023_100035029 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300006041|Ga0075023_100219317 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300006046|Ga0066652_100267940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
| 3300006046|Ga0066652_100695702 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300006046|Ga0066652_101058699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300006047|Ga0075024_100172297 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300006050|Ga0075028_100087012 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300006050|Ga0075028_100667556 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006050|Ga0075028_100677494 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006052|Ga0075029_100013028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4599 | Open in IMG/M |
| 3300006052|Ga0075029_100274200 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300006052|Ga0075029_100577311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 749 | Open in IMG/M |
| 3300006052|Ga0075029_100968692 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006059|Ga0075017_100146579 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300006163|Ga0070715_10691097 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006173|Ga0070716_100028415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3013 | Open in IMG/M |
| 3300006173|Ga0070716_100298895 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300006173|Ga0070716_101499534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300006174|Ga0075014_100282828 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006175|Ga0070712_101841057 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006176|Ga0070765_100293130 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300006176|Ga0070765_100382406 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300006237|Ga0097621_101017844 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300006354|Ga0075021_10217261 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300006354|Ga0075021_10462752 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006358|Ga0068871_102125233 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006755|Ga0079222_10573295 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006755|Ga0079222_11118679 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300006755|Ga0079222_11949563 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006791|Ga0066653_10788098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300006800|Ga0066660_10675052 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300006800|Ga0066660_11593064 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006804|Ga0079221_11556680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300006852|Ga0075433_10000112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 40085 | Open in IMG/M |
| 3300006854|Ga0075425_100892825 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006871|Ga0075434_101456610 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300007076|Ga0075435_100369929 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300007076|Ga0075435_101580721 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300007258|Ga0099793_10610285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300007265|Ga0099794_10101862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| 3300007788|Ga0099795_10259342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300009012|Ga0066710_101715082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300009012|Ga0066710_104269779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300009038|Ga0099829_10001893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 11829 | Open in IMG/M |
| 3300009038|Ga0099829_10004658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 8212 | Open in IMG/M |
| 3300009038|Ga0099829_10092294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2341 | Open in IMG/M |
| 3300009038|Ga0099829_10261625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1413 | Open in IMG/M |
| 3300009038|Ga0099829_11154598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300009038|Ga0099829_11369445 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009088|Ga0099830_10991994 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009089|Ga0099828_10001072 | All Organisms → cellular organisms → Bacteria | 17766 | Open in IMG/M |
| 3300009089|Ga0099828_10005307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9215 | Open in IMG/M |
| 3300009089|Ga0099828_10463567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300009090|Ga0099827_10252260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300009098|Ga0105245_10903457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300009098|Ga0105245_11546153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300009098|Ga0105245_12421218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300009137|Ga0066709_100013750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7653 | Open in IMG/M |
| 3300009137|Ga0066709_104498921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300009176|Ga0105242_11685592 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009177|Ga0105248_10137944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2751 | Open in IMG/M |
| 3300009520|Ga0116214_1300841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300009553|Ga0105249_10358800 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300010046|Ga0126384_11800993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300010048|Ga0126373_10000039 | All Organisms → cellular organisms → Bacteria | 134948 | Open in IMG/M |
| 3300010048|Ga0126373_10944649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 927 | Open in IMG/M |
| 3300010048|Ga0126373_11500525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300010333|Ga0134080_10535902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300010358|Ga0126370_11804900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010373|Ga0134128_11018558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300010376|Ga0126381_101201430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300010379|Ga0136449_100925040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300010397|Ga0134124_10435900 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300011119|Ga0105246_10045588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2986 | Open in IMG/M |
| 3300011120|Ga0150983_11129960 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300011269|Ga0137392_10091784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2377 | Open in IMG/M |
| 3300011269|Ga0137392_10109921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2185 | Open in IMG/M |
| 3300011444|Ga0137463_1103132 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300011998|Ga0120114_1107429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012096|Ga0137389_10455755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300012189|Ga0137388_10135998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2159 | Open in IMG/M |
| 3300012201|Ga0137365_10880684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300012202|Ga0137363_10070834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2564 | Open in IMG/M |
| 3300012208|Ga0137376_10535949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300012209|Ga0137379_10548262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300012209|Ga0137379_11358859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012285|Ga0137370_10546183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300012359|Ga0137385_10487435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300012359|Ga0137385_11529458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300012361|Ga0137360_10054532 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300012361|Ga0137360_10665856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300012361|Ga0137360_11345873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300012362|Ga0137361_10412426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1241 | Open in IMG/M |
| 3300012362|Ga0137361_11040473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300012363|Ga0137390_10174384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2137 | Open in IMG/M |
| 3300012363|Ga0137390_10621312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300012917|Ga0137395_10810928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300012922|Ga0137394_10270940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
| 3300012924|Ga0137413_10209678 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300012929|Ga0137404_10456199 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300012929|Ga0137404_10803831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300012930|Ga0137407_10045810 | All Organisms → cellular organisms → Bacteria | 3523 | Open in IMG/M |
| 3300012930|Ga0137407_12331413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012944|Ga0137410_10333059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300012944|Ga0137410_10659300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 869 | Open in IMG/M |
| 3300012944|Ga0137410_11430128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300012944|Ga0137410_11637819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012955|Ga0164298_10586654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300012960|Ga0164301_11071836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300012960|Ga0164301_11694713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300012986|Ga0164304_10323977 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300012987|Ga0164307_10247676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300013297|Ga0157378_10440840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1291 | Open in IMG/M |
| 3300013770|Ga0120123_1126465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300014166|Ga0134079_10126437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1006 | Open in IMG/M |
| 3300014498|Ga0182019_10082898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300014502|Ga0182021_11193277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 917 | Open in IMG/M |
| 3300015052|Ga0137411_1355318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
| 3300015193|Ga0167668_1070851 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300015241|Ga0137418_10937976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300015264|Ga0137403_10378146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300015358|Ga0134089_10488625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300016319|Ga0182033_11148502 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017822|Ga0187802_10325881 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300017823|Ga0187818_10019270 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300017823|Ga0187818_10385810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300017927|Ga0187824_10000057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16304 | Open in IMG/M |
| 3300017930|Ga0187825_10001747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6676 | Open in IMG/M |
| 3300017930|Ga0187825_10056563 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300017932|Ga0187814_10198150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300017933|Ga0187801_10070370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1294 | Open in IMG/M |
| 3300017936|Ga0187821_10036346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1747 | Open in IMG/M |
| 3300017939|Ga0187775_10099735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300017939|Ga0187775_10400164 | Not Available | 567 | Open in IMG/M |
| 3300017947|Ga0187785_10277931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300017948|Ga0187847_10164185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1213 | Open in IMG/M |
| 3300017948|Ga0187847_10734150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300017959|Ga0187779_10000059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 80484 | Open in IMG/M |
| 3300017959|Ga0187779_10014661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4478 | Open in IMG/M |
| 3300017961|Ga0187778_10487150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300017961|Ga0187778_10488494 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300017966|Ga0187776_10069656 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300017966|Ga0187776_10385481 | Not Available | 934 | Open in IMG/M |
| 3300017966|Ga0187776_11303788 | Not Available | 549 | Open in IMG/M |
| 3300017972|Ga0187781_10048675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2917 | Open in IMG/M |
| 3300017972|Ga0187781_10413608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300017974|Ga0187777_10998416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300017975|Ga0187782_10150095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1733 | Open in IMG/M |
| 3300018007|Ga0187805_10038902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2130 | Open in IMG/M |
| 3300018007|Ga0187805_10039320 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300018027|Ga0184605_10274683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300018058|Ga0187766_10810075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300018060|Ga0187765_11032051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300018062|Ga0187784_10531480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 946 | Open in IMG/M |
| 3300018064|Ga0187773_10713191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300018085|Ga0187772_10091047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1950 | Open in IMG/M |
| 3300018086|Ga0187769_10079568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2326 | Open in IMG/M |
| 3300018086|Ga0187769_10096845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2115 | Open in IMG/M |
| 3300018086|Ga0187769_10107765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2008 | Open in IMG/M |
| 3300018088|Ga0187771_10056403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3074 | Open in IMG/M |
| 3300018088|Ga0187771_10456851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1079 | Open in IMG/M |
| 3300018088|Ga0187771_10967894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300018090|Ga0187770_10407408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300018431|Ga0066655_10691987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300018431|Ga0066655_11117819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300018433|Ga0066667_10009458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4590 | Open in IMG/M |
| 3300018468|Ga0066662_10002804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8265 | Open in IMG/M |
| 3300018468|Ga0066662_10304791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
| 3300018482|Ga0066669_10843729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300018482|Ga0066669_12148973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300019284|Ga0187797_1619882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300019785|Ga0182022_1361438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300019789|Ga0137408_1080690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1310 | Open in IMG/M |
| 3300019870|Ga0193746_1021649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 669 | Open in IMG/M |
| 3300019877|Ga0193722_1121084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300019879|Ga0193723_1056282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300019881|Ga0193707_1000082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24081 | Open in IMG/M |
| 3300019881|Ga0193707_1057342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300019881|Ga0193707_1075842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1038 | Open in IMG/M |
| 3300019882|Ga0193713_1205100 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300019885|Ga0193747_1005626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3037 | Open in IMG/M |
| 3300019888|Ga0193751_1059578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300020004|Ga0193755_1083873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300020021|Ga0193726_1176635 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300020140|Ga0179590_1181722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300020170|Ga0179594_10159506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300020579|Ga0210407_10142004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1847 | Open in IMG/M |
| 3300020579|Ga0210407_10304722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1244 | Open in IMG/M |
| 3300020580|Ga0210403_10256042 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300020580|Ga0210403_11027887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 644 | Open in IMG/M |
| 3300020580|Ga0210403_11064875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300020581|Ga0210399_11032022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300020581|Ga0210399_11138032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 623 | Open in IMG/M |
| 3300020583|Ga0210401_10614426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300020583|Ga0210401_10879109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300021088|Ga0210404_10854935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300021168|Ga0210406_10005335 | All Organisms → cellular organisms → Bacteria | 13509 | Open in IMG/M |
| 3300021168|Ga0210406_10606661 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300021170|Ga0210400_10186134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1684 | Open in IMG/M |
| 3300021170|Ga0210400_11027810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300021344|Ga0193719_10080653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1414 | Open in IMG/M |
| 3300021344|Ga0193719_10328500 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300021358|Ga0213873_10109395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300021362|Ga0213882_10043347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1766 | Open in IMG/M |
| 3300021377|Ga0213874_10135449 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300021403|Ga0210397_10241533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1307 | Open in IMG/M |
| 3300021420|Ga0210394_10001085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 46492 | Open in IMG/M |
| 3300021432|Ga0210384_10007365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 11613 | Open in IMG/M |
| 3300021432|Ga0210384_11061902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300021478|Ga0210402_10566333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300021479|Ga0210410_11167395 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300021559|Ga0210409_10512059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1064 | Open in IMG/M |
| 3300021559|Ga0210409_10977631 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300021559|Ga0210409_11343468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300021560|Ga0126371_10060483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3653 | Open in IMG/M |
| 3300021560|Ga0126371_10061369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3629 | Open in IMG/M |
| 3300022531|Ga0242660_1053420 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300022756|Ga0222622_10693333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300024288|Ga0179589_10496524 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300025711|Ga0207696_1080849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300025899|Ga0207642_10481922 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300025899|Ga0207642_10502109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300025906|Ga0207699_10212344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1317 | Open in IMG/M |
| 3300025906|Ga0207699_11185507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300025910|Ga0207684_10091851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2587 | Open in IMG/M |
| 3300025912|Ga0207707_11262931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300025915|Ga0207693_10946428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300025922|Ga0207646_10454411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1156 | Open in IMG/M |
| 3300025934|Ga0207686_11242842 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025939|Ga0207665_10106431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1965 | Open in IMG/M |
| 3300025939|Ga0207665_10464626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300025961|Ga0207712_10352872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300026023|Ga0207677_10726497 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300026142|Ga0207698_11694025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300026217|Ga0209871_1055296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 757 | Open in IMG/M |
| 3300026296|Ga0209235_1152640 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300026301|Ga0209238_1074983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1185 | Open in IMG/M |
| 3300026313|Ga0209761_1065865 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300026313|Ga0209761_1108876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
| 3300026314|Ga0209268_1182047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300026317|Ga0209154_1003661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8312 | Open in IMG/M |
| 3300026332|Ga0209803_1245034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300026354|Ga0257180_1048658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300026354|Ga0257180_1053389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300026555|Ga0179593_1165158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1981 | Open in IMG/M |
| 3300027565|Ga0209219_1013889 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
| 3300027667|Ga0209009_1014185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1903 | Open in IMG/M |
| 3300027680|Ga0207826_1213410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300027701|Ga0209447_10166554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300027706|Ga0209581_1000004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1127213 | Open in IMG/M |
| 3300027821|Ga0209811_10007763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3435 | Open in IMG/M |
| 3300027846|Ga0209180_10095606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1689 | Open in IMG/M |
| 3300027862|Ga0209701_10020199 | All Organisms → cellular organisms → Bacteria | 4342 | Open in IMG/M |
| 3300027862|Ga0209701_10061298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2396 | Open in IMG/M |
| 3300027862|Ga0209701_10489397 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300027869|Ga0209579_10130639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300027869|Ga0209579_10164954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1183 | Open in IMG/M |
| 3300027869|Ga0209579_10636218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300027882|Ga0209590_10056326 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
| 3300027894|Ga0209068_10014403 | All Organisms → cellular organisms → Bacteria | 3796 | Open in IMG/M |
| 3300027894|Ga0209068_10383034 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300027894|Ga0209068_10758346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300027895|Ga0209624_10492856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300027911|Ga0209698_10067741 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300027915|Ga0209069_10008279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5130 | Open in IMG/M |
| 3300027915|Ga0209069_10473575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300028047|Ga0209526_10002889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11641 | Open in IMG/M |
| 3300028047|Ga0209526_10613638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 695 | Open in IMG/M |
| 3300028380|Ga0268265_10654602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300028381|Ga0268264_12512395 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300028536|Ga0137415_10567398 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300028792|Ga0307504_10086651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 972 | Open in IMG/M |
| 3300028800|Ga0265338_10113217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2180 | Open in IMG/M |
| 3300029636|Ga0222749_10508825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300029990|Ga0311336_11135772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300030991|Ga0073994_11793898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300031094|Ga0308199_1047654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1073076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1204332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300031682|Ga0318560_10821326 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031716|Ga0310813_11081801 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031720|Ga0307469_10451150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1113 | Open in IMG/M |
| 3300031720|Ga0307469_11225252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300031740|Ga0307468_100016663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3103 | Open in IMG/M |
| 3300031740|Ga0307468_100344689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300031879|Ga0306919_10484299 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031962|Ga0307479_10006239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10938 | Open in IMG/M |
| 3300031962|Ga0307479_11058827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300031962|Ga0307479_11275261 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031996|Ga0308176_10616301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300032160|Ga0311301_10571560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1643 | Open in IMG/M |
| 3300032163|Ga0315281_10075873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3969 | Open in IMG/M |
| 3300032180|Ga0307471_100189845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2040 | Open in IMG/M |
| 3300032180|Ga0307471_100728605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
| 3300032180|Ga0307471_101026813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300032180|Ga0307471_101047037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300032180|Ga0307471_103101816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300032205|Ga0307472_100468867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300032205|Ga0307472_100567397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 994 | Open in IMG/M |
| 3300032205|Ga0307472_101578255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300032261|Ga0306920_100411057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2012 | Open in IMG/M |
| 3300032770|Ga0335085_10001693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 44853 | Open in IMG/M |
| 3300032770|Ga0335085_10007977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 16254 | Open in IMG/M |
| 3300032770|Ga0335085_10015561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11028 | Open in IMG/M |
| 3300032770|Ga0335085_10024162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8581 | Open in IMG/M |
| 3300032770|Ga0335085_10278136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1996 | Open in IMG/M |
| 3300032770|Ga0335085_12030878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300032783|Ga0335079_10000524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 43899 | Open in IMG/M |
| 3300032783|Ga0335079_10004189 | All Organisms → cellular organisms → Bacteria | 16586 | Open in IMG/M |
| 3300032783|Ga0335079_10013559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 9314 | Open in IMG/M |
| 3300032783|Ga0335079_10018489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7965 | Open in IMG/M |
| 3300032783|Ga0335079_10023937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6996 | Open in IMG/M |
| 3300032783|Ga0335079_10036324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5658 | Open in IMG/M |
| 3300032783|Ga0335079_10077825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3770 | Open in IMG/M |
| 3300032783|Ga0335079_10079851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3719 | Open in IMG/M |
| 3300032783|Ga0335079_10321752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1683 | Open in IMG/M |
| 3300032783|Ga0335079_10455954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1370 | Open in IMG/M |
| 3300032783|Ga0335079_10604882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300032783|Ga0335079_11096995 | Not Available | 806 | Open in IMG/M |
| 3300032805|Ga0335078_10003603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 23044 | Open in IMG/M |
| 3300032805|Ga0335078_10438032 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300032805|Ga0335078_10882458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300032805|Ga0335078_11058944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 953 | Open in IMG/M |
| 3300032805|Ga0335078_11180147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 886 | Open in IMG/M |
| 3300032828|Ga0335080_10009558 | All Organisms → cellular organisms → Bacteria | 10139 | Open in IMG/M |
| 3300032828|Ga0335080_10141207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2668 | Open in IMG/M |
| 3300032828|Ga0335080_10858458 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300032829|Ga0335070_10001967 | All Organisms → cellular organisms → Bacteria | 23877 | Open in IMG/M |
| 3300032829|Ga0335070_10006800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13441 | Open in IMG/M |
| 3300032829|Ga0335070_10182085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2108 | Open in IMG/M |
| 3300032829|Ga0335070_10209980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1933 | Open in IMG/M |
| 3300032829|Ga0335070_11238914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300032829|Ga0335070_12132760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300032892|Ga0335081_10000914 | All Organisms → cellular organisms → Bacteria | 47264 | Open in IMG/M |
| 3300032893|Ga0335069_10817109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1049 | Open in IMG/M |
| 3300033158|Ga0335077_10635724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300033158|Ga0335077_11350743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 689 | Open in IMG/M |
| 3300033158|Ga0335077_12088237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300033433|Ga0326726_10197474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1856 | Open in IMG/M |
| 3300033433|Ga0326726_10468856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1201 | Open in IMG/M |
| 3300033433|Ga0326726_11005662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300034090|Ga0326723_0142917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1049 | Open in IMG/M |
| 3300034090|Ga0326723_0578143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.86% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.15% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.13% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.18% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.18% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.18% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.18% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.71% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.71% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.47% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.47% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.47% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.47% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.47% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.47% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.24% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.24% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.24% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.24% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.24% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.24% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.24% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.24% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.24% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.24% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.24% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.24% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019870 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01877920 | 2140918007 | Soil | MNFLYAAYAATWIIHLVYVVTLVRRYGRVKNDLDELKRK |
| MRS1b_0141.00001630 | 2162886011 | Miscanthus Rhizosphere | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK |
| INPhiseqgaiiFebDRAFT_1020111203 | 3300000364 | Soil | MNFLYTAYAAVWIVHVAYAFTXXRRYSXLSREIEDLKKK* |
| F14TC_1049449452 | 3300000559 | Soil | MKSETFLYAAYAATWLIHVLYLGTLVRRYSRVKQEIKELERLKR* |
| JGI1027J11758_129189783 | 3300000789 | Soil | MNFLYTAYAAVWIVHVAYAFTLVRRYSXLSREIEDLKKK* |
| JGI12269J14319_100122065 | 3300001356 | Peatlands Soil | LYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK* |
| JGI12630J15595_100040833 | 3300001545 | Forest Soil | MNFLYAAYTATWIIHITYLGILVQRYERLRSEIEELKKK* |
| JGI12635J15846_106961032 | 3300001593 | Forest Soil | MKFLYAAYAATWIIHISYLAYLLRRYARLRNEIQELNQK* |
| JGI12053J15887_104325991 | 3300001661 | Forest Soil | MNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEEL |
| JGI12627J18819_100042946 | 3300001867 | Forest Soil | MTYLYAAYAATWVIHIAYLASLLRRYTRLRKEIEELRRK* |
| JGI25382J43887_104362432 | 3300002908 | Grasslands Soil | MNFLYAAYAATWIIHIIYLSILFRRYTRLRSEIEELKKR* |
| Ga0055483_103023422 | 3300004063 | Natural And Restored Wetlands | MTDTSYLYAAYAATWIIHITYLWIVARRYKRLQSRVQELKKRS* |
| Ga0062385_108093981 | 3300004080 | Bog Forest Soil | MSENANVYLYAAYAATWIIHIGYLTTIARRYAKLRREIKSLNKK* |
| Ga0062389_1015607722 | 3300004092 | Bog Forest Soil | MNFLYAAYAATWIIHITYLGTLVRRYQRLNREIEELKKR* |
| Ga0062386_1001275644 | 3300004152 | Bog Forest Soil | MNFLYAAYAATWIIHIIYLGTLVRRYQRLNREIEELKKK* |
| Ga0062589_1001724972 | 3300004156 | Soil | MKSETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR* |
| Ga0062590_1000434293 | 3300004157 | Soil | MNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELKRK* |
| Ga0062595_1000785253 | 3300004479 | Soil | MNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK* |
| Ga0062595_1001823352 | 3300004479 | Soil | MNFLYAAYAATWIIHIAYLGILVRRYQRLRKEIDELKKSG* |
| Ga0062595_1015790592 | 3300004479 | Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKR* |
| Ga0066395_110078782 | 3300004633 | Tropical Forest Soil | MSFLYVAYAATWIIHIAYLTLLVRRYQRLRDEIQEMKKEQE* |
| Ga0062388_1000018783 | 3300004635 | Bog Forest Soil | MNFLYTAYAAVWIIHLGYLGTLVRRYKRVRREIAEMNRK* |
| Ga0066672_101877432 | 3300005167 | Soil | MNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK* |
| Ga0066672_103927112 | 3300005167 | Soil | MKFLYAAYAATWIIHISYLAFLLRRFTRLRNEIQELNQK* |
| Ga0066672_109949961 | 3300005167 | Soil | MKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNQK* |
| Ga0066677_100114095 | 3300005171 | Soil | MKFLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR* |
| Ga0066677_102813941 | 3300005171 | Soil | MNFLYAAYTATWVIHITYLGILVRRYKRLQSEIEELKKKS* |
| Ga0066673_100025924 | 3300005175 | Soil | MNFLYAAYTATWVIHITYLAILVRRYKRLQSEIEELKKSKG* |
| Ga0066673_102716912 | 3300005175 | Soil | MKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNRK* |
| Ga0066679_105784292 | 3300005176 | Soil | MKFLYAAYSATWIIHISYLAFVLRRYIRLRNKILELNQK* |
| Ga0066685_101182642 | 3300005180 | Soil | MNFLYAAYAATWIIHISYLATLLLRYRRLRKQIEELRRSQ* |
| Ga0066388_1044543392 | 3300005332 | Tropical Forest Soil | MSFLSLAYAATWIIHIAYLTLLVRRYQRLRDEIQEMKNEQE* |
| Ga0068868_1004736832 | 3300005338 | Miscanthus Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKNTN* |
| Ga0070667_1017388362 | 3300005367 | Switchgrass Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKTN* |
| Ga0070709_100979793 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYTATWLIHITYLSVLVRRYKRLQREIEDLKGQTVRR* |
| Ga0070709_103129633 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYTATWIIHVTYLGILVRRYQRLRKEIEHLKRTEPRS* |
| Ga0070709_112068122 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYIAYAATWLIHITYLGVLVRRYQRLRHEIDELKRSKS* |
| Ga0070713_1001667382 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYLYAAYAATWIIHIFYLSTILSRAKRVRKEAEELKRK* |
| Ga0070711_1014845631 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IFLYAAYGVTWTIHIVYLGTLVGRYLLARIEADELKKQN* |
| Ga0070708_1000129923 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWIIHITYLGILVRRYQRLRSEIDELKKGKLA* |
| Ga0070708_1001640833 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIRELNQK* |
| Ga0070708_1010399691 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLYAAYAATWIIHICYLASLLRRYIRLRNKIQELDQK* |
| Ga0066686_101817592 | 3300005446 | Soil | MNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELTRK* |
| Ga0073909_107165301 | 3300005526 | Surface Soil | PELTMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK* |
| Ga0070741_1000029581 | 3300005529 | Surface Soil | MNFLYAAYAVTWVIHIGYLTTLVRRYARLKKEIAELKK* |
| Ga0070741_1000067437 | 3300005529 | Surface Soil | MTFLYAAYAATWVIHIVYLGTVLSRYTKVRKEFDELKRKKI* |
| Ga0070741_100200777 | 3300005529 | Surface Soil | MTYLYAAYAATWLIHITYLGILARRYARLKKEIESLQKKSV* |
| Ga0070697_1000004707 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYLYAAYAATWIIHITYLTIIVRRYGRLRKEIEELRRK* |
| Ga0070697_1000750023 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYTATWLIHIGYLGILVRRYKRLQKTIQDVDRK* |
| Ga0070697_1011728191 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRLRKEIDELKKSN* |
| Ga0070697_1019695872 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYTATWIIHISYLVFLLRRYTRLSREIQELNQK* |
| Ga0070697_1019799701 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VSYLFAAYAATWIIHITYLGTLVRRYSRLRREIEELKKP* |
| Ga0070731_101109303 | 3300005538 | Surface Soil | MNFLYTAYAATWIIHIAYLGTLVRRYQRLSREIEELKK* |
| Ga0070731_102258702 | 3300005538 | Surface Soil | MNFLYAAYTATWIIHIAYLGTLVRRYQRLSREIVEMKKK* |
| Ga0070731_109301192 | 3300005538 | Surface Soil | GTAERPMTYLYAAYAATWIIHIFYLSTIVSRAKKVRKEAEELKRK* |
| Ga0070733_101169592 | 3300005541 | Surface Soil | MTYLYAAYAATWVIHVSYLGWLARRYVRLRQEIDELKKK* |
| Ga0070733_108772942 | 3300005541 | Surface Soil | MNYLYAAYAATWIIHVGYLTILARRYARLRKEIDDLAKK* |
| Ga0070693_1013129631 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYTATWIIHITYLGILVQRYRRLRAEIEELQKKN* |
| Ga0070665_1000157013 | 3300005548 | Switchgrass Rhizosphere | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK* |
| Ga0070665_1001220893 | 3300005548 | Switchgrass Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKMK* |
| Ga0066661_108244812 | 3300005554 | Soil | MKFLYAAYAATWIIHISYLAFVLRRFTRLRNEIQELNQK* |
| Ga0066692_100050794 | 3300005555 | Soil | VKFLYAAYAATWIIHILYLGSLVRRYATLRREIDELNRK* |
| Ga0066707_101491294 | 3300005556 | Soil | HDRASECKMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELTRK* |
| Ga0066707_103089922 | 3300005556 | Soil | VNFLYAAYAATWIIHILYLASLVRRYSRLRNEIEELKRK* |
| Ga0066700_106139132 | 3300005559 | Soil | MSYLYAAYAATWIIHITYLTIIVRRYARLQKEIEELRRK* |
| Ga0068855_1014687061 | 3300005563 | Corn Rhizosphere | TRRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKNTN* |
| Ga0066693_102235601 | 3300005566 | Soil | AYTATWVIHITYLAILVRRYKRLQSEIEELKKSKG* |
| Ga0066706_103796133 | 3300005598 | Soil | AAYAATWIIHISYLAFLLRRFTRLRNEIQELNQK* |
| Ga0068863_1003953162 | 3300005841 | Switchgrass Rhizosphere | MNFLYTAYAAVWIVHVAYAFTLMRRYSRLSREIEDLKKK* |
| Ga0068863_1017635782 | 3300005841 | Switchgrass Rhizosphere | LYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK* |
| Ga0068863_1024363612 | 3300005841 | Switchgrass Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKIK* |
| Ga0070766_108035712 | 3300005921 | Soil | MNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEELKKK* |
| Ga0070766_109548382 | 3300005921 | Soil | MTFLYAAYAATWIIHITYLSTLVRRYKRLQREIEELQK* |
| Ga0080026_100593962 | 3300005952 | Permafrost Soil | MNFLYAAYAATWIIHITYLGTLVRRYQRLSHEIEELKKK* |
| Ga0081540_11151373 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNFLYIAYAAVWIIHVLYLVTLVRRYSRLRKEINELKSK* |
| Ga0066696_103256232 | 3300006032 | Soil | MTYLYAAYAATWIIHITYLGILARRYARLKKDIESLQKK* |
| Ga0075023_1000350292 | 3300006041 | Watersheds | MNFLYAAYAATWIIHIAYLGILVRRYQRVSREIDELKKK* |
| Ga0075023_1002193172 | 3300006041 | Watersheds | MNYLYAAYSATWIIHITYLGVLVLRYRRLQREIENLRKGNPALGN* |
| Ga0066652_1002679403 | 3300006046 | Soil | MNLLYAAYAATWIIHISYLATLLLRYRRLRKQIEELRRSQ* |
| Ga0066652_1006957022 | 3300006046 | Soil | MNFLYAAYTATWIIHIAYLGILVRRYQCLRNEIEELKTKKST* |
| Ga0066652_1010586992 | 3300006046 | Soil | MKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELSQK* |
| Ga0075024_1001722972 | 3300006047 | Watersheds | MNFLYAAYTATWIIHISYLSVLVLRYRRLQREIENLRKGNPALGN* |
| Ga0075028_1000870122 | 3300006050 | Watersheds | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDEMKKVGGSN* |
| Ga0075028_1006675562 | 3300006050 | Watersheds | MNFLYAAYAATWIIHIACLGILVRRYQRVSREIDELKKK* |
| Ga0075028_1006774941 | 3300006050 | Watersheds | MIYLYAAYAATWIIHITYLGILARRYSRLRKEIQELKK* |
| Ga0075029_1000130283 | 3300006052 | Watersheds | MNFLYAAYAATWIIHIAYLASVVNRYGRLKKELNNLKGK* |
| Ga0075029_1002742002 | 3300006052 | Watersheds | MNFLDAAYTATWIIHITYLAVLVRRYQRLRSEIEELKKK* |
| Ga0075029_1005773112 | 3300006052 | Watersheds | MTYLHAAYAATWIIHVAYLGWLARRYSRLRREIDELKKK* |
| Ga0075029_1009686922 | 3300006052 | Watersheds | MNFLYAAYTATWIIHITYLGTLVRRYQRLSREIEELKKK* |
| Ga0075017_1001465792 | 3300006059 | Watersheds | MNFLYAAYTATWIIHIAYLGILVQRYKRLQRGIEELRKTKPGA* |
| Ga0070715_106910972 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RTPELSMNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK* |
| Ga0070716_1000284154 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYLYAAFAATWIIHIVYLATLVRRYAQLRKEIEELKRK* |
| Ga0070716_1002988951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKTS* |
| Ga0070716_1014995341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYLYAAYAATWIIHVVYLGSLVTRYIRLRQEMSE |
| Ga0075014_1002828282 | 3300006174 | Watersheds | MNFLYAAYAATWIIHISYLGILARRYKRLQREIEELQKR* |
| Ga0070712_1018410571 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEELQK* |
| Ga0070765_1002931302 | 3300006176 | Soil | MNFLYAAYTATWIIHITYLVILARRYKRLRSEIEQLKKK* |
| Ga0070765_1003824062 | 3300006176 | Soil | MNFLYAAYTATWIIHITYLGTLVRRYHRLSGEIEELKKK* |
| Ga0097621_1010178442 | 3300006237 | Miscanthus Rhizosphere | SETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR* |
| Ga0075021_102172612 | 3300006354 | Watersheds | MNFLYAAYTATWVIHIAYLSILVQRYRRLQREMEELKKK* |
| Ga0075021_104627521 | 3300006354 | Watersheds | MNYLYAAYSATWIIHITYLGVLVLRYRRLQREIENLRKGNP |
| Ga0068871_1021252332 | 3300006358 | Miscanthus Rhizosphere | LYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK* |
| Ga0079222_105732951 | 3300006755 | Agricultural Soil | MNFLYAAYTATWVIHIVYLGILVRRYSRLRKEVDELNKK* |
| Ga0079222_111186792 | 3300006755 | Agricultural Soil | MNFLYAAYTATWVIHIFYLGILVRRYQRLRREIESLNLKR* |
| Ga0079222_119495632 | 3300006755 | Agricultural Soil | MNFLYAAYASTWIIHISYLAILLRRYIRLRNQIQELNQK* |
| Ga0066653_107880982 | 3300006791 | Soil | MKFLYAAYAATWIIHISYLAFLLRRYTPLRNEIQELNQR* |
| Ga0066660_106750521 | 3300006800 | Soil | MKFLYAAYTATWIIHISYLAVVLRRYIRLRNKIQELNQK* |
| Ga0066660_115930642 | 3300006800 | Soil | ARCAMNFLYAAYAATWLIHIGYLATIATRAMRLRREIDDLNRRSS* |
| Ga0079221_115566802 | 3300006804 | Agricultural Soil | MNFLYAAYTATWLIHITYLSVLVRRYKRLQREIEELKGQTVRR* |
| Ga0075433_100001123 | 3300006852 | Populus Rhizosphere | MNFLYAAYAATWIIHICYLVILLVGYRRVRKQIEELRRGQ* |
| Ga0075425_1008928251 | 3300006854 | Populus Rhizosphere | EHAMKFLYAAYAATWIIHILYLAALVRRYASLRREIDELKRK* |
| Ga0075434_1014566102 | 3300006871 | Populus Rhizosphere | MSFLYAAYTATWIIHISYLAALVLRYRRLQKQIEELCKGR* |
| Ga0075435_1003699292 | 3300007076 | Populus Rhizosphere | MKFLYAAYAATWIIHILYLAALVRRYASLRREIDELKRK* |
| Ga0075435_1015807212 | 3300007076 | Populus Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRLRNEIEEIKTKKSN* |
| Ga0099793_106102852 | 3300007258 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKK* |
| Ga0099794_101018621 | 3300007265 | Vadose Zone Soil | MKFLYAAYTATWIIHLSYLAFVLRRYIRLRNKIQELNQK* |
| Ga0099795_102593422 | 3300007788 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLGTRVRRYQRLSREIDELKKK* |
| Ga0066710_1017150822 | 3300009012 | Grasslands Soil | MNFLYAAYTATWVIHITYLAILVRRYKRLQSEIEELKKSKG |
| Ga0066710_1042697791 | 3300009012 | Grasslands Soil | MNFLYAAYTATWLIHIGYLGILVRRYKRLQKAIQDVDRK |
| Ga0099829_100018933 | 3300009038 | Vadose Zone Soil | MNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGN* |
| Ga0099829_100046582 | 3300009038 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGILVRRYQRLRNEIEEMKKAEGGN* |
| Ga0099829_100922942 | 3300009038 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSRQIDELKKK* |
| Ga0099829_102616252 | 3300009038 | Vadose Zone Soil | MTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK* |
| Ga0099829_111545982 | 3300009038 | Vadose Zone Soil | MNFLYAAYAATWIIHITYLGILARRYTRLRSEIEELKKK* |
| Ga0099829_113694452 | 3300009038 | Vadose Zone Soil | FLYAAYTATWVIHITYLGILVRRFQRLQHEIEALKKTGSST* |
| Ga0099830_109919942 | 3300009088 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGTLVRRYQRLSREIAELKKK* |
| Ga0099828_1000107217 | 3300009089 | Vadose Zone Soil | MNFLNAAYAATWIIHITYLGILVRRYQRLRSEIDELKKGKLA* |
| Ga0099828_100053072 | 3300009089 | Vadose Zone Soil | MNFLYAAYAATWIIHITYLGILVRRYTRLRSEIEELKKR* |
| Ga0099828_104635671 | 3300009089 | Vadose Zone Soil | GFAMTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK* |
| Ga0099827_102522602 | 3300009090 | Vadose Zone Soil | MNLLYAAYAATWIIHIAYLGTLVRRYQRLSREIDELRKK* |
| Ga0105245_109034571 | 3300009098 | Miscanthus Rhizosphere | TRRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKIK* |
| Ga0105245_115461531 | 3300009098 | Miscanthus Rhizosphere | MNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDE |
| Ga0105245_124212181 | 3300009098 | Miscanthus Rhizosphere | TRRLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKTN* |
| Ga0066709_1000137505 | 3300009137 | Grasslands Soil | MKSLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR* |
| Ga0066709_1044989212 | 3300009137 | Grasslands Soil | MNFLYAAYVATWIIHISYLTTLFLRYRRLRKQIEELQRSQ* |
| Ga0105242_116855922 | 3300009176 | Miscanthus Rhizosphere | MNFLYAAYTATWIIHITYLGILVQRYRRLRAEIEELQKKRTSA* |
| Ga0105248_101379442 | 3300009177 | Switchgrass Rhizosphere | MNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELKRN* |
| Ga0116214_13008412 | 3300009520 | Peatlands Soil | MSYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK* |
| Ga0105249_103588001 | 3300009553 | Switchgrass Rhizosphere | TYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR* |
| Ga0126384_114991291 | 3300010046 | Tropical Forest Soil | MNFLYTAYAAVWIIHVAYAFTLVRRYSRLSRDIEELKKK* |
| Ga0126384_118009931 | 3300010046 | Tropical Forest Soil | MTYLYAAYAATWIIHIAYLSTLVRRYSRLKREIEELKKR* |
| Ga0126373_1000003913 | 3300010048 | Tropical Forest Soil | MKFLYAAYAATWLIHITYLLTVARRYARLKREIQDLKRDLR* |
| Ga0126373_109446492 | 3300010048 | Tropical Forest Soil | MKFLYAAYAATWIIHITYLVSVVRRYARLKREIEELKQK* |
| Ga0126373_115005251 | 3300010048 | Tropical Forest Soil | MTYLYAAYAATWIIHISYLGWMAMRYGRLKSEIQELRKER* |
| Ga0134080_105359022 | 3300010333 | Grasslands Soil | MKFLYSAYTATWIIHISYLAFVLRRYIRLRNKIQELSQK* |
| Ga0126370_118049001 | 3300010358 | Tropical Forest Soil | MNFLYAAYVATWAIHIGYLITLVRRYGRVKREIAQLKK* |
| Ga0134128_110185582 | 3300010373 | Terrestrial Soil | MNYLYTAYAAVWIIHIVYLSSVARRYSRLRDEIKNLGKK* |
| Ga0126381_1012014302 | 3300010376 | Tropical Forest Soil | MNFLYAAYAATWIIHVGYLATLLRRYSRLKREIQELKK* |
| Ga0136449_1009250403 | 3300010379 | Peatlands Soil | MNATRYLYAAYAATWIIHIAYLWTVARRYQRLRETIDKLKRK* |
| Ga0134124_104359002 | 3300010397 | Terrestrial Soil | MNFLYAAYGVTWLIHIGYLTTLLRRYSRLKKEIAELKK* |
| Ga0105246_100455883 | 3300011119 | Miscanthus Rhizosphere | MNFLYAAYAATWIIHIVYRGTLVRRYQRLSKEIAELKK* |
| Ga0150983_111299602 | 3300011120 | Forest Soil | MTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEALQK* |
| Ga0137392_100917843 | 3300011269 | Vadose Zone Soil | MNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGT* |
| Ga0137392_101099212 | 3300011269 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGILVSRYRRLRNEIEEMKKAEGGN* |
| Ga0137463_11031322 | 3300011444 | Soil | MNFLYAAYTATWIIHIAYLGILVRRYQRLSKEIAELKK* |
| Ga0120114_11074291 | 3300011998 | Permafrost | MSFLYAAYAATWIIHISYLAFLLRRYTRLRNEIKELNQK* |
| Ga0137389_104557552 | 3300012096 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGNLVRRYHRLSREIEELKKK* |
| Ga0137388_101359982 | 3300012189 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGILVRRYQRLRNEIEEMKNAEGGN* |
| Ga0137365_108806842 | 3300012201 | Vadose Zone Soil | MKFLYAAYAATWIIHISYLAIILRRYGRLRNQIQELNQK* |
| Ga0137363_100708343 | 3300012202 | Vadose Zone Soil | MNYLYAAYSATWIIHITYLSILVQRYRRVQREIEELKKGKPALGN* |
| Ga0137376_105359492 | 3300012208 | Vadose Zone Soil | MKFLYAAYAATWIIHISYLTFLLRRYTHLKREIQELNQK* |
| Ga0137379_105482622 | 3300012209 | Vadose Zone Soil | MNFLYAAYTATWVIHITYLGILLRRYQRLQREMEALKKAGSST* |
| Ga0137379_113588591 | 3300012209 | Vadose Zone Soil | MKFLYAAYAATWIIHISYLTFLLRRFTRLRNEIQELNQK* |
| Ga0137378_102469791 | 3300012210 | Vadose Zone Soil | TYLYAAYTATWVIHIAYVGLLVSRYSKLRRDIRELNERK* |
| Ga0137370_105461832 | 3300012285 | Vadose Zone Soil | MKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNRK |
| Ga0137385_104874352 | 3300012359 | Vadose Zone Soil | MKFLYAAYTDTWIIHISYLAFVLRRYIRLRNKIQELNQK* |
| Ga0137385_115294581 | 3300012359 | Vadose Zone Soil | MNFLYAAYTATWVIHITYLGILLRRYQRLQREMEALKKA* |
| Ga0137360_100545321 | 3300012361 | Vadose Zone Soil | ARSPEPTMNFLYAAYAATWIIHIVYLGTLVRRYQHLSREIDELKKK* |
| Ga0137360_106658562 | 3300012361 | Vadose Zone Soil | MNFLYAAYTATWVIHITYLGILVRRYQRLQHEIEALKKAGSST* |
| Ga0137360_113458731 | 3300012361 | Vadose Zone Soil | MNFLYAAYAATWIIHIAYLGTLVRRYQRLSREIDELKKREAG |
| Ga0137361_104124262 | 3300012362 | Vadose Zone Soil | MKFLYAAYVATWIIHISYLAYLLRRYARLRNEIQELNHK* |
| Ga0137361_110404731 | 3300012362 | Vadose Zone Soil | PTMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKK* |
| Ga0137390_101743841 | 3300012363 | Vadose Zone Soil | MNGYLLAAYAATWIIHITYLGILARRYTRLRSEIEELKKK* |
| Ga0137390_106213121 | 3300012363 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKQ* |
| Ga0137395_108109282 | 3300012917 | Vadose Zone Soil | GHAVKFLYAAYAATWIIHILYLGSLVRRYATLRREIEELNRK* |
| Ga0137394_102709401 | 3300012922 | Vadose Zone Soil | LSEGAMNFLYAAYAATWIIHISYLVSLFRRYTRLRNEIQQLNQK* |
| Ga0137413_102096783 | 3300012924 | Vadose Zone Soil | MNYLYTAYAATWIIHIVYLGSLVRRYSRLRKEIDELKRSK* |
| Ga0137404_104561992 | 3300012929 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGILVRRYQRLSKEIAELKK* |
| Ga0137404_108038311 | 3300012929 | Vadose Zone Soil | MNFLYAAYTATWVIHIIYLGILVRRYQRLQREIESLNLKR* |
| Ga0137407_100458103 | 3300012930 | Vadose Zone Soil | MNFLYAAYAATWIIHITYLGILVLRYQRLKVEIEELKK* |
| Ga0137407_123314131 | 3300012930 | Vadose Zone Soil | MNFLYAAYTATWVIHITYLGILVRRYQRLRREIEILNLKR* |
| Ga0137410_103330593 | 3300012944 | Vadose Zone Soil | MNFLYAAYAATWIIHITYLGILVRRYQRVSREIDELKKR* |
| Ga0137410_106593002 | 3300012944 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLSILASKYSRLRKEIDELNKK* |
| Ga0137410_114301282 | 3300012944 | Vadose Zone Soil | MNFLYAAYTATWVIHITYLGILVRRYQRLQHEIEVLKKAGSST* |
| Ga0137410_116378192 | 3300012944 | Vadose Zone Soil | MNYLYTAYAATWIIHIIYLGSLVRRYARLRKEIDELNKK* |
| Ga0164298_105866541 | 3300012955 | Soil | MNFLYAAYTATWIIHITYLGILVQRYRRLRAEIDELQKKN* |
| Ga0164301_110718362 | 3300012960 | Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEVAELKK* |
| Ga0164301_116947131 | 3300012960 | Soil | MTFLYAAYAATWVIHISYLAFVLRRYIRLRSEIKELNQK* |
| Ga0153916_106151742 | 3300012964 | Freshwater Wetlands | MKFMYAAYIATWVVHIVYLGILTRGYRRLRAEVEESRKQ* |
| Ga0164304_103239772 | 3300012986 | Soil | NFLYAAYTATWIIHITYLGILVQRYRRLRAEIDELQKKN* |
| Ga0164307_102476762 | 3300012987 | Soil | MNFLYAGYAATWIIHIVYLGTLVRRYQRLSKEIAELKK* |
| Ga0157378_104408401 | 3300013297 | Miscanthus Rhizosphere | MNFLYAAYTATWLIHITYLSVLVRRYKRLQGEIEELKGQTVRR* |
| Ga0120123_11264651 | 3300013770 | Permafrost | MNFLYAAYTATWIIHITYLGILVRRYQRLNKEIEELRKK* |
| Ga0134079_101264372 | 3300014166 | Grasslands Soil | MKFLYAAYTTTWIIHISYLAFVLRRYIRLRNKIQELSQK* |
| Ga0182019_100828983 | 3300014498 | Fen | MNFLYAAYAATWIIHLVYVVTLVRRYGRVKSDLDELKRK* |
| Ga0182021_111932772 | 3300014502 | Fen | MNYLYAAYAATWTIHIIYLGTLALRYSRLRKEIEELSKK* |
| Ga0137411_13553182 | 3300015052 | Vadose Zone Soil | MNFLYAAYAATWIIHITYLGILVRRYQRLRSEIDELKKGSWHKH* |
| Ga0167668_10708512 | 3300015193 | Glacier Forefield Soil | MNFLYAAYAATWIIHIAYLSTLVRRYRRLQKDIEAVNKM* |
| Ga0137418_109379761 | 3300015241 | Vadose Zone Soil | GSPARLRGCAMKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNQK* |
| Ga0137403_103781462 | 3300015264 | Vadose Zone Soil | MNFLYAAYTATWIIHIAYLGILVRRYQRLRNEIEELKTKKST* |
| Ga0134089_104886251 | 3300015358 | Grasslands Soil | SECKMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK* |
| Ga0132258_102245273 | 3300015371 | Arabidopsis Rhizosphere | MNFLYIAYAAVWIVHVAYAFTLMRRYSRLSREIEDLKKK* |
| Ga0182033_111485022 | 3300016319 | Soil | AKECGAMNYLYAAYTATWVIHITYLATLVRRYSKLRREIAELKKD |
| Ga0187802_103258812 | 3300017822 | Freshwater Sediment | MSYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK |
| Ga0187818_100192703 | 3300017823 | Freshwater Sediment | MNYLYAAYAATWIIHISYLGVLVRRYTRLRHEIEELKKQ |
| Ga0187818_103858102 | 3300017823 | Freshwater Sediment | MTYLYAAYAATWIIHIAYLGTLVRRYTRLRNEIEELKRK |
| Ga0187824_100000577 | 3300017927 | Freshwater Sediment | MNFLYAAYAATWIIHITYLGILVRRYQRLNKEIEELRKR |
| Ga0187825_100017473 | 3300017930 | Freshwater Sediment | MNFLYAAYAATWIIHITYLGILVRRYQRLNKEIEELRKK |
| Ga0187825_100565633 | 3300017930 | Freshwater Sediment | MNFLYAAYAATWIIHITYLSILVRRYKRLQREIEELKKK |
| Ga0187814_101981501 | 3300017932 | Freshwater Sediment | MKFLYAAYAATWIIHITYLTTVVRRYARLKREIEDLGGK |
| Ga0187801_100703703 | 3300017933 | Freshwater Sediment | MSYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKR |
| Ga0187821_100363463 | 3300017936 | Freshwater Sediment | MNFLYAAYAATWIIHITYLSILVRRYKRLQREIEEL |
| Ga0187775_100997352 | 3300017939 | Tropical Peatland | MNYLYAAYAATWIVHITYLSIVSRRYARLRKELEELKKS |
| Ga0187775_104001642 | 3300017939 | Tropical Peatland | MKYLYAAYAATWIIHIIYLTTVVRRYARLKREIEDLGGK |
| Ga0187785_102779312 | 3300017947 | Tropical Peatland | MNFLYAAYTATWIIHIAYLGILVQRYRKLRSEIEELKRGGS |
| Ga0187847_101641853 | 3300017948 | Peatland | MNYLYAAYAATWIIHIGYLTILARRYARLRKEIDDLKKSPM |
| Ga0187847_107341502 | 3300017948 | Peatland | MNYLYAAYAATWIIHVGYLTILARKYSRLRKEIDELEKK |
| Ga0187779_1000005922 | 3300017959 | Tropical Peatland | MKFLYAAYAATWIIHIMYLTTVVRRYARLKREIEDLGGK |
| Ga0187779_100146615 | 3300017959 | Tropical Peatland | MSYLYAAYVITWLIHIGYLGTLVRRYSRLRNEMEELKRQQ |
| Ga0187778_104871501 | 3300017961 | Tropical Peatland | MKFLYAAYAATWIIHITYLTTLVRRYARLKREVGNLEGSRG |
| Ga0187778_104884942 | 3300017961 | Tropical Peatland | MNGYLYSAYAATWIIHIFYLGVLVRRYSRLRREIEELKRK |
| Ga0187776_100696562 | 3300017966 | Tropical Peatland | MTFLYAAYAAVWIIHLVYVANLVRRYTRLRKEIEEIGK |
| Ga0187776_103854812 | 3300017966 | Tropical Peatland | MNAIKFLYAAYAATWIIHILYLGSLVRRYSRLRRELDELKK |
| Ga0187776_113037881 | 3300017966 | Tropical Peatland | TMKYLYAAYAATWIIHIIYLTTVVRRYARLKREIADLGKK |
| Ga0187781_100486753 | 3300017972 | Tropical Peatland | MSYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRKK |
| Ga0187781_104136081 | 3300017972 | Tropical Peatland | RHDGIWSLAMSYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKK |
| Ga0187777_109984161 | 3300017974 | Tropical Peatland | MNFLYAAYTATWLIHITYLVTLVRRYQRLQKEIEEL |
| Ga0187782_101500952 | 3300017975 | Tropical Peatland | MSYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKK |
| Ga0187805_100389022 | 3300018007 | Freshwater Sediment | MTYLYAAYAATWIIHVAYLGWLARGYVRLRQEVDDLKKK |
| Ga0187805_100393203 | 3300018007 | Freshwater Sediment | MTYLYAAYAATWIIHIAYLGSLVRRYSRLRTEIEELKRK |
| Ga0184605_102746832 | 3300018027 | Groundwater Sediment | MKFLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR |
| Ga0187766_108100752 | 3300018058 | Tropical Peatland | MNFLYAAYSATWIIHITYLVSLFRRYKRLRKEIEELNK |
| Ga0187765_110320512 | 3300018060 | Tropical Peatland | MNFLYAAYSATWIIHITYLASLFRRYKRLRKEIEELNK |
| Ga0187784_105314802 | 3300018062 | Tropical Peatland | MNYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRKK |
| Ga0187773_107131912 | 3300018064 | Tropical Peatland | MNPYLYAAYAATWIIHVFYLGILVRRYTRLRNEIEELKRK |
| Ga0187772_100910471 | 3300018085 | Tropical Peatland | MNAYLYSAYAATWIIHIFYLSVLVRRYSRLRREIDELKRK |
| Ga0187769_100795684 | 3300018086 | Tropical Peatland | MTYLYAAYAATWVIHIAYLGSLVRRYTRLRKEIEELAKK |
| Ga0187769_100968453 | 3300018086 | Tropical Peatland | MSYLFAAYAATWIIHIAYLGWLARRYARLRREIDELRKK |
| Ga0187769_101077653 | 3300018086 | Tropical Peatland | GSPRRAMSYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRKK |
| Ga0187771_100564032 | 3300018088 | Tropical Peatland | MNYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKK |
| Ga0187771_104568512 | 3300018088 | Tropical Peatland | MNAIKFLYAAYAATWIIHSLYLGSLVHRYRRLRRELEDLKK |
| Ga0187771_109678942 | 3300018088 | Tropical Peatland | MNYLFAAYAATWIIHIAYLGWLARRYARLRQEIEELKKR |
| Ga0187770_104074082 | 3300018090 | Tropical Peatland | MSYLFAAYAATWIIHIAYLGWLARRYARLRREIDELKKK |
| Ga0066655_106919872 | 3300018431 | Grasslands Soil | MNFLYAAYAATWIIHIVYLSSLAMKYRRLEHEIEELRRKQ |
| Ga0066655_111178192 | 3300018431 | Grasslands Soil | MNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELTRK |
| Ga0066667_100094582 | 3300018433 | Grasslands Soil | MNFLYAAYAATWIIHISYLATLLLRYRRLRKQIEELRRSQ |
| Ga0066662_100028044 | 3300018468 | Grasslands Soil | VKFLYAAYAATWIIHILYLGSLVRRYATLRREIDELNRK |
| Ga0066662_103047913 | 3300018468 | Grasslands Soil | MKFLYAAYTATWIIHISYLAFVLRRYIRLRNKIQELNQK |
| Ga0066669_108437291 | 3300018482 | Grasslands Soil | MNFLYIAYAATWLIHITYLGVLVRRYQRLRHEIDELKRSKS |
| Ga0066669_121489732 | 3300018482 | Grasslands Soil | MNFLYAAYTATWIIHIAYLGILVRRYQCLRNEIEELKTKKST |
| Ga0187797_16198821 | 3300019284 | Peatland | GSPRRAMSYLFAAYAATWIIHIAYLGWLARRYARLRREIEELRRK |
| Ga0182022_13614382 | 3300019785 | Fen | MNYLYAAYAATWTIHIIYLGTLALRYSRLRKEIEELSKK |
| Ga0137408_10806902 | 3300019789 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKK |
| Ga0193746_10216492 | 3300019870 | Soil | MNFLYIAYAATWLIHITYLGVLVRRYQHLRHEIEELKRSKS |
| Ga0193722_11210842 | 3300019877 | Soil | MNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDELKKK |
| Ga0193723_10562822 | 3300019879 | Soil | MNFLYAAYTATWIIHIAYLGILVRRYQRLRNEIGAIAAAC |
| Ga0193707_100008222 | 3300019881 | Soil | MNFLYAAYSATWIIHIIYLVILVRRYHSLRNEIDELKKGKPTPGH |
| Ga0193707_10573422 | 3300019881 | Soil | MSFLYAAYAATWVIHVIYLGSLVRRYVRLRKDVEELRRK |
| Ga0193707_10758422 | 3300019881 | Soil | MKFLYAAYAATWIIHIGYLAYLLRRYTRLRNEILKLNQK |
| Ga0193713_12051001 | 3300019882 | Soil | MNFLYAAYTATWIIHIAYLGILVRRYQRLRNEIEELKTKKST |
| Ga0193747_10056265 | 3300019885 | Soil | MNFLYAAYSATWIIHITYLVILVRRYHNLRSEIDELKKGEPAPGH |
| Ga0193751_10595782 | 3300019888 | Soil | MSFLYAAYAATWIIHISYLAYLLRRYARLRHEIQKLNQK |
| Ga0193755_10838732 | 3300020004 | Soil | MNFLYAAYTATWLIHIGYLGILVRRYKRLQKAIQDLDRK |
| Ga0193726_11766352 | 3300020021 | Soil | MNPYLCAAYVATWMIHITYLGILARRYWRLQREIEQLKPPPPNSIP |
| Ga0179590_11817222 | 3300020140 | Vadose Zone Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQHLSREIDELKKK |
| Ga0179594_101595062 | 3300020170 | Vadose Zone Soil | MNYLYTAYAATWIIHIVYLGSLVRRYSRLRKEIDELNKK |
| Ga0210407_101420042 | 3300020579 | Soil | MNFLYAAYTATWIIHITYLGTLVRRYHRLSGEIEELKKK |
| Ga0210407_103047222 | 3300020579 | Soil | MNFLYAAYTATWVIHIAYLSILVQRYRHLQREIEDLKKKPGLGS |
| Ga0210403_102560422 | 3300020580 | Soil | MTYLYAAYAATWIIHIAYLGWLARRYSRLRQEIDELNKK |
| Ga0210403_110278872 | 3300020580 | Soil | MNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEELKKK |
| Ga0210403_110648752 | 3300020580 | Soil | MNYLYTAYTVTWLIHITYLATLVRRYSKLRREIAELKKD |
| Ga0210399_110320222 | 3300020581 | Soil | MTYLYAAYAATWIIHIAYLATLLSRYTRLRDEMQDLKNTPAK |
| Ga0210399_111380322 | 3300020581 | Soil | MNFLYAAYTATWVIHIVYLGTLLQRYRHLRSEIEELKRK |
| Ga0210401_106144261 | 3300020583 | Soil | MNFLYAAYTATWIIHITYLVILARRYKRLRSEIEQPKKK |
| Ga0210401_108791091 | 3300020583 | Soil | MNFLYAAYAATWIIHVGYLTTLVRRYSRLKREIEELKKK |
| Ga0210404_108549351 | 3300021088 | Soil | MTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEAL |
| Ga0210406_100053356 | 3300021168 | Soil | MNYLYAAYTATWVIHIAYLTTLVRRYSRLRREIAELKKD |
| Ga0210406_106066611 | 3300021168 | Soil | MTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEALHK |
| Ga0210400_101861343 | 3300021170 | Soil | MTFLYAAYAATWIIHITYLSTLVRRYKRLQREIEALQK |
| Ga0210400_110278101 | 3300021170 | Soil | MNFLYAAYTATWIIHLTYLGTLVRRYHRLSREIEELKKK |
| Ga0193719_100806532 | 3300021344 | Soil | MKFLYAAYAATWIIHIGYLAYLLRRYTRLRNEIQKLNQK |
| Ga0193719_103285002 | 3300021344 | Soil | MNFLYAAYTATWIIHIAYLGILVRRYQRLWNEIEELKTKKST |
| Ga0213873_101093951 | 3300021358 | Rhizosphere | MIYLYAAYAATWTIHITYLAWVLLRYRRLRREIYELRKAAR |
| Ga0213882_100433473 | 3300021362 | Exposed Rock | MIYLYAAYAATWTIHITYLAWVLLRYRRLRREIYELRKAVR |
| Ga0213874_101354492 | 3300021377 | Plant Roots | MTYLYAAYAATWIIHLGYLAWLGSRYARLRKEIEELKR |
| Ga0210397_102415332 | 3300021403 | Soil | MNFLYAAYTATWIIHITYLVILARRYKRLRSEIEQLKKK |
| Ga0210394_1000108514 | 3300021420 | Soil | MTYLYAAYAATWIIHIAYLATLLSRYTRLRNEIRDLKSAREN |
| Ga0210384_100073652 | 3300021432 | Soil | MTFLYAAYAATWIIHITYLSTLVRRYKRLQREIEELQK |
| Ga0210384_110619021 | 3300021432 | Soil | ARTPEPTMNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDELKKR |
| Ga0210402_105663331 | 3300021478 | Soil | MNFLYAAYTATWIIHITYLGILARRYQRLRREVEQLKRSSN |
| Ga0210410_111673952 | 3300021479 | Soil | TMTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEALHK |
| Ga0210409_105120592 | 3300021559 | Soil | MNFLYAAYTATWIIHITYLGMLVRRYQRLKDDIEELKK |
| Ga0210409_109776312 | 3300021559 | Soil | VNFLYVAYTATWIIHIVYLGILVERYRRLRSEIEELQRK |
| Ga0210409_113434681 | 3300021559 | Soil | MNFLYAAYAATWIIHVGYLTTLVRRYSRLKREIEDLKKK |
| Ga0126371_100604832 | 3300021560 | Tropical Forest Soil | MKFLYAAYAATWLIHITYLLTVARRYARLKREIQDLKRDLR |
| Ga0126371_100613692 | 3300021560 | Tropical Forest Soil | MKFLYAAYAATWLIHIAYLVTVARRYARLKREIQDLNRDLR |
| Ga0242660_10534202 | 3300022531 | Soil | MNFLYAAYTATWIIHITYVVILARRYKRLRSEIDQLKKK |
| Ga0222622_106933331 | 3300022756 | Groundwater Sediment | MNFLYAAYTATWIIHIGYLAFLLRRYARLRNKIQELNQK |
| Ga0179589_104965242 | 3300024288 | Vadose Zone Soil | MNFLYAAYTATWIIHIAYLRILVRRYQRLRNEIEELQKAKPSTE |
| Ga0207696_10808492 | 3300025711 | Switchgrass Rhizosphere | MKSETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR |
| Ga0207642_104819222 | 3300025899 | Miscanthus Rhizosphere | MNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELKRK |
| Ga0207642_105021091 | 3300025899 | Miscanthus Rhizosphere | MNFLYAAYAATWIIHIVYLGTLVRRYQRLIKEIAELKK |
| Ga0207699_102123441 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYTATWLIHITYLSVLVRRYKRLQREIEDLKGQTV |
| Ga0207699_111855071 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWIIHIVYLSTLVRRYQRLSREIDE |
| Ga0207684_100918512 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK |
| Ga0207707_112629312 | 3300025912 | Corn Rhizosphere | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSKEVAELKK |
| Ga0207693_109464281 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEELQK |
| Ga0207646_104544112 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFLYAAYAATWLIHILYLGILVRRYSRLRNEIEQARK |
| Ga0207686_112428421 | 3300025934 | Miscanthus Rhizosphere | MNFLYAAYTATWIIHITYLGILVQRYRRLRAEIEELQKKRTSA |
| Ga0207665_101064312 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYLYAAYAATWIIHITYLTIIVRRYARLQKEIEELRRK |
| Ga0207665_104646262 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNFLYAAYAATWIIHISYLGTLVRRYQRLSREIDELRKK |
| Ga0207712_103528723 | 3300025961 | Switchgrass Rhizosphere | ETYLYIAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR |
| Ga0207677_107264971 | 3300026023 | Miscanthus Rhizosphere | NFLYAAYAATWIIHIVYLGTLVRRYQRLSKEIAELKK |
| Ga0207698_116940252 | 3300026142 | Corn Rhizosphere | MNFLYAAYAATWVIHVVYLGTLVTRYMRLRRDVDELK |
| Ga0209871_10552962 | 3300026217 | Permafrost Soil | MNFLYAAYAATWIIHITYLGTLVRRYQRLSHEIEELKKK |
| Ga0209235_11526402 | 3300026296 | Grasslands Soil | MTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK |
| Ga0209238_10749833 | 3300026301 | Grasslands Soil | MNFLYAAYTATWLIHIGYLGILVRRYKRLRKAIQDIDRK |
| Ga0209761_10658653 | 3300026313 | Grasslands Soil | FLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK |
| Ga0209761_11088763 | 3300026313 | Grasslands Soil | KMNFLYAAYAATWIIHILYLGSLVRRYSRLRNEIEELKRK |
| Ga0209268_11820472 | 3300026314 | Soil | MNFLYAAYAATWIIHISYLATLLLRYRRLRKQIEELR |
| Ga0209154_10036617 | 3300026317 | Soil | VKVLYAAYAATWIIHILYLGSLVRRYATLRREIDELNRK |
| Ga0209803_12450342 | 3300026332 | Soil | MKFLYAAYAATWIIHISYLAFLLRRFTRLRNEIQELNQK |
| Ga0257180_10486581 | 3300026354 | Soil | MNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGT |
| Ga0257180_10533892 | 3300026354 | Soil | MNFLYAAYTATWIIHITYLGILVRRYQRLRNEIEEMKKAEGGN |
| Ga0179593_11651583 | 3300026555 | Vadose Zone Soil | MNFLYAAYAATWVIHVGYLTTLLRRYSRLKREIEELKKK |
| Ga0209219_10138892 | 3300027565 | Forest Soil | MNFLYAAYTATWIIHITYLGILVRRYQRLRSEIEELKKK |
| Ga0209009_10141852 | 3300027667 | Forest Soil | MNFLYTAYTATWIIHITYLGILVRRYKRLRSEIDQLKKK |
| Ga0207826_12134101 | 3300027680 | Tropical Forest Soil | MNYLYAAYAATWIIHISYLATLVVRYNKLKREIADLKVK |
| Ga0209447_101665541 | 3300027701 | Bog Forest Soil | MNFLYTAYAAVWIIHLGYLGTLVRRYKRVRREIAEMNRK |
| Ga0209581_1000004884 | 3300027706 | Surface Soil | MNFLYAAYAATWAIHIAYLVTLGLRYARLKREIEDMGRKGR |
| Ga0209811_100077633 | 3300027821 | Surface Soil | MNFLYAAYAATWIIHIAYLATLVSRYSRLKREIEELKK |
| Ga0209180_100956062 | 3300027846 | Vadose Zone Soil | MNYLYAAYSATWIIHITYLSILVQRYRRLQREIEELKKGKPALGN |
| Ga0209701_100201993 | 3300027862 | Vadose Zone Soil | MNFLYAAYAATWIIHITYLGILVRRYTRLRSEIEELKKR |
| Ga0209701_100612984 | 3300027862 | Vadose Zone Soil | MKFLYAAYAATWIIHILYLAALVRRYASLRREIDELKRK |
| Ga0209701_104893972 | 3300027862 | Vadose Zone Soil | MNFLYAAYTATWIIHITYLGTLVRRYQRLSREIAELKKK |
| Ga0209579_101306393 | 3300027869 | Surface Soil | MNFLYAAYTATWIIHIAYLGTLVRRYQRLSREIVEMKKK |
| Ga0209579_101649542 | 3300027869 | Surface Soil | MNFLYTAYAATWIIHIAYLGTLVRRYQRLSREIEELKK |
| Ga0209579_106362182 | 3300027869 | Surface Soil | TGTAERPMTYLYAAYAATWIIHIFYLSTIVSRAKKVRKEAEELKRK |
| Ga0209590_100563263 | 3300027882 | Vadose Zone Soil | AMTFLYAAYAATWLIHIFYLGILVRRYSRLRNEIEQAKK |
| Ga0209068_100144032 | 3300027894 | Watersheds | MNYLYAAYSATWIIHITYLGVLVLRYRRLQREIENLRKGNPALGN |
| Ga0209068_103830342 | 3300027894 | Watersheds | MNFLYAAYAATWIIHIVYLGTLVRRYQRLSREIDEMKKVGGSN |
| Ga0209068_107583462 | 3300027894 | Watersheds | MNFLYAAYTATWIIHITYLGTLVRRYQRLSREIEELKKK |
| Ga0209624_104928562 | 3300027895 | Forest Soil | MNFLYAAYATTWIIHVGYLTTLVRRYSRLKREIEDLKK |
| Ga0209698_100677414 | 3300027911 | Watersheds | MNFLDAAYTATWIIHITYLAVLVRRYQRLRSEIEELKKK |
| Ga0209069_100082797 | 3300027915 | Watersheds | MNFLYAAYAATWIIHIAYLGILVRRYQRVSREIDELKKK |
| Ga0209069_104735752 | 3300027915 | Watersheds | MNFLYAAYTATWIIHISYLSVLVLRYRRLQREIENLRKGNPALGN |
| Ga0209526_100028895 | 3300028047 | Forest Soil | MNFLYAAYTATWIIHITYLGILVQRYERLRSEIEELKKK |
| Ga0209526_106136382 | 3300028047 | Forest Soil | MNFLYAAYTATWIIHITYLGILVQRYARLRSEIEELKKK |
| Ga0268265_106546022 | 3300028380 | Switchgrass Rhizosphere | IAFGMTWLIHIVYLGTLVRRYARLRREIDELERLKR |
| Ga0268264_125123951 | 3300028381 | Switchgrass Rhizosphere | RLKMNFLYAAYAATWIIHIAYLGILVRRYQRVSRDIDELKKTN |
| Ga0137415_105673982 | 3300028536 | Vadose Zone Soil | SATWLIHIAYLVILVRRYQRLRKEIDEIRKEKGGA |
| Ga0307504_100866513 | 3300028792 | Soil | MNFLYAAYTATWIIHITYLGILVRRYTRLRSEIEELKKR |
| Ga0265338_101132173 | 3300028800 | Rhizosphere | MNFLYAAYAATWIIHIGYLTTLVRRYSRLKREIDELKKK |
| Ga0222749_105088251 | 3300029636 | Soil | MNFLYAAYTATWIIHITYLGTLVRRYHRLSREIEELKEK |
| Ga0311336_111357722 | 3300029990 | Fen | MNYLYASYAATWTIHIIYLGTLALRYSRLRKEIEELSKK |
| Ga0073994_117938982 | 3300030991 | Soil | MNFLYAAYGATWVIHIVYLGSLLRRYLRLRKEMKELDDQMSGGD |
| Ga0308199_10476541 | 3300031094 | Soil | FLYAAYAATWIIHISYLALLLRRYIRLRNEIQELNQR |
| (restricted) Ga0255311_10730761 | 3300031150 | Sandy Soil | MNFLYAAYTATWIIHITYLGILVRRYQRLNKEIEELKKK |
| (restricted) Ga0255312_12043321 | 3300031248 | Sandy Soil | MNFLYAAYAATWIIHITYLGILVRRYQRMNKEIEELRKK |
| Ga0318560_108213262 | 3300031682 | Soil | ECGAMNYLYAAYTATWVIHITYLATLVRRYSKLRREIAELKKD |
| Ga0310813_110818011 | 3300031716 | Soil | MNYLYAAYAATWIIHIAYLVILTRGYQNAKQDIEELNRESGQAQ |
| Ga0307469_104511502 | 3300031720 | Hardwood Forest Soil | MSYLYAAYAATWIIHITYLTIIVRRYGRLRKEIEELRRK |
| Ga0307469_112252521 | 3300031720 | Hardwood Forest Soil | MNFLYAAYSATWIIHIVYLGTLVRRYQRLSREIEELKKK |
| Ga0307468_1000166633 | 3300031740 | Hardwood Forest Soil | MNFLYSAYAATWIIHISYLAFLLRRYIRLRNKIQEFNQK |
| Ga0307468_1003446891 | 3300031740 | Hardwood Forest Soil | MNFLYAAYAATWIIHIAYLGILVRRYQRLRKEIDELKKSG |
| Ga0306919_104842992 | 3300031879 | Soil | MNYLYAAYTATWVIHITYLATLVRRYSKLRREIAELKKD |
| Ga0307479_100062392 | 3300031962 | Hardwood Forest Soil | MNFLYAAYTATWIIHIAYLSILVQRYRHLQREIEDLKKKPGLGA |
| Ga0307479_110588271 | 3300031962 | Hardwood Forest Soil | MTYLYAAYAATWIIHIAYLASLVRRYTRLRKEVEALRRK |
| Ga0307479_112752612 | 3300031962 | Hardwood Forest Soil | MNFLYAAYAATWMIHITYLGILVRRYQRLNKEIEELRKK |
| Ga0308176_106163012 | 3300031996 | Soil | MNFLYAAYAVTWIIHIGYLTTLVRRYSQLKREINELKRG |
| Ga0311301_105715602 | 3300032160 | Peatlands Soil | MNATRYLYAAYAATWIIHIAYLWTVARRYQRLRETIDKLKRK |
| Ga0315281_100758733 | 3300032163 | Sediment | MNFLDAAYIATWLIHIAYLTTLVGRFKKLRQEIGQLPRK |
| Ga0307471_1001898453 | 3300032180 | Hardwood Forest Soil | MNFLYAAYTATWIIHIIYLGILVSRYRRLRNEIEELRKAEKNK |
| Ga0307471_1007286052 | 3300032180 | Hardwood Forest Soil | MNGYLLAAYAATWIIHITYLGILVSRYRRLRNEIEDLKKAEGSK |
| Ga0307471_1010268132 | 3300032180 | Hardwood Forest Soil | MKFPMSYLYAAYAATWIIHIAYLGTLVRRYTRLRNEITELRRN |
| Ga0307471_1010470372 | 3300032180 | Hardwood Forest Soil | MNFLYAAYAATWIIHIAYLSILVQRYRHLQREIEDLKKKPAPGA |
| Ga0307471_1031018162 | 3300032180 | Hardwood Forest Soil | MNFLYAAYTATWLIHIGYLGILVRRYKRLQKTIQDVDRK |
| Ga0307472_1004688672 | 3300032205 | Hardwood Forest Soil | MTFLYVAYAATWIIHITYLGTLVQRYKRLQREIEGLQK |
| Ga0307472_1005673972 | 3300032205 | Hardwood Forest Soil | MNFLYAAYTATWLIHIMYLGILVQRYRRLRSEIEELKRK |
| Ga0307472_1015782552 | 3300032205 | Hardwood Forest Soil | MTYLYAAYAATWIIHIAYLGTLALRYSRLRKEIQELKK |
| Ga0306920_1004110573 | 3300032261 | Soil | MSYLYAAYAATWIIHIFYLSTILTRAKRVRKEADELKRK |
| Ga0335085_1000169338 | 3300032770 | Soil | MNFLYAAYAATWIIHIAYLGTLVRRYQRLSKEIAELKK |
| Ga0335085_100079778 | 3300032770 | Soil | MNFLYAAYAATWIIHIGYLTTLVRRYARLKKEVDEMRRPGRG |
| Ga0335085_100155615 | 3300032770 | Soil | MNFLYAAYTATWIIHITYLTILVRRYKRLRQKIEQLGKE |
| Ga0335085_100241626 | 3300032770 | Soil | MNYLYTAYAATWLIHLTYVGYLVRRYVRLRKEIDELGK |
| Ga0335085_102781363 | 3300032770 | Soil | MSFLHAAYAATWIIHITYLGILVRRYTRLRKKIQELGKN |
| Ga0335085_120308782 | 3300032770 | Soil | MSYLYAAYTATWIIHITYLTIVLRRYARLRRELEDLKK |
| Ga0335079_1000052431 | 3300032783 | Soil | MTYLYAAYAATWIIHIAYLSTLALRYKRLRDQVRELKAHSDE |
| Ga0335079_1000418915 | 3300032783 | Soil | MNFLYAAYAATWIIHITYLAILMRRYSRLRDEIEVLKKQK |
| Ga0335079_100135593 | 3300032783 | Soil | MNFLYAAYTATWLIHITYAVTLVRRYQRLRKEIEELKLNR |
| Ga0335079_100184893 | 3300032783 | Soil | MNYLFAAYAATWIIHVFYLTTLVRRYSRLRKEIEDLQRK |
| Ga0335079_100239374 | 3300032783 | Soil | MNFLYAAYAATWIIHITYLSILVRRYARLRKKIEELGR |
| Ga0335079_100363243 | 3300032783 | Soil | MNFLYAAYAATWLIHIGYLVTLARRYARLRGKIRELAKR |
| Ga0335079_100778255 | 3300032783 | Soil | MNFLYAAYTATWIIHITYLASLFRRYNRLRKEIEELKK |
| Ga0335079_100798513 | 3300032783 | Soil | MSYLYAAYAATWIIHIVYLASVVRRYGRLKKEMDDLKGK |
| Ga0335079_103217523 | 3300032783 | Soil | MTFLYAAYAAVWIIHLVYVVNLVRRYTRLRKEIEEIGK |
| Ga0335079_104559541 | 3300032783 | Soil | VNYLYAAYAVTWLIHISYLGTLVRRHNRLKREIAELKKD |
| Ga0335079_106048823 | 3300032783 | Soil | MTYLYAAYAATWIIHIAYLTLLARRYNRVRRELEELKKK |
| Ga0335079_110969952 | 3300032783 | Soil | MSYLYAAYAATWIIHLAYIGTLVRRYMRLRGELNQARSK |
| Ga0335078_1000360314 | 3300032805 | Soil | MNFLYTAYAAAWIIHLVYVAHLVRRYVRLRKEIEELGK |
| Ga0335078_104380323 | 3300032805 | Soil | EEFSMNFLYAAYAATWIIHITYLSILVRRYARLRKKIEELGR |
| Ga0335078_108824582 | 3300032805 | Soil | MNYLYAAYAVTWLIHVTYLGTLVRRHNRLKREIAELKKD |
| Ga0335078_110589443 | 3300032805 | Soil | MNFLYAAYAATWIIHITYLSILVRRYARLRKKIEELG |
| Ga0335078_111801472 | 3300032805 | Soil | MNFLYAAYTATWIIHITYLASLFRRYKRLRKEIEELKK |
| Ga0335080_100095584 | 3300032828 | Soil | MNYLYTAYSATWIIHLVYVGYLVRRYMRLRKEIGELGK |
| Ga0335080_101412073 | 3300032828 | Soil | MKFLYAAYAATWIIHIAYLATIARRYTKLRDKMAELKKKA |
| Ga0335080_108584582 | 3300032828 | Soil | MNFLYTAYAAVWIIHLAYVGHLVRRYVRLRKEIDELGK |
| Ga0335070_1000196719 | 3300032829 | Soil | MNYYLYAAYAATWIIHIAYLSIVSRRYSRLRKELQELKKS |
| Ga0335070_100068009 | 3300032829 | Soil | MNFLHAAYVATWIIHICYLGTLVRRYSRLRKDIQELNKK |
| Ga0335070_101820853 | 3300032829 | Soil | MIYFYAAYAATWIIHITYLSIVLRRYSRLRKELEELKKP |
| Ga0335070_102099801 | 3300032829 | Soil | MNFLYAAYAATWIIHIVYLGTLVRRYQRLNREIKELKKA |
| Ga0335070_112389141 | 3300032829 | Soil | MNYLYAAYAATWIIHIAYLGTIVQRYGRLKRELDELQRK |
| Ga0335070_121327602 | 3300032829 | Soil | YAAYAATWIIHIVYLGSVAMKYRKLQREIEELRRKQ |
| Ga0335081_1000091413 | 3300032892 | Soil | MNFLYAAYTATWLIHITYAVTLVRRYQRLRKEIDELKDRQP |
| Ga0335069_108171092 | 3300032893 | Soil | MNFLYAAYAATWIIHILYLGTLVRRYQRLNREIKELKKAGGSN |
| Ga0335077_106357241 | 3300033158 | Soil | MNFLYAAYAATWIIHITYLTTLVRRYSRLRKEIDELGKK |
| Ga0335077_113507432 | 3300033158 | Soil | MNFLYAAYTATWLIHIAYLTTLVRRYKRLRKEIQELKKD |
| Ga0335077_120882372 | 3300033158 | Soil | MNYLYAAYAATWIIHIGYLTTLVRRYARLKKEIQELKGM |
| Ga0326726_101974742 | 3300033433 | Peat Soil | MNFLYAAYAATWIIHITYLTILVRRYSRLRKDIEELGKK |
| Ga0326726_104688562 | 3300033433 | Peat Soil | MNFLYAAYTATWIIHITYLGILVRRYRRLSKEIGELKKGR |
| Ga0326726_110056622 | 3300033433 | Peat Soil | MTYLYAAYAATWIIHVSYLSILVRRYTRLRREIDELKRK |
| Ga0326723_0142917_221_346 | 3300034090 | Peat Soil | MMNFLYAAYTATWIIHITYLGILVRRYRRLSKEIGELKKGR |
| Ga0326723_0578143_337_459 | 3300034090 | Peat Soil | MNFLYAAYTATWIIHITYLGILVRRYRRLSKEIEELKKGR |
| ⦗Top⦘ |