| Basic Information | |
|---|---|
| Family ID | F004291 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 445 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MNTKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Number of Associated Samples | 242 |
| Number of Associated Scaffolds | 445 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.64 % |
| % of genes near scaffold ends (potentially truncated) | 10.79 % |
| % of genes from short scaffolds (< 2000 bps) | 61.12 % |
| Associated GOLD sequencing projects | 220 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.832 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.865 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.045 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.44% β-sheet: 0.00% Coil/Unstructured: 51.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 445 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 29.89 |
| PF13557 | Phenol_MetA_deg | 3.37 |
| PF01545 | Cation_efflux | 1.57 |
| PF07238 | PilZ | 0.67 |
| PF12840 | HTH_20 | 0.45 |
| PF00069 | Pkinase | 0.45 |
| PF14489 | QueF | 0.45 |
| PF13372 | Alginate_exp | 0.45 |
| PF04191 | PEMT | 0.45 |
| PF00902 | TatC | 0.45 |
| PF03795 | YCII | 0.45 |
| PF01297 | ZnuA | 0.45 |
| PF07470 | Glyco_hydro_88 | 0.22 |
| PF00464 | SHMT | 0.22 |
| PF00753 | Lactamase_B | 0.22 |
| PF09286 | Pro-kuma_activ | 0.22 |
| PF02310 | B12-binding | 0.22 |
| PF07676 | PD40 | 0.22 |
| PF03741 | TerC | 0.22 |
| PF07589 | PEP-CTERM | 0.22 |
| PF06964 | Alpha-L-AF_C | 0.22 |
| PF13176 | TPR_7 | 0.22 |
| PF00871 | Acetate_kinase | 0.22 |
| PF01551 | Peptidase_M23 | 0.22 |
| PF12900 | Pyridox_ox_2 | 0.22 |
| PF01381 | HTH_3 | 0.22 |
| PF01895 | PhoU | 0.22 |
| PF13411 | MerR_1 | 0.22 |
| PF12704 | MacB_PCD | 0.22 |
| PF08241 | Methyltransf_11 | 0.22 |
| PF04239 | DUF421 | 0.22 |
| PF13676 | TIR_2 | 0.22 |
| PF12697 | Abhydrolase_6 | 0.22 |
| PF10996 | Beta-Casp | 0.22 |
| PF02416 | TatA_B_E | 0.22 |
| PF07508 | Recombinase | 0.22 |
| PF10083 | DUF2321 | 0.22 |
| PF04014 | MazE_antitoxin | 0.22 |
| PF01592 | NifU_N | 0.22 |
| PF08447 | PAS_3 | 0.22 |
| PF14684 | Tricorn_C1 | 0.22 |
| PF13537 | GATase_7 | 0.22 |
| PF02774 | Semialdhyde_dhC | 0.22 |
| PF13689 | DUF4154 | 0.22 |
| PF02502 | LacAB_rpiB | 0.22 |
| PF02604 | PhdYeFM_antitox | 0.22 |
| PF00891 | Methyltransf_2 | 0.22 |
| PF07167 | PhaC_N | 0.22 |
| PF13432 | TPR_16 | 0.22 |
| PF01121 | CoaE | 0.22 |
| PF04338 | DUF481 | 0.22 |
| PF02065 | Melibiase | 0.22 |
| PF02737 | 3HCDH_N | 0.22 |
| PF08281 | Sigma70_r4_2 | 0.22 |
| PF05239 | PRC | 0.22 |
| PF00850 | Hist_deacetyl | 0.22 |
| PF00383 | dCMP_cyt_deam_1 | 0.22 |
| PF10646 | Germane | 0.22 |
| PF13298 | LigD_N | 0.22 |
| PF00067 | p450 | 0.22 |
| PF00486 | Trans_reg_C | 0.22 |
| PF03544 | TonB_C | 0.22 |
| PF00135 | COesterase | 0.22 |
| PF05050 | Methyltransf_21 | 0.22 |
| PF00230 | MIP | 0.22 |
| PF07715 | Plug | 0.22 |
| PF02954 | HTH_8 | 0.22 |
| PF12848 | ABC_tran_Xtn | 0.22 |
| PF12728 | HTH_17 | 0.22 |
| PF04389 | Peptidase_M28 | 0.22 |
| PF00115 | COX1 | 0.22 |
| PF13515 | FUSC_2 | 0.22 |
| PF01740 | STAS | 0.22 |
| PF00005 | ABC_tran | 0.22 |
| COG ID | Name | Functional Category | % Frequency in 445 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.80 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.57 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.57 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.57 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.45 |
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 0.45 |
| COG3137 | Putative salt-induced outer membrane protein YdiY | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.22 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.22 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.22 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.22 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.22 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.22 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.22 |
| COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.22 |
| COG3345 | Alpha-galactosidase | Carbohydrate transport and metabolism [G] | 0.22 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.22 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.22 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.22 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.22 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.22 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.22 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.22 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.22 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
| COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.22 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.22 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.22 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.22 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.22 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.22 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02IMQ9R | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 2228664022|INPgaii200_c0873690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101803802 | All Organisms → cellular organisms → Bacteria | 3467 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101804168 | All Organisms → cellular organisms → Bacteria | 5986 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101804605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101805093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
| 3300000567|JGI12270J11330_10000850 | All Organisms → cellular organisms → Bacteria | 22899 | Open in IMG/M |
| 3300000567|JGI12270J11330_10008781 | All Organisms → cellular organisms → Bacteria | 6872 | Open in IMG/M |
| 3300000567|JGI12270J11330_10083627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1490 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1003955 | All Organisms → cellular organisms → Bacteria | 2798 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1059820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300001154|JGI12636J13339_1000054 | All Organisms → cellular organisms → Bacteria | 14770 | Open in IMG/M |
| 3300001305|C688J14111_10000818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8117 | Open in IMG/M |
| 3300001593|JGI12635J15846_10015678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6301 | Open in IMG/M |
| 3300001593|JGI12635J15846_10564580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100097489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2750 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100834936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300002558|JGI25385J37094_10061283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
| 3300002908|JGI25382J43887_10327495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300003370|JGI26337J50220_1001305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2711 | Open in IMG/M |
| 3300004080|Ga0062385_10663223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300004635|Ga0062388_102297455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300005172|Ga0066683_10682365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300005332|Ga0066388_104540482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300005450|Ga0066682_10196975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1290 | Open in IMG/M |
| 3300005529|Ga0070741_10006236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 25788 | Open in IMG/M |
| 3300005529|Ga0070741_10257424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
| 3300005532|Ga0070739_10007136 | All Organisms → cellular organisms → Bacteria | 11997 | Open in IMG/M |
| 3300005532|Ga0070739_10068791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2154 | Open in IMG/M |
| 3300005537|Ga0070730_10104215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1960 | Open in IMG/M |
| 3300005540|Ga0066697_10000212 | All Organisms → cellular organisms → Bacteria | 17934 | Open in IMG/M |
| 3300005540|Ga0066697_10084148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
| 3300005540|Ga0066697_10487074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300005540|Ga0066697_10592436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300005541|Ga0070733_10072175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2176 | Open in IMG/M |
| 3300005541|Ga0070733_10079063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2078 | Open in IMG/M |
| 3300005541|Ga0070733_10798727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300005542|Ga0070732_10026807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3268 | Open in IMG/M |
| 3300005542|Ga0070732_10030054 | All Organisms → cellular organisms → Bacteria | 3090 | Open in IMG/M |
| 3300005542|Ga0070732_10051914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2370 | Open in IMG/M |
| 3300005542|Ga0070732_10057340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2257 | Open in IMG/M |
| 3300005552|Ga0066701_10168008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300005552|Ga0066701_10732239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300005552|Ga0066701_10890889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300005554|Ga0066661_10004415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6427 | Open in IMG/M |
| 3300005554|Ga0066661_10008115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5097 | Open in IMG/M |
| 3300005554|Ga0066661_10468437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005554|Ga0066661_10834578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005555|Ga0066692_10582048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300005555|Ga0066692_10647182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300005557|Ga0066704_10314397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300005560|Ga0066670_10133821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1432 | Open in IMG/M |
| 3300005566|Ga0066693_10178258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300005566|Ga0066693_10373894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300005569|Ga0066705_10934241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300005577|Ga0068857_101867967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005587|Ga0066654_10829506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300005591|Ga0070761_10482830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300005598|Ga0066706_10410878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300005602|Ga0070762_10402483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300005610|Ga0070763_10539562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300005610|Ga0070763_10582690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005610|Ga0070763_10660915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300005614|Ga0068856_101866768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300005764|Ga0066903_100208612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2938 | Open in IMG/M |
| 3300005764|Ga0066903_101228841 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1394 | Open in IMG/M |
| 3300005764|Ga0066903_102600873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300005921|Ga0070766_10444565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
| 3300005938|Ga0066795_10180756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300005994|Ga0066789_10071441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
| 3300005994|Ga0066789_10099300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
| 3300006034|Ga0066656_10467785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300006041|Ga0075023_100214693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300006050|Ga0075028_100020613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2903 | Open in IMG/M |
| 3300006050|Ga0075028_100075815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1672 | Open in IMG/M |
| 3300006050|Ga0075028_100459216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300006052|Ga0075029_100006383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6510 | Open in IMG/M |
| 3300006052|Ga0075029_100030027 | All Organisms → cellular organisms → Bacteria | 3082 | Open in IMG/M |
| 3300006052|Ga0075029_100033649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2920 | Open in IMG/M |
| 3300006059|Ga0075017_100000362 | All Organisms → cellular organisms → Bacteria | 24775 | Open in IMG/M |
| 3300006059|Ga0075017_100073291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2342 | Open in IMG/M |
| 3300006102|Ga0075015_100721310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300006102|Ga0075015_100823331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300006162|Ga0075030_100007590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9672 | Open in IMG/M |
| 3300006162|Ga0075030_100096308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2417 | Open in IMG/M |
| 3300006162|Ga0075030_100248834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300006172|Ga0075018_10022434 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
| 3300006172|Ga0075018_10475158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300006174|Ga0075014_100715423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300006175|Ga0070712_100130039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1907 | Open in IMG/M |
| 3300006176|Ga0070765_100000974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 17084 | Open in IMG/M |
| 3300006176|Ga0070765_100020015 | All Organisms → cellular organisms → Bacteria | 4976 | Open in IMG/M |
| 3300006176|Ga0070765_100129252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2227 | Open in IMG/M |
| 3300006176|Ga0070765_100178530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1915 | Open in IMG/M |
| 3300006642|Ga0075521_10389042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300006794|Ga0066658_10507581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300006797|Ga0066659_11455532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300006800|Ga0066660_10018621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3999 | Open in IMG/M |
| 3300006800|Ga0066660_10445571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1080 | Open in IMG/M |
| 3300006800|Ga0066660_10869584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300006806|Ga0079220_10066202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
| 3300006893|Ga0073928_10010673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10881 | Open in IMG/M |
| 3300006893|Ga0073928_10024883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5973 | Open in IMG/M |
| 3300006893|Ga0073928_10030547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5193 | Open in IMG/M |
| 3300006893|Ga0073928_10189723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300006903|Ga0075426_10361862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300006904|Ga0075424_102137895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300007265|Ga0099794_10018678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3112 | Open in IMG/M |
| 3300007265|Ga0099794_10118470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300007788|Ga0099795_10008168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2968 | Open in IMG/M |
| 3300007788|Ga0099795_10556254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300007982|Ga0102924_1003863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15469 | Open in IMG/M |
| 3300007982|Ga0102924_1161921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300009029|Ga0066793_10325598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300009038|Ga0099829_10031622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3776 | Open in IMG/M |
| 3300009038|Ga0099829_10036013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3569 | Open in IMG/M |
| 3300009038|Ga0099829_10055250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2957 | Open in IMG/M |
| 3300009088|Ga0099830_10010382 | All Organisms → cellular organisms → Bacteria | 5658 | Open in IMG/M |
| 3300009088|Ga0099830_10973521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300009090|Ga0099827_10118473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2129 | Open in IMG/M |
| 3300009090|Ga0099827_10382920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300009137|Ga0066709_100069958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4114 | Open in IMG/M |
| 3300009137|Ga0066709_101968085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300009143|Ga0099792_10002766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6754 | Open in IMG/M |
| 3300009143|Ga0099792_10142861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1310 | Open in IMG/M |
| 3300009143|Ga0099792_10360830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300009632|Ga0116102_1064744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
| 3300009643|Ga0116110_1007599 | All Organisms → cellular organisms → Bacteria | 4694 | Open in IMG/M |
| 3300009698|Ga0116216_10567635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300009698|Ga0116216_10730013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300009700|Ga0116217_10500193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300009839|Ga0116223_10035511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3353 | Open in IMG/M |
| 3300009839|Ga0116223_10538444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300009839|Ga0116223_10613915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300010043|Ga0126380_10145528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1509 | Open in IMG/M |
| 3300010048|Ga0126373_10005130 | All Organisms → cellular organisms → Bacteria | 10135 | Open in IMG/M |
| 3300010048|Ga0126373_11256597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300010326|Ga0134065_10021994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1805 | Open in IMG/M |
| 3300010326|Ga0134065_10031239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1563 | Open in IMG/M |
| 3300010329|Ga0134111_10125267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300010343|Ga0074044_10038824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3312 | Open in IMG/M |
| 3300010343|Ga0074044_10058984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2615 | Open in IMG/M |
| 3300010343|Ga0074044_10860512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010358|Ga0126370_11691450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300010371|Ga0134125_10026466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6461 | Open in IMG/M |
| 3300010371|Ga0134125_10145647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2638 | Open in IMG/M |
| 3300010371|Ga0134125_10344839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1652 | Open in IMG/M |
| 3300010379|Ga0136449_100023870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15324 | Open in IMG/M |
| 3300010379|Ga0136449_100068542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7647 | Open in IMG/M |
| 3300010379|Ga0136449_100166474 | All Organisms → cellular organisms → Bacteria | 4279 | Open in IMG/M |
| 3300010379|Ga0136449_100210351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3680 | Open in IMG/M |
| 3300010379|Ga0136449_100868122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1477 | Open in IMG/M |
| 3300010379|Ga0136449_102302888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300010859|Ga0126352_1051370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300011269|Ga0137392_10059554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2902 | Open in IMG/M |
| 3300011269|Ga0137392_11300883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300011270|Ga0137391_10004564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10591 | Open in IMG/M |
| 3300011270|Ga0137391_10010081 | All Organisms → cellular organisms → Bacteria | 7517 | Open in IMG/M |
| 3300011271|Ga0137393_10002274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12397 | Open in IMG/M |
| 3300011271|Ga0137393_10518860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300012199|Ga0137383_10696547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300012199|Ga0137383_11141181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300012202|Ga0137363_10034916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3503 | Open in IMG/M |
| 3300012202|Ga0137363_10036578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3432 | Open in IMG/M |
| 3300012202|Ga0137363_10168759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1734 | Open in IMG/M |
| 3300012202|Ga0137363_10915246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300012203|Ga0137399_10249436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
| 3300012205|Ga0137362_10746034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300012205|Ga0137362_11147684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300012206|Ga0137380_11078750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300012207|Ga0137381_10375088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300012207|Ga0137381_11076905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300012210|Ga0137378_10062896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3356 | Open in IMG/M |
| 3300012211|Ga0137377_11882432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300012211|Ga0137377_11922784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300012357|Ga0137384_11357836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012359|Ga0137385_10702803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300012361|Ga0137360_10022246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4254 | Open in IMG/M |
| 3300012363|Ga0137390_10220430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1883 | Open in IMG/M |
| 3300012386|Ga0134046_1069222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300012917|Ga0137395_11031100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300012918|Ga0137396_10206766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1444 | Open in IMG/M |
| 3300012922|Ga0137394_10044050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3668 | Open in IMG/M |
| 3300012930|Ga0137407_10964023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300012944|Ga0137410_11480708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012989|Ga0164305_11526170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300014489|Ga0182018_10002176 | All Organisms → cellular organisms → Bacteria | 20267 | Open in IMG/M |
| 3300014489|Ga0182018_10046521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2672 | Open in IMG/M |
| 3300014491|Ga0182014_10175911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
| 3300014495|Ga0182015_10003055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 19234 | Open in IMG/M |
| 3300014495|Ga0182015_10025026 | All Organisms → cellular organisms → Bacteria | 4736 | Open in IMG/M |
| 3300014497|Ga0182008_10083400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1574 | Open in IMG/M |
| 3300014501|Ga0182024_10001126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 69191 | Open in IMG/M |
| 3300014501|Ga0182024_10071046 | All Organisms → cellular organisms → Bacteria | 5271 | Open in IMG/M |
| 3300014501|Ga0182024_10190016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2824 | Open in IMG/M |
| 3300014501|Ga0182024_11315987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300015241|Ga0137418_10003320 | All Organisms → cellular organisms → Bacteria | 14812 | Open in IMG/M |
| 3300015358|Ga0134089_10172126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300017654|Ga0134069_1203034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300017656|Ga0134112_10007680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3500 | Open in IMG/M |
| 3300017946|Ga0187879_10117320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1519 | Open in IMG/M |
| 3300017972|Ga0187781_10015964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5290 | Open in IMG/M |
| 3300018037|Ga0187883_10256057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 895 | Open in IMG/M |
| 3300018040|Ga0187862_10500227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300018431|Ga0066655_10000515 | All Organisms → cellular organisms → Bacteria | 13001 | Open in IMG/M |
| 3300018431|Ga0066655_10065996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1922 | Open in IMG/M |
| 3300018431|Ga0066655_10267150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300018433|Ga0066667_10760442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300018468|Ga0066662_10217985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1527 | Open in IMG/M |
| 3300018468|Ga0066662_10938627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300018468|Ga0066662_11554102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300018468|Ga0066662_12950413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300019890|Ga0193728_1007918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5377 | Open in IMG/M |
| 3300020579|Ga0210407_10003094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13731 | Open in IMG/M |
| 3300020579|Ga0210407_10009512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7263 | Open in IMG/M |
| 3300020579|Ga0210407_10011037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6730 | Open in IMG/M |
| 3300020579|Ga0210407_10065241 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
| 3300020579|Ga0210407_10257387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1360 | Open in IMG/M |
| 3300020579|Ga0210407_10588404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300020580|Ga0210403_10000021 | All Organisms → cellular organisms → Bacteria | 187907 | Open in IMG/M |
| 3300020580|Ga0210403_10004472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12047 | Open in IMG/M |
| 3300020580|Ga0210403_10009384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8014 | Open in IMG/M |
| 3300020580|Ga0210403_10048755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3387 | Open in IMG/M |
| 3300020580|Ga0210403_10148597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1916 | Open in IMG/M |
| 3300020580|Ga0210403_10192495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1673 | Open in IMG/M |
| 3300020581|Ga0210399_10149986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300020581|Ga0210399_10608175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300020581|Ga0210399_10916209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300020581|Ga0210399_10942612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300020581|Ga0210399_11071932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300020582|Ga0210395_10404681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300020582|Ga0210395_10918881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300020583|Ga0210401_10290792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300020583|Ga0210401_10722305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300020583|Ga0210401_10877862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300020583|Ga0210401_11252832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300021046|Ga0215015_10046485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1488 | Open in IMG/M |
| 3300021086|Ga0179596_10420709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021088|Ga0210404_10000100 | All Organisms → cellular organisms → Bacteria | 60873 | Open in IMG/M |
| 3300021168|Ga0210406_10913559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300021170|Ga0210400_10000047 | All Organisms → cellular organisms → Bacteria | 198819 | Open in IMG/M |
| 3300021170|Ga0210400_10042596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3524 | Open in IMG/M |
| 3300021170|Ga0210400_10354672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300021171|Ga0210405_10000011 | All Organisms → cellular organisms → Bacteria | 263401 | Open in IMG/M |
| 3300021171|Ga0210405_10000237 | All Organisms → cellular organisms → Bacteria | 77834 | Open in IMG/M |
| 3300021171|Ga0210405_10011820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7329 | Open in IMG/M |
| 3300021171|Ga0210405_10029647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4388 | Open in IMG/M |
| 3300021171|Ga0210405_10081495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2550 | Open in IMG/M |
| 3300021178|Ga0210408_11090988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300021180|Ga0210396_10011796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8189 | Open in IMG/M |
| 3300021180|Ga0210396_10326297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
| 3300021180|Ga0210396_10924865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300021401|Ga0210393_10347088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
| 3300021403|Ga0210397_10507908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300021405|Ga0210387_10279509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1466 | Open in IMG/M |
| 3300021405|Ga0210387_11598175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300021406|Ga0210386_10968650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300021407|Ga0210383_10007698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 9328 | Open in IMG/M |
| 3300021407|Ga0210383_10037554 | All Organisms → cellular organisms → Bacteria | 4041 | Open in IMG/M |
| 3300021407|Ga0210383_10782396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300021407|Ga0210383_11408528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300021420|Ga0210394_10046037 | All Organisms → cellular organisms → Bacteria | 3827 | Open in IMG/M |
| 3300021420|Ga0210394_10785647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300021432|Ga0210384_10016673 | All Organisms → cellular organisms → Bacteria | 7203 | Open in IMG/M |
| 3300021432|Ga0210384_10317290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
| 3300021476|Ga0187846_10072365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300021478|Ga0210402_10167301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2010 | Open in IMG/M |
| 3300021478|Ga0210402_10367509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300021478|Ga0210402_10410853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
| 3300021479|Ga0210410_10000270 | All Organisms → cellular organisms → Bacteria | 65103 | Open in IMG/M |
| 3300021479|Ga0210410_10000405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 50060 | Open in IMG/M |
| 3300021479|Ga0210410_10744771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300021559|Ga0210409_10074516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3152 | Open in IMG/M |
| 3300021559|Ga0210409_10170729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1988 | Open in IMG/M |
| 3300021559|Ga0210409_10533185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
| 3300021559|Ga0210409_10820024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300021560|Ga0126371_10500559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
| 3300022533|Ga0242662_10190714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300022557|Ga0212123_10014829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9848 | Open in IMG/M |
| 3300022557|Ga0212123_10014984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9769 | Open in IMG/M |
| 3300022557|Ga0212123_10018459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8226 | Open in IMG/M |
| 3300022557|Ga0212123_10195738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1505 | Open in IMG/M |
| 3300022557|Ga0212123_10294208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1139 | Open in IMG/M |
| 3300022873|Ga0224550_1010366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1311 | Open in IMG/M |
| 3300023250|Ga0224544_1000433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5933 | Open in IMG/M |
| 3300024222|Ga0247691_1027027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300024227|Ga0228598_1005897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2546 | Open in IMG/M |
| 3300024271|Ga0224564_1050922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300024271|Ga0224564_1097833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300024331|Ga0247668_1008607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2142 | Open in IMG/M |
| 3300025134|Ga0207416_1007173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8010 | Open in IMG/M |
| 3300025494|Ga0207928_1101718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300025579|Ga0207927_1000514 | All Organisms → cellular organisms → Bacteria | 16444 | Open in IMG/M |
| 3300025906|Ga0207699_10385397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 996 | Open in IMG/M |
| 3300025910|Ga0207684_10480985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300025910|Ga0207684_10863865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300025912|Ga0207707_10717711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
| 3300025921|Ga0207652_10062492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3218 | Open in IMG/M |
| 3300025922|Ga0207646_10004201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 15771 | Open in IMG/M |
| 3300025922|Ga0207646_10479556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300025922|Ga0207646_11100537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300026277|Ga0209350_1020207 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300026291|Ga0209890_10063976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300026295|Ga0209234_1093743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
| 3300026297|Ga0209237_1089999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300026307|Ga0209469_1020184 | All Organisms → cellular organisms → Bacteria | 2349 | Open in IMG/M |
| 3300026323|Ga0209472_1005180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6966 | Open in IMG/M |
| 3300026325|Ga0209152_10247910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300026333|Ga0209158_1003466 | All Organisms → cellular organisms → Bacteria | 9143 | Open in IMG/M |
| 3300026333|Ga0209158_1091714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
| 3300026334|Ga0209377_1226974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300026356|Ga0257150_1032129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300026538|Ga0209056_10078781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2789 | Open in IMG/M |
| 3300026538|Ga0209056_10090193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2543 | Open in IMG/M |
| 3300026550|Ga0209474_10132211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1642 | Open in IMG/M |
| 3300026550|Ga0209474_10163166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1443 | Open in IMG/M |
| 3300026550|Ga0209474_10232313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
| 3300026551|Ga0209648_10003194 | All Organisms → cellular organisms → Bacteria | 13739 | Open in IMG/M |
| 3300026551|Ga0209648_10085718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2616 | Open in IMG/M |
| 3300026552|Ga0209577_10785197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300026557|Ga0179587_10120199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1611 | Open in IMG/M |
| 3300026557|Ga0179587_10212007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300026783|Ga0207778_115599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300027070|Ga0208365_1006756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1391 | Open in IMG/M |
| 3300027071|Ga0209214_1009300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300027370|Ga0209010_1030687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300027376|Ga0209004_1020377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1049 | Open in IMG/M |
| 3300027546|Ga0208984_1081428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300027562|Ga0209735_1000581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6345 | Open in IMG/M |
| 3300027562|Ga0209735_1002670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3162 | Open in IMG/M |
| 3300027565|Ga0209219_1010629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
| 3300027576|Ga0209003_1057029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300027625|Ga0208044_1003119 | All Organisms → cellular organisms → Bacteria | 7813 | Open in IMG/M |
| 3300027625|Ga0208044_1195766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300027641|Ga0208827_1085050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300027645|Ga0209117_1008413 | All Organisms → cellular organisms → Bacteria | 3510 | Open in IMG/M |
| 3300027651|Ga0209217_1015591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2468 | Open in IMG/M |
| 3300027674|Ga0209118_1000013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 167144 | Open in IMG/M |
| 3300027681|Ga0208991_1245569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027698|Ga0209446_1012799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2057 | Open in IMG/M |
| 3300027701|Ga0209447_10000808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9037 | Open in IMG/M |
| 3300027706|Ga0209581_1001116 | All Organisms → cellular organisms → Bacteria | 35338 | Open in IMG/M |
| 3300027729|Ga0209248_10044025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1377 | Open in IMG/M |
| 3300027737|Ga0209038_10008847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2956 | Open in IMG/M |
| 3300027745|Ga0209908_10000170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4731 | Open in IMG/M |
| 3300027765|Ga0209073_10120975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300027768|Ga0209772_10019305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1926 | Open in IMG/M |
| 3300027783|Ga0209448_10003372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4939 | Open in IMG/M |
| 3300027783|Ga0209448_10005917 | All Organisms → cellular organisms → Bacteria | 3836 | Open in IMG/M |
| 3300027783|Ga0209448_10050463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
| 3300027783|Ga0209448_10068964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300027812|Ga0209656_10003818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9736 | Open in IMG/M |
| 3300027825|Ga0209039_10370463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300027829|Ga0209773_10075365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
| 3300027829|Ga0209773_10148243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300027835|Ga0209515_10050596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3205 | Open in IMG/M |
| 3300027842|Ga0209580_10115055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
| 3300027842|Ga0209580_10162246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300027842|Ga0209580_10171837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300027842|Ga0209580_10329767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300027846|Ga0209180_10049150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2322 | Open in IMG/M |
| 3300027846|Ga0209180_10252827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300027857|Ga0209166_10086419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1765 | Open in IMG/M |
| 3300027862|Ga0209701_10029112 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
| 3300027867|Ga0209167_10071049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1741 | Open in IMG/M |
| 3300027867|Ga0209167_10099388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1486 | Open in IMG/M |
| 3300027867|Ga0209167_10561809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300027867|Ga0209167_10777473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027875|Ga0209283_10005289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7415 | Open in IMG/M |
| 3300027889|Ga0209380_10002302 | All Organisms → cellular organisms → Bacteria | 12339 | Open in IMG/M |
| 3300027889|Ga0209380_10060045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2163 | Open in IMG/M |
| 3300027894|Ga0209068_10000260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30553 | Open in IMG/M |
| 3300027894|Ga0209068_10644348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300027898|Ga0209067_10132864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300027898|Ga0209067_10224693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
| 3300027903|Ga0209488_10007072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8434 | Open in IMG/M |
| 3300027903|Ga0209488_10013427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5982 | Open in IMG/M |
| 3300027903|Ga0209488_10092212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2264 | Open in IMG/M |
| 3300027905|Ga0209415_10021463 | All Organisms → cellular organisms → Bacteria | 9936 | Open in IMG/M |
| 3300027905|Ga0209415_10209920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1822 | Open in IMG/M |
| 3300027908|Ga0209006_11005107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300027910|Ga0209583_10104156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300027911|Ga0209698_10030668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4922 | Open in IMG/M |
| 3300027911|Ga0209698_10086460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2649 | Open in IMG/M |
| 3300027911|Ga0209698_10147849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1929 | Open in IMG/M |
| 3300027911|Ga0209698_10552754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300027911|Ga0209698_11227412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300029636|Ga0222749_10059856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1704 | Open in IMG/M |
| 3300029636|Ga0222749_10686906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300030007|Ga0311338_10418054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1433 | Open in IMG/M |
| 3300030503|Ga0311370_12443922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300031057|Ga0170834_113642861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031090|Ga0265760_10011322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2550 | Open in IMG/M |
| 3300031090|Ga0265760_10060835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300031170|Ga0307498_10459180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300031231|Ga0170824_116844774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2911 | Open in IMG/M |
| 3300031708|Ga0310686_108443643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300031708|Ga0310686_111764447 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300031708|Ga0310686_115289395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3867 | Open in IMG/M |
| 3300031708|Ga0310686_116211544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300031708|Ga0310686_117710121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300031708|Ga0310686_117995537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300031718|Ga0307474_10093683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2243 | Open in IMG/M |
| 3300031720|Ga0307469_10145122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1766 | Open in IMG/M |
| 3300031720|Ga0307469_10267132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300031720|Ga0307469_10296122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
| 3300031720|Ga0307469_10458710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1105 | Open in IMG/M |
| 3300031720|Ga0307469_12374385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031753|Ga0307477_10016555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5032 | Open in IMG/M |
| 3300031753|Ga0307477_10115921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1865 | Open in IMG/M |
| 3300031753|Ga0307477_10374908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300031754|Ga0307475_10031405 | All Organisms → cellular organisms → Bacteria | 3859 | Open in IMG/M |
| 3300031754|Ga0307475_10032037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3828 | Open in IMG/M |
| 3300031754|Ga0307475_10047220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3220 | Open in IMG/M |
| 3300031754|Ga0307475_10051797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3085 | Open in IMG/M |
| 3300031754|Ga0307475_10071553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2652 | Open in IMG/M |
| 3300031754|Ga0307475_10109938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2160 | Open in IMG/M |
| 3300031754|Ga0307475_10168762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1744 | Open in IMG/M |
| 3300031754|Ga0307475_11195786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300031754|Ga0307475_11496388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031820|Ga0307473_10721559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300031823|Ga0307478_10332654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1249 | Open in IMG/M |
| 3300031823|Ga0307478_11448913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300031938|Ga0308175_100145654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2264 | Open in IMG/M |
| 3300031962|Ga0307479_10057982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3730 | Open in IMG/M |
| 3300031962|Ga0307479_10379579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1398 | Open in IMG/M |
| 3300031962|Ga0307479_10839238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300031962|Ga0307479_11015684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300031962|Ga0307479_11355812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300031962|Ga0307479_11416919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300031962|Ga0307479_11496414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300032160|Ga0311301_10002403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 71235 | Open in IMG/M |
| 3300032160|Ga0311301_10020930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18404 | Open in IMG/M |
| 3300032160|Ga0311301_10030353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14051 | Open in IMG/M |
| 3300032160|Ga0311301_10146967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4286 | Open in IMG/M |
| 3300032160|Ga0311301_10259210 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
| 3300032180|Ga0307471_100003956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8992 | Open in IMG/M |
| 3300032180|Ga0307471_100059813 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300032180|Ga0307471_100202161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
| 3300032205|Ga0307472_100510836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
| 3300032205|Ga0307472_101018399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300032205|Ga0307472_101396096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300032205|Ga0307472_101718687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300032515|Ga0348332_13827897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300034125|Ga0370484_0085745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.07% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.62% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.27% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.82% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.57% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.90% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.90% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.67% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.67% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.67% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.45% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.45% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.45% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.45% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.45% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.22% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.22% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.22% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.22% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.22% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.22% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.22% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.22% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.22% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.22% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.22% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.22% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025494 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_01420070 | 2170459005 | Grass Soil | MKTKRLALLVLLGSIAVVPVAKAQVKHVEMRVEGMT |
| INPgaii200_08736902 | 2228664022 | Soil | MNAKQIALLMLLGTTAMPVAQAQIKHIEMRVEGMT |
| INPhiseqgaiiFebDRAFT_1018038022 | 3300000364 | Soil | MNAKQIALLMLLGTTAMPVAQAQIKHIEMRVEGMT* |
| INPhiseqgaiiFebDRAFT_1018041687 | 3300000364 | Soil | MEWKNLALLALLGLLIAPAAQAQIKHIEMRVEGMT* |
| INPhiseqgaiiFebDRAFT_1018046052 | 3300000364 | Soil | MNTKRVALLVLLGSMVVVPVAQGQIKHIEMRVEGMT* |
| INPhiseqgaiiFebDRAFT_1018050933 | 3300000364 | Soil | MGSNRAVLLIVLCGTMAIVPVVQAQIKHIEMRVEGMT* |
| JGI12270J11330_1000085019 | 3300000567 | Peatlands Soil | MNTKRVALLVLLGSMIVVPVAQAQIKHIEMRVEGMT* |
| JGI12270J11330_1000878112 | 3300000567 | Peatlands Soil | MNRKRVALLVLLGSMVVVPVAQAKIKHIEMRVEGMT* |
| JGI12270J11330_100836274 | 3300000567 | Peatlands Soil | MNTKRVAMLVLLGSMVVVPVAQAQVKHIEMRVEGMT* |
| AP72_2010_repI_A01DRAFT_10039556 | 3300000579 | Forest Soil | MKKAALILVLLGSIIVVPVAKAQIKHIEMRVEGMT* |
| AP72_2010_repI_A10DRAFT_10598201 | 3300000651 | Forest Soil | MKKAALILVLLGSIIFVPVAKAQIKHIEMRVEGMT* |
| JGI12636J13339_10000546 | 3300001154 | Forest Soil | MNRKRIALLVLLGPIVVVPVAQAQINHIEMRVEGMT* |
| C688J14111_100008182 | 3300001305 | Soil | MEMKRTALILLLLGSTIVVPVAEAQVKHIEMRVEGMT* |
| JGI12635J15846_100156788 | 3300001593 | Forest Soil | MNKKVALLILLGSMVAPVAQAQIKHIEMRVEGMT* |
| JGI12635J15846_105645802 | 3300001593 | Forest Soil | MNKKLALFVLLGSIIAPVAQAQIKHIELRVEGMT* |
| JGIcombinedJ26739_1000974893 | 3300002245 | Forest Soil | MKTRRITLLVLLGSIVVVPVAQAQVKHIEMRVEGMT* |
| JGIcombinedJ26739_1008349362 | 3300002245 | Forest Soil | MNKKVALLILLGSMVVPVAQAQIKHIEMRVEGMT* |
| JGI25385J37094_100612831 | 3300002558 | Grasslands Soil | RKGGTMNTKKMALFVVLGSMVVLPVAQAQIKHIEMRVEGMT* |
| JGI25382J43887_103274951 | 3300002908 | Grasslands Soil | TFEKGGTMNTKRIALLVLLGSMVVMSVAQAQIKHLEMRVEGMT* |
| JGI26337J50220_10013053 | 3300003370 | Bog Forest Soil | MVKGGTMKRKGLLLLALAGLMVVPAAQAQIKHIEMRVEGMT* |
| Ga0062385_106632231 | 3300004080 | Bog Forest Soil | CTFKKGGTMNMKRVALLVLLGSMVVVPVAQAQVKHIEMRVEGMT* |
| Ga0062388_1022974552 | 3300004635 | Bog Forest Soil | VKGGTMNSKNVALVALLCFMAVPAAQAQIKHIEMRVEGMT* |
| Ga0066683_106823651 | 3300005172 | Soil | FAPLRKGGTMNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0066388_1045404823 | 3300005332 | Tropical Forest Soil | GGTMDTKKLALLVLFGSTLLMPAAQAQIKHIEMRVEGMT* |
| Ga0066682_101969751 | 3300005450 | Soil | APLRKGGTMNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0070741_1000623622 | 3300005529 | Surface Soil | VKNKLAIFLVLLGSIVVLPLAKAQVKHIEMRVEGMT* |
| Ga0070741_102574242 | 3300005529 | Surface Soil | MRMNRAALALVLLGGVVVVPVAKPQVKHIEMRVEGMT* |
| Ga0070739_1000713612 | 3300005532 | Surface Soil | MKSKAAIFLVLLGSILVMPMATAQVKHIEMRVEGMT* |
| Ga0070739_100687913 | 3300005532 | Surface Soil | MRSRAAIFLVLLGSILVMPLATAQVKHIEMRVEGMT* |
| Ga0070730_101042153 | 3300005537 | Surface Soil | MNMKGVALLVLLGSMVVMPVAQAQVKHIEMRVEGMT* |
| Ga0066697_1000021210 | 3300005540 | Soil | MNTKRVALLALLISIVSPVAQAQIKHIEMRVEGMT* |
| Ga0066697_100841483 | 3300005540 | Soil | MNTKRIALLVLLGSMVVVSVAQAQIKHLEMRVEGMT* |
| Ga0066697_104870742 | 3300005540 | Soil | MNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0066697_105924362 | 3300005540 | Soil | MNTKRVALLVLLGSMVVVPVAQAQIKRIEMRVEGMT* |
| Ga0070733_100721752 | 3300005541 | Surface Soil | MNTKKKRIALLVLLGSIVVVPVAQAQIKHIEMRVEGMT* |
| Ga0070733_100790634 | 3300005541 | Surface Soil | MKTRTIALLALLGSTLVPAAQAQIKHIEMRVEGMT* |
| Ga0070733_107987271 | 3300005541 | Surface Soil | GGSMKTKGLLLAALAGFLAVPAAQAQIKHIEMRVEGMT* |
| Ga0070732_100268073 | 3300005542 | Surface Soil | MNMKRVALLVLLGSMVVVPIAQAQIKHIEMRVEGMT* |
| Ga0070732_100300544 | 3300005542 | Surface Soil | MHIKRVALLVLLGAMVVVPVAEAQIKHIEMRVEGMT* |
| Ga0070732_100519142 | 3300005542 | Surface Soil | MKKKAVLLILLGAVVAPMAQAQIKHIEMRVEGMT* |
| Ga0070732_100573402 | 3300005542 | Surface Soil | MNTRKIALLALFVSIAAPAAQAQIKHIEMRVEGMT* |
| Ga0066701_101680082 | 3300005552 | Soil | MNTKKMALFVVLGSMVVLPVAQAQIKHIEMRVEGMT* |
| Ga0066701_107322391 | 3300005552 | Soil | MNTKKIALLVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0066701_108908891 | 3300005552 | Soil | MNTKKMALFVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0066661_100044153 | 3300005554 | Soil | MNTKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0066661_100081152 | 3300005554 | Soil | MKRKLALLLLAGCVSVPQLKAQIKHIEMRVEGMT* |
| Ga0066661_104684371 | 3300005554 | Soil | MNTKNLALLALLGSMVAPMAQAQIKHIEMRVEGMT* |
| Ga0066661_108345782 | 3300005554 | Soil | MKTMKMAMLVLLGSIVVVPAATAQIKHIEMRVEGMT* |
| Ga0066692_105820482 | 3300005555 | Soil | MNTKKLALLALLVSMVSPVAQAQIKHIEMRVEGMT* |
| Ga0066692_106471822 | 3300005555 | Soil | MNTKKIALLVLFGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0066704_103143972 | 3300005557 | Soil | MSRKRVALLVLLGSIVVVPIAQAQIKHIEMRVEGMT* |
| Ga0066670_101338211 | 3300005560 | Soil | MSRKRVALLVLLGSIIVVPIAQGQIKHIEMRVEGMT* |
| Ga0066693_101782583 | 3300005566 | Soil | PLRKGGTMNTKKIALLVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0066693_103738942 | 3300005566 | Soil | MSRKRVGLLVLLGSIVVVPIAQAQIKHIEMRVEGMT* |
| Ga0066705_109342412 | 3300005569 | Soil | MNKKNFGLLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0068857_1018679672 | 3300005577 | Corn Rhizosphere | MNSKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0066654_108295061 | 3300005587 | Soil | MNKKRVALLVLVGSMFVVPGAQAQVKHIEMRVEGMT* |
| Ga0070761_104828301 | 3300005591 | Soil | MNMKRVALLVLLGSMIVVPVAQAQVKHIEMRVEGMT* |
| Ga0066706_104108783 | 3300005598 | Soil | MNKKKFGLLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0070762_104024832 | 3300005602 | Soil | MKTKKVAMLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0070763_105395622 | 3300005610 | Soil | MNRKNIALLILLGMMVGPMAQAQIKHIEMRVEGMT* |
| Ga0070763_105826902 | 3300005610 | Soil | MNVKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT* |
| Ga0070763_106609152 | 3300005610 | Soil | MNMKRVALLVLLGSMVVVPVAQAQVKHIEMRVEGMT* |
| Ga0068856_1018667682 | 3300005614 | Corn Rhizosphere | MSVRNFALFVLLGSVMIGPAAEAQMKHIEMRVEGMT* |
| Ga0066903_1002086122 | 3300005764 | Tropical Forest Soil | MNKRVALLLLLGFVVAPMSQAQVKHIEMRVEGMT* |
| Ga0066903_1012288412 | 3300005764 | Tropical Forest Soil | MQWKNLALLALLGLLIAPAAQAQIKHIEMRVEGMT* |
| Ga0066903_1026008732 | 3300005764 | Tropical Forest Soil | MDRKRIALLILLGSMIVVPATQAQIQHIEMRVEGMT* |
| Ga0070766_104445652 | 3300005921 | Soil | MNMKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0066795_101807562 | 3300005938 | Soil | MNRKNFALLVLLGLMVGPMAQAQIKHIEMRVEGMT* |
| Ga0066789_100714412 | 3300005994 | Soil | MNTKRVALLVLLGSIVVVSVAQAQVKHIEMRVEGMT* |
| Ga0066789_100993002 | 3300005994 | Soil | MNRKNFAMLVLLGMMVGPMAQAQIKHIEMRVEGMT* |
| Ga0066656_104677851 | 3300006034 | Soil | TKRIALLVLLGSIVVVPVAKAQIKHIEMRVEGMT* |
| Ga0075023_1002146931 | 3300006041 | Watersheds | MNTKKVALLVLLGSMVVVPVAQTQIKHIEMRVEGMT* |
| Ga0075028_1000206134 | 3300006050 | Watersheds | MNMKRVALLVLLGSTVVVPVAQAQVKHIEMRVEGMT* |
| Ga0075028_1000758152 | 3300006050 | Watersheds | MKTKRVALLVLLGSIVVVPVAQAQVKHIEMRVEGMT* |
| Ga0075028_1004592162 | 3300006050 | Watersheds | MNKKNFALLILLGLMVGPMAQAQIKHIEMRVEGMT* |
| Ga0075029_1000063835 | 3300006052 | Watersheds | MNTKRMAFLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0075029_1000300275 | 3300006052 | Watersheds | MNTKKLALLALLVSIVGPVAQAQIKHIEMRVEGMT* |
| Ga0075029_1000336495 | 3300006052 | Watersheds | MSTKRIALLVLLGSMVVVPVDQAQIKHIEMRVEGMT* |
| Ga0075017_10000036213 | 3300006059 | Watersheds | MNAKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT* |
| Ga0075017_1000732913 | 3300006059 | Watersheds | MNTKRVALMVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0075015_1007213102 | 3300006102 | Watersheds | MMNRKKLALLVFLGLMVGPMAQAQIKHIEMRVEGMT* |
| Ga0075015_1008233311 | 3300006102 | Watersheds | IFEKGGTMNTKRVALLVLLGSMVVVPPAQAQIKHIEMRVEGMT* |
| Ga0075030_1000075902 | 3300006162 | Watersheds | MNTRRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0075030_1000963084 | 3300006162 | Watersheds | MKRKRLALLALLGLFAVPAAQAQIKHIEMRVEGMT* |
| Ga0075030_1002488343 | 3300006162 | Watersheds | MKTRRLALLVLLGSIVVVPAAKAQVKHIEMRVEGMT* |
| Ga0075018_100224346 | 3300006172 | Watersheds | MKTKRVALLVLLGSIMVVPVAQAQIKHIEMRVEGMT* |
| Ga0075018_104751582 | 3300006172 | Watersheds | MNRKIALLVLLGSIVAPIGQAQVKHIEMRVEGMT* |
| Ga0075014_1007154232 | 3300006174 | Watersheds | MNKKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0070712_1001300392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWKNLALLALLGLLIAAAAQAQIKHIEMRVEGMT* |
| Ga0070765_1000009745 | 3300006176 | Soil | MNARKLTFLFLLGSMFVPAAQAQIKHIEMRVEGMT* |
| Ga0070765_1000200152 | 3300006176 | Soil | MNAKKLALLALLISIVSPMAQAQIKHIEMRVEGMT* |
| Ga0070765_1001292523 | 3300006176 | Soil | MNKKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT* |
| Ga0070765_1001785302 | 3300006176 | Soil | MKRKELTLLALLGFFLVPTAQAQIKHIEMRVEGMT* |
| Ga0075521_103890422 | 3300006642 | Arctic Peat Soil | MNRKNFALLILCGMMVGPMAQAQIKHIEMRVEGMT* |
| Ga0066658_105075812 | 3300006794 | Soil | MNTKKIALLVLLGSMVVVPVAHAQIKHIEMRVEGMT* |
| Ga0066659_114555322 | 3300006797 | Soil | MNTKKIALLVLLGSMLVVPVAQAQIKHIEMRVEGMT* |
| Ga0066660_100186211 | 3300006800 | Soil | MSRKRVALLVLLGSIVVVPIAQAQIKHIEMRVEGMTCNF |
| Ga0066660_104455712 | 3300006800 | Soil | MKRSALMLVLLGSMVVMPVAKAQVKHIEMRVEGMT* |
| Ga0066660_108695842 | 3300006800 | Soil | MNTKRIALVVMLGSMVVVPGAHAQIKHIEMRVEGMT* |
| Ga0079220_100662022 | 3300006806 | Agricultural Soil | MNPKKIALLVLLGCQLAPVTEAQVKHIEMRVEGMT* |
| Ga0073928_100106734 | 3300006893 | Iron-Sulfur Acid Spring | MNSKKLALLVVLGFTFVPVAQAQIKHIEMRVEGMT* |
| Ga0073928_100248831 | 3300006893 | Iron-Sulfur Acid Spring | MKRKSLLLLALTGFMVVPAAQAQIKHIELRVEGMT* |
| Ga0073928_100305475 | 3300006893 | Iron-Sulfur Acid Spring | MNRKNLALMALLGLMAVPAAQAQIKHIEMRVEGMT* |
| Ga0073928_101897232 | 3300006893 | Iron-Sulfur Acid Spring | MNIKRVALLVLLGSMVVVPVARAQVKHIEMRVEGMT* |
| Ga0075426_103618621 | 3300006903 | Populus Rhizosphere | MNSKRVALLVLLCSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0075424_1021378951 | 3300006904 | Populus Rhizosphere | MNTKKLALLVLLGSTLLVPAAQAQIKHIEMRVEGMT* |
| Ga0099794_100186784 | 3300007265 | Vadose Zone Soil | MMNTKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT* |
| Ga0099794_101184702 | 3300007265 | Vadose Zone Soil | MKVKQFALLVLFGSMLVPVAQAQIRHIEMRVEGMT* |
| Ga0099795_100081683 | 3300007788 | Vadose Zone Soil | MNKKLALFILLGSILTPIAQAQIKHIEMRVEGMT* |
| Ga0099795_105562541 | 3300007788 | Vadose Zone Soil | MKAKKIALLMLLGCALGPVAQAQIKHIEMRVEGMT* |
| Ga0102924_10038639 | 3300007982 | Iron-Sulfur Acid Spring | VKGGMMKGKSLLVLALTGIIVVPAAQAQIKHIEMRVEGMT* |
| Ga0102924_11619213 | 3300007982 | Iron-Sulfur Acid Spring | MNTKRVAMLLLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0066793_103255981 | 3300009029 | Prmafrost Soil | PLRKGGTMNTKNFALLILLGLMVGPMAQAQIKHIEMRVEGMT* |
| Ga0099829_100316225 | 3300009038 | Vadose Zone Soil | MNTKKLALLALLGSMVAPMAQAQIKHIEMRVEGMT* |
| Ga0099829_100360131 | 3300009038 | Vadose Zone Soil | MKTRRIALLVLLGSMIVVPVVQAQIKHIEMRVEGMT* |
| Ga0099829_100552503 | 3300009038 | Vadose Zone Soil | MNRKKLALLVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0099830_100103824 | 3300009088 | Vadose Zone Soil | MNTKKLALIALLGSMVAPMAQAQIKHIEMRVEGMT* |
| Ga0099830_109735212 | 3300009088 | Vadose Zone Soil | MKTRRIALPVLLGSMIVVPVVQAQIKHIEMRVEGMT* |
| Ga0099827_101184732 | 3300009090 | Vadose Zone Soil | MNTKRIALLVLLGSMVVMSVAQAQIKHLEMRVEGMT* |
| Ga0099827_103829202 | 3300009090 | Vadose Zone Soil | MNTKRVALLLLLGSVVVVPVAQAQIKHIEMRVEGMT* |
| Ga0066709_1000699583 | 3300009137 | Grasslands Soil | MNTKRVALLILLGSMVVVPVAQAQIKRIEMRVEGMT* |
| Ga0066709_1019680852 | 3300009137 | Grasslands Soil | MKTKRIALLVLLGSMVVVSVAQAQIKHLEMRVEGMT* |
| Ga0099792_100027666 | 3300009143 | Vadose Zone Soil | MMNTKRIALVVLLGSMIVAPMAQAQIKHIEMRVEGMT* |
| Ga0099792_101428611 | 3300009143 | Vadose Zone Soil | MNRKRLALLVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0099792_103608302 | 3300009143 | Vadose Zone Soil | MKAKKIALLVLLGCALGPVAQAQIKHIEMRVEGMT* |
| Ga0116102_10647442 | 3300009632 | Peatland | MNIKIFARLVLFGSMIVVGPVAQAQIKHIEIRVEGMT* |
| Ga0116110_10075995 | 3300009643 | Peatland | MNIKIFARLVLFGSMIVVGPVAQAQINHIEMRVEGMT* |
| Ga0116216_105676352 | 3300009698 | Peatlands Soil | MRVKKFALLVLLGSIFGPVAQAQIKHIEMRVEGMT* |
| Ga0116216_107300132 | 3300009698 | Peatlands Soil | RIKNFALLVLLGSMIAPAAQAQIKHIEMRVEGMT* |
| Ga0116217_105001932 | 3300009700 | Peatlands Soil | MRIKNFALLVLLGSMIAPAAQAQIKHIEMRVEGMT* |
| Ga0116223_100355113 | 3300009839 | Peatlands Soil | MNTKRVAMLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0116223_105384442 | 3300009839 | Peatlands Soil | MNTRILARLVLFASMIVVVPVAQAQIKHIEMRVEGMT* |
| Ga0116223_106139152 | 3300009839 | Peatlands Soil | ATPIKGGETMRVKKFALLVLLGSIFGPVAQAQIKHIEMRVEGMT* |
| Ga0126380_101455283 | 3300010043 | Tropical Forest Soil | MGTKRAVVLIALLGTMAIVPAVQAQIKHIEMRVEGMT* |
| Ga0126373_100051302 | 3300010048 | Tropical Forest Soil | MNKRIALLLLLGCVIASTSQAQVKHIEMRVEGMT* |
| Ga0126373_112565972 | 3300010048 | Tropical Forest Soil | MKAGRMAMLVLLGSMVFVPAATAEVKHIEMRVEGMT* |
| Ga0134065_100219942 | 3300010326 | Grasslands Soil | MNTKRVALLALLISIVSPVAQAQINHIEMRVEGMT* |
| Ga0134065_100312391 | 3300010326 | Grasslands Soil | FAPLRKRGTMNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0134111_101252673 | 3300010329 | Grasslands Soil | MNTKRIALIVLLGSMLVVPVAQAQIKHIEMRVEGMT* |
| Ga0074044_100388245 | 3300010343 | Bog Forest Soil | VKGGTMKRKNIALLALLGLMVVPAAQAQVKHIEMRVEGMT* |
| Ga0074044_100589843 | 3300010343 | Bog Forest Soil | MNRKFVLLALLNMIVVPAAQAQIKHIEMRVEGMT* |
| Ga0074044_108605121 | 3300010343 | Bog Forest Soil | MNAKKLALLALLISIVSPVAQAQIKHIEMRVEGMT* |
| Ga0126370_116914502 | 3300010358 | Tropical Forest Soil | MKTKIALLVLLGSMVVVPGAQAQMKHIEMRVEGMT* |
| Ga0134125_100264666 | 3300010371 | Terrestrial Soil | MKGSVLMLVLLGSIMVVPMATAQVKHIEMRVEGMT* |
| Ga0134125_101456473 | 3300010371 | Terrestrial Soil | MNMRMNRAALALVLLGGVVVVPVAKAQVKHIEMRVEGMT* |
| Ga0134125_103448392 | 3300010371 | Terrestrial Soil | MSVRNFALFVLLGSVMIGPAAEAQVKHIEMRVEGMT* |
| Ga0136449_1000238708 | 3300010379 | Peatlands Soil | MMIRKKLALLALLGLFVVPAAQAQIKHIEMRVEGMT* |
| Ga0136449_1000685428 | 3300010379 | Peatlands Soil | MNRKNFALLIFLGLMVGPMAQAQIKHIEMRVEGMT* |
| Ga0136449_1001664747 | 3300010379 | Peatlands Soil | VNRKKLALLALLVSVVSPVAQAQIKHIEMRVEGMT* |
| Ga0136449_1002103513 | 3300010379 | Peatlands Soil | MHRKNFALLVLLGSIIVVVPVAQAQIKHIEMRVEGMT* |
| Ga0136449_1008681222 | 3300010379 | Peatlands Soil | MKIKNLARVVLFGSMIVVAPVAQAQIKHIEMRVEGMT* |
| Ga0136449_1023028882 | 3300010379 | Peatlands Soil | VKGGKMKRKNLALLAFLGLLIVPAAQAQIKHIEMRVEGMT* |
| Ga0126352_10513701 | 3300010859 | Boreal Forest Soil | MNMKRVALLVLLGSMVVVPAAKAQIKHIEMRVEGMT* |
| Ga0137392_100595544 | 3300011269 | Vadose Zone Soil | MKLKQFALLVLFGSMLVPVAQAQIRHIEMRVEGMT* |
| Ga0137392_113008831 | 3300011269 | Vadose Zone Soil | TMNTKKMALFVVLGSMVVLPVAQAQIKHIEMRVEGMT* |
| Ga0137391_100045645 | 3300011270 | Vadose Zone Soil | MNTGRRVALLVLLGSIVVVPVARAQVKHIEMRVEGMT* |
| Ga0137391_100100812 | 3300011270 | Vadose Zone Soil | MNTKKLALLALLVSIVCPVAQAQIKHIEMRVEGMT* |
| Ga0137393_100022747 | 3300011271 | Vadose Zone Soil | MMNTKRIALVVLLGSMVVAPMAQAQIKHIEMRVEGMT* |
| Ga0137393_105188602 | 3300011271 | Vadose Zone Soil | MNTKRVALLVLLGSMVVVPVAQAQVKHIEMRVEGMT* |
| Ga0137383_106965471 | 3300012199 | Vadose Zone Soil | MNTKTLALLALLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0137383_111411811 | 3300012199 | Vadose Zone Soil | MNTKRIALLVLLGSMVVVSVAQAQIRHLEMRVEGMT |
| Ga0137363_100349165 | 3300012202 | Vadose Zone Soil | MTAKKLALLLLLGSMVMPIAQGQVKHIEMRVEGMT* |
| Ga0137363_100365781 | 3300012202 | Vadose Zone Soil | MNTKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT* |
| Ga0137363_101687592 | 3300012202 | Vadose Zone Soil | MKTRKLALLVLLGFALVPISRAQVKHIEMRVEGMT* |
| Ga0137363_109152462 | 3300012202 | Vadose Zone Soil | MNTKKMALFVVLGSMVVLPVAQAQIKHSEMRVEGMT* |
| Ga0137399_102494364 | 3300012203 | Vadose Zone Soil | MNTKRMALLALLVSIVSPAAQAQIKHIEMRVEGMT* |
| Ga0137362_107460342 | 3300012205 | Vadose Zone Soil | MNTKKMALFVVLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0137362_111476841 | 3300012205 | Vadose Zone Soil | MKAKKIALLVLLGCALGPVAQAQIKHIEMRVEDMT* |
| Ga0137380_110787503 | 3300012206 | Vadose Zone Soil | NTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0137381_103750881 | 3300012207 | Vadose Zone Soil | KGGTMNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0137381_110769051 | 3300012207 | Vadose Zone Soil | MNTKRIALLVLLGSMVVVSVAQAQIKHLEMRVEGM |
| Ga0137378_100628963 | 3300012210 | Vadose Zone Soil | MKTKRVALLVLLGSMVVVPVAEAQVKHIEMRVEGMT* |
| Ga0137377_118824321 | 3300012211 | Vadose Zone Soil | LRKGGTMNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT* |
| Ga0137377_119227841 | 3300012211 | Vadose Zone Soil | MNTKKIALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0137384_113578362 | 3300012357 | Vadose Zone Soil | MNTKKMALFVLLGSIVVVPAAQAQIKHIEMRVEGMT* |
| Ga0137385_107028032 | 3300012359 | Vadose Zone Soil | MNTKRVVLLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0137360_100222463 | 3300012361 | Vadose Zone Soil | MNRKYLAMLVMFGSLLISAAQAQIKHIEMRVEGMT* |
| Ga0137390_102204302 | 3300012363 | Vadose Zone Soil | MNTKRIVLVVLLGSMVVVPMAQAQIKHIEMRVEGMT* |
| Ga0134046_10692222 | 3300012386 | Grasslands Soil | NTKRVALLALLISIVSPVAQAQIKHIEMRVEGMT* |
| Ga0137395_110311002 | 3300012917 | Vadose Zone Soil | NNFGYTFKEGETMNTGRRVALLVLLGSIVVVPVARAQVKHIEMRVEGMT* |
| Ga0137396_102067662 | 3300012918 | Vadose Zone Soil | MKVKQFALLVLFGSMLMPVAQAQIRHIEMRVEGMT* |
| Ga0137394_100440505 | 3300012922 | Vadose Zone Soil | MNRKLALLILLGSIVVPIAQAQIKHIEMRVEGMT* |
| Ga0137407_109640231 | 3300012930 | Vadose Zone Soil | MKTRKLALLVLLGFALVPISQAQVKHIEMRVEGMT* |
| Ga0137410_114807081 | 3300012944 | Vadose Zone Soil | MKTKRIVLLLVLLGPIVVVPVAKAQVKHIEMRVEGMT* |
| Ga0164305_115261702 | 3300012989 | Soil | MNRKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0182018_100021768 | 3300014489 | Palsa | MNTKKLALLALLGLMFVPTAQAQIKHIEMRVEGMT* |
| Ga0182018_100465213 | 3300014489 | Palsa | MKMKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT* |
| Ga0182014_101759112 | 3300014491 | Bog | MDTKTLARLVLFGSMIFVVPVAQAQIKHIEMRVEGMT* |
| Ga0182015_100030552 | 3300014495 | Palsa | MNTKNLALLALLGLMFVPTAQAQIKHIEMRVEGMT* |
| Ga0182015_100250263 | 3300014495 | Palsa | MKMKRVALLVLLGSIAVVPVVQAQIKHIEMRVEGMT* |
| Ga0182008_100834003 | 3300014497 | Rhizosphere | MNRRYLALLLLAGSVFVTPRLEAQVKHIEMRVEGMT* |
| Ga0182024_1000112637 | 3300014501 | Permafrost | MNRKNVALVALLCFMAVPVAQAQIKHIEMRVEGMT* |
| Ga0182024_100710467 | 3300014501 | Permafrost | MVKGGTMKRKSLLLLALAGFMVVPAAQAQIKHIEMRVEGMT* |
| Ga0182024_101900163 | 3300014501 | Permafrost | VKGETMKRKSLLLLALAGFMVVPAAQAQIKHIEMRVEGMT* |
| Ga0182024_113159871 | 3300014501 | Permafrost | MNRKIVVLLALLGLLVVPAAQAQIKHIEMRVEGMT* |
| Ga0137418_100033203 | 3300015241 | Vadose Zone Soil | MNTKKMALLALLVSIVSPAAQAQIKHIEMRVEGMT* |
| Ga0134089_101721262 | 3300015358 | Grasslands Soil | MNTKKMALFVLLGSLVVVPVAQAQIKHIEMRVEGMT* |
| Ga0134069_12030342 | 3300017654 | Grasslands Soil | MNTKKMALFVLLGSMVVVRAAQAQIKHIEMRVEGMT |
| Ga0134112_100076803 | 3300017656 | Grasslands Soil | MNTKRVALLALLISIVSPVAQAHIKHIEMRVEGMT |
| Ga0187879_101173202 | 3300017946 | Peatland | MNIKIFARLVLFGSMIVVGPVAQAQINHIEMRVEGMT |
| Ga0187781_100159642 | 3300017972 | Tropical Peatland | MDFRKLALLTLLAATAVPAAQAQIKHIEMRVEGMT |
| Ga0187883_102560573 | 3300018037 | Peatland | MNRKIVVLLALLGLLVVPAAQAQIKHIEMRVEGMT |
| Ga0187862_105002272 | 3300018040 | Peatland | MNIKIFARLVLFGSMIVVGPVAQAQIKHIEMRVEGMT |
| Ga0066655_100005159 | 3300018431 | Grasslands Soil | MNTKRVALLALLISIVSPVAQAQIKHIEMRVEGMT |
| Ga0066655_100659963 | 3300018431 | Grasslands Soil | MSRKRVALLVLLGSIVVVPIAQAQIKHIEMRVEGMT |
| Ga0066655_102671502 | 3300018431 | Grasslands Soil | MNTKKMALFVLLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0066667_107604422 | 3300018433 | Grasslands Soil | MNKKKFGLLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0066662_102179852 | 3300018468 | Grasslands Soil | MKTMKMAMLVLLGSIVVVPAATAQIKHIEMRVEGMT |
| Ga0066662_109386272 | 3300018468 | Grasslands Soil | MNTKRIALLVLLGSMVVMSVAQAQIKHLEMRVEGMT |
| Ga0066662_115541022 | 3300018468 | Grasslands Soil | MKRSALMLVLLGSMVVMPVAKAQVKHIEMRVEGMT |
| Ga0066662_129504132 | 3300018468 | Grasslands Soil | MNTKKLALLALLVSMVSPVAQAQIKHIEMRVEGMT |
| Ga0193728_10079187 | 3300019890 | Soil | MKTRTGRRIALLLLLGSTVVVPVARAQVKHIEMRVEGMT |
| Ga0210407_1000309412 | 3300020579 | Soil | MNQKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0210407_100095127 | 3300020579 | Soil | MNSKKLALLVVLGFTFVPVAQAQIKHIEMRVEGMT |
| Ga0210407_100110378 | 3300020579 | Soil | MNTKKLALLALLGSMLVPVAQAQIKHIEMRVEGMT |
| Ga0210407_100652412 | 3300020579 | Soil | MNMKRVALLLLLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0210407_102573873 | 3300020579 | Soil | MNTKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0210407_105884042 | 3300020579 | Soil | MKRKNLALLAFLGLLIVPAAQAQIKHIEMRVEGMT |
| Ga0210403_1000002185 | 3300020580 | Soil | MITKKLALVALLISIVSPVAQAQIKHIEMRVEGMT |
| Ga0210403_100044728 | 3300020580 | Soil | MNTRRLALLALLVSIASTAAQAQIKHIEMRVEGMT |
| Ga0210403_100093844 | 3300020580 | Soil | MNKMNLMKSRLALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0210403_100487555 | 3300020580 | Soil | MKRIALILVLLGSIVVVPVAKAQIKHIEMRVEGMT |
| Ga0210403_101485974 | 3300020580 | Soil | MNMKRVALLVLLGSVVVVPVAQAQVKHIEMRVEGMT |
| Ga0210403_101924953 | 3300020580 | Soil | MNRKRIALLVLLGSIVVVPVAQAQIKHVEMRVEGMT |
| Ga0210399_101499862 | 3300020581 | Soil | MKTAKIALFVLLGSTLAPVAQAQIKHIEMRVEGMT |
| Ga0210399_106081751 | 3300020581 | Soil | MNTKKLALFALLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0210399_109162092 | 3300020581 | Soil | MNTKRVAMLVLLGSIVVVPVAQAQIKHIEMRVEGMT |
| Ga0210399_109426121 | 3300020581 | Soil | MNRKNLALVALLCFMAVPAAQAQIKHIEMRVEGMT |
| Ga0210399_110719322 | 3300020581 | Soil | MNMKRVALLVLLGSMVVVPVAEAQVKHIEMRVEGMT |
| Ga0210395_104046813 | 3300020582 | Soil | MNSKKLALLVVLGFTFVPAAQAQIKHIEMRVEGMT |
| Ga0210395_109188811 | 3300020582 | Soil | MKTKKVAMLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0210401_102907922 | 3300020583 | Soil | MNTKRIALLVLLGSMAVVSAAEAQIKHIEMRVEGMT |
| Ga0210401_107223051 | 3300020583 | Soil | MNTKKLVLLALLVSIVGPVAQAQIKHIEMRVEGMT |
| Ga0210401_108778622 | 3300020583 | Soil | MNTKRVAMLLLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0210401_112528322 | 3300020583 | Soil | MNRIPLTLAVLLSALVVPAAQAQIKHIEMRVEGMT |
| Ga0215015_100464851 | 3300021046 | Soil | MDTKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0179596_104207092 | 3300021086 | Vadose Zone Soil | MKAKKIALLMLLGCALGPVAQAQIKHIEMRVEGMT |
| Ga0210404_1000010031 | 3300021088 | Soil | MNMKRVALLVLLGSMVVLPVAEAQVKHIEMRVEGMT |
| Ga0210406_109135592 | 3300021168 | Soil | MSVRNFALFVLLGSVMIGPAAEAQVKHIEMRVEGMT |
| Ga0210400_100000475 | 3300021170 | Soil | MNTQRLALLALLGSMLVPVAQAQIKHIEMRVEGMT |
| Ga0210400_100425964 | 3300021170 | Soil | MNTRRMRTSRKSLALLILLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0210400_103546721 | 3300021170 | Soil | ASLTIGGKMNGKKLALLVVLGFTFVPAAQAQIKHIEMRVEGMT |
| Ga0210405_10000011182 | 3300021171 | Soil | MNTKRLALLVLLGSMVVVPVAEAQIKHIEMRVEGMT |
| Ga0210405_1000023774 | 3300021171 | Soil | MKTKKVAMLVLLGSMVVVLVAQAQIKHIEMRVEGMT |
| Ga0210405_100118203 | 3300021171 | Soil | MSTKKLALLALLVSIVCPAAQAQIKHIEMRVEGMT |
| Ga0210405_100296473 | 3300021171 | Soil | MNTKKLALLALLVSIVSPAAQAQIKHIEMRVEGMT |
| Ga0210405_100814954 | 3300021171 | Soil | MNSKKFALLVVLGFTFVPVAQAQIKHIEMRVEGMT |
| Ga0210408_110909882 | 3300021178 | Soil | FKRGGTMRRKILVNLVLLGSIIVVPVAQAQVKHIEMRVEGMT |
| Ga0210396_100117967 | 3300021180 | Soil | MNTKKLALLALLISIVSAVAQAQIKHIEMRVEGMT |
| Ga0210396_103262972 | 3300021180 | Soil | MNVRKIGLFCLLTFVFVPAAQAQIKHIEMRVEGMT |
| Ga0210396_109248652 | 3300021180 | Soil | MNAKKLALLALLGSMVVPVAQAQIKHIEMRVEGMT |
| Ga0210393_103470881 | 3300021401 | Soil | MNMKSVALLVLLGSMVVVPVAEAQVKHIEMRVEGMT |
| Ga0210397_105079082 | 3300021403 | Soil | MKTKRLALLVLLGSMVVVPVAKAQIKHIEMRVEGMT |
| Ga0210387_102795093 | 3300021405 | Soil | MNRKNLALLILFGMMVGPMAQAQIKHIEMRVEGMT |
| Ga0210387_115981752 | 3300021405 | Soil | TMNSKKLALLVVLGFTFVPVAQAQIKHIEMRVEGMT |
| Ga0210386_109686502 | 3300021406 | Soil | VKGGTMNRKNLALVALLCFMAVPAAQAQIKHIEMRVEGMT |
| Ga0210383_100076989 | 3300021407 | Soil | MNRKNFALLILFGMMVGPMAQAQIKHIEMRVEGMT |
| Ga0210383_100375545 | 3300021407 | Soil | MNTKKLARLALLVSMVSPVAQAQIKHIEMRVEGMT |
| Ga0210383_107823962 | 3300021407 | Soil | MRVKKFALLILLGSMFAPLAQAQIKHIEMRVEGMT |
| Ga0210383_114085281 | 3300021407 | Soil | MMNTKKLVLLVLLGSIAAPAAQAQIKHIEMRVEGMT |
| Ga0210394_100460374 | 3300021420 | Soil | MNTEKLVLLALLVSIVGPVAQAQIKHIEMRVEGMT |
| Ga0210394_107856471 | 3300021420 | Soil | MNAKKLALLALLISIVSPVAQAQIKHIEMRVEGMT |
| Ga0210384_100166734 | 3300021432 | Soil | MRRKILVNLVLLGSIIVVPVAQAQVKHIEMRVEGMT |
| Ga0210384_103172902 | 3300021432 | Soil | MNTKKLALLALLISIVSPVAQAQIKHIEMRVEGMT |
| Ga0187846_100723653 | 3300021476 | Biofilm | MRIERIALLLVLASVFVPVAQAQIKHVEMRVEGMT |
| Ga0210402_101673014 | 3300021478 | Soil | MNTKRLALLVLLGSIVVVPVAKAQVQHIEMRVEGMT |
| Ga0210402_103675091 | 3300021478 | Soil | MRFAVKGGTMNITKFALLVLLGSIAAPAAQAQIKHIEMRVEGMT |
| Ga0210402_104108533 | 3300021478 | Soil | MNMKRAALLVLLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0210410_1000027057 | 3300021479 | Soil | MNTKRLALLALLGSMLVPVAQAQIKHIEMRVEGMT |
| Ga0210410_1000040539 | 3300021479 | Soil | MNRKRIAVLVLLGSIVVVPVAQAQIKHIEMRVEGMT |
| Ga0210410_107447713 | 3300021479 | Soil | EGRKTMNMKRVALLVLLGSMVVVPVAKAQIKHIEMRVEGMT |
| Ga0210409_100745164 | 3300021559 | Soil | MKVKQFALLVLFGSMLVPVAQAQIRHIEMRVEGMT |
| Ga0210409_101707294 | 3300021559 | Soil | MNIKKLALLALLVSIASPVAQAQIKHIEMRVEGMT |
| Ga0210409_105331852 | 3300021559 | Soil | MKTKRLALLVLLGSMVVVPVARAQIKHIEMRVEGMT |
| Ga0210409_108200242 | 3300021559 | Soil | MNTKRIALLVLSGLMVAAPMAEAQIKHIEMRVEGMT |
| Ga0126371_105005593 | 3300021560 | Tropical Forest Soil | MKEGTMNKRVALLLLLGFVVAPMSQAQVKHIEMRVEGMT |
| Ga0242662_101907141 | 3300022533 | Soil | RKEQIKMKRIALMLVLLGSIVVVPIAKAQIKHIEMRVEGMT |
| Ga0212123_1001482912 | 3300022557 | Iron-Sulfur Acid Spring | MNTKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0212123_1001498410 | 3300022557 | Iron-Sulfur Acid Spring | MKGKSLLVLALTGIIVVPAAQAQIKHIEMRVEGMT |
| Ga0212123_1001845913 | 3300022557 | Iron-Sulfur Acid Spring | MNRKNLALMALLGLMAVPAAQAQIKHIEMRVEGMT |
| Ga0212123_101957383 | 3300022557 | Iron-Sulfur Acid Spring | MKRKSLLLLALTGFMVVPAAQAQIKHIELRVEGMT |
| Ga0212123_102942082 | 3300022557 | Iron-Sulfur Acid Spring | MNIKRVALLVLLGSMVVVPVARAQVKHIEMRVEGMT |
| Ga0224550_10103663 | 3300022873 | Soil | MNTKKLALLALLGLMFVPTAQAQIKHIEMRVEGMT |
| Ga0224544_10004336 | 3300023250 | Soil | MKMKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0247691_10270272 | 3300024222 | Soil | MNRKKLALLALLASIVSPVAQAQIKHIEMRVEGMT |
| Ga0228598_10058973 | 3300024227 | Rhizosphere | MNTKRVALLVLLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0224564_10509221 | 3300024271 | Soil | KEETMNTKRVALLVLLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0224564_10978332 | 3300024271 | Soil | MNTKRVALLVLLGSIVVVPVAQAQIKHVEMRVEGMT |
| Ga0247668_10086072 | 3300024331 | Soil | MNRKNFALLALLGLLIAPAAQAQIKHIEMRVEGMT |
| Ga0207416_10071739 | 3300025134 | Iron-Sulfur Acid Spring | VKGGMMKGKSLLVLALTGIIVVPAAQAQIKHIEMRVEGMT |
| Ga0207928_11017182 | 3300025494 | Arctic Peat Soil | MNRKNFALLILLGMMVGPMAQAQIKHIEMRVEGMT |
| Ga0207927_10005145 | 3300025579 | Arctic Peat Soil | MNRKNSARLILLALMVGPMAEAQIKHIEMRVEGMT |
| Ga0207699_103853972 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRIALLLIVLGSIVVVPVARAQVKHIEMRVEGMT |
| Ga0207684_104809853 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTKRVALLLLLGSVVVVPVAQAQIKHIEMRVEGMT |
| Ga0207684_108638651 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTKRIALLVLLGSMVVVSVAQAQIKHLEMRVEGMT |
| Ga0207707_107177112 | 3300025912 | Corn Rhizosphere | MSVRNFALFVLLGSVMIGPAVEARVKHIEMRVEGMT |
| Ga0207652_100624922 | 3300025921 | Corn Rhizosphere | MSVRNFALFVLLGSVMIGPAVEAQVKHIEMRVEGMT |
| Ga0207646_1000420112 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTKKLALVVLLVAIVSPVAQAQIKHIEMRVEGMT |
| Ga0207646_104795562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTKKIALLVLLGSMVVVPVTQAQIKHIEMRVEGMT |
| Ga0207646_111005372 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTKRIALLVLLGSMVVVPVVQAQIKHIEMRVEGMT |
| Ga0209350_10202075 | 3300026277 | Grasslands Soil | MNTKKIALLVLLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0209890_100639763 | 3300026291 | Soil | MNTKRVALLVLLGSIVVVSVAQAQVKHIEMRVEGMT |
| Ga0209234_10937431 | 3300026295 | Grasslands Soil | SLQMKGGTMNTKRIALLVLLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0209237_10899993 | 3300026297 | Grasslands Soil | MNTKKMALFVVLGSMVVLPVAQAQIKHIEMRVEGMT |
| Ga0209469_10201842 | 3300026307 | Soil | MNTKKIALLVLLGSMLVVPVAQAQIKHIEMRVEGMT |
| Ga0209472_10051802 | 3300026323 | Soil | MNTKRIALIVLLGSMLVVPVAQAQIKHIEMRVEGMT |
| Ga0209152_102479102 | 3300026325 | Soil | MNTKKIALLVLLGSMVVVPVAHAQIKHIEMRVEGMT |
| Ga0209158_10034663 | 3300026333 | Soil | MNTKKMALFVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209158_10917144 | 3300026333 | Soil | KGGTMNTKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209377_12269742 | 3300026334 | Soil | MNTKKIALLVLFGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0257150_10321292 | 3300026356 | Soil | MNRKKVALLVLLGSMVVVPGAEAQIKHIEMRVEGMT |
| Ga0209056_100787813 | 3300026538 | Soil | MNKKNFGLLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209056_100901933 | 3300026538 | Soil | MNTKRVALLVLLGSMVVVPVAQAQIKRIEMRVEGMT |
| Ga0209474_101322111 | 3300026550 | Soil | APLGKGGIMNTKRVALLALLISIVSPVAQAQIKHIEMRVEGMT |
| Ga0209474_101631663 | 3300026550 | Soil | MSRKRVGLLVLLGSIVVVPIAQAQIKHIEMRVEGMT |
| Ga0209474_102323133 | 3300026550 | Soil | APLRKGRTMNTKRIALIVLLGSMLVVPVAQAQIKHIEMRVEGMT |
| Ga0209648_100031949 | 3300026551 | Grasslands Soil | MNTGRRVALLVLLGSIVVVPVARAQVKHIEMRVEGMT |
| Ga0209648_100857182 | 3300026551 | Grasslands Soil | MNTKKLALLALLVSIVCPVAQAQIKHIEMRVEGMT |
| Ga0209577_107851972 | 3300026552 | Soil | MKKKAIALLLLLGSIVVIPAAQAQVKHIEMRVEGMT |
| Ga0179587_101201993 | 3300026557 | Vadose Zone Soil | MNTKKMALLALLVSIVSPAAQAQIKHIEMRVEGMT |
| Ga0179587_102120071 | 3300026557 | Vadose Zone Soil | MNTKRMALLVLLGSMIVVPMAQAQIKHIEMRVEGMT |
| Ga0207778_1155992 | 3300026783 | Tropical Forest Soil | MSRKNFALLILFGMMVGPMAQAQIKHIEMRVEGMT |
| Ga0208365_10067562 | 3300027070 | Forest Soil | MNSKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0209214_10093002 | 3300027071 | Forest Soil | MNTKRVALLVLLGSMVVVPMAQAQIKHIEMRVEGMT |
| Ga0209010_10306872 | 3300027370 | Forest Soil | MNMKRVALLVLLGSMVVVPVAQAQVKHIEMRVEGMT |
| Ga0209004_10203773 | 3300027376 | Forest Soil | MNTKKLALLVLLSSTLLVPVAQAQIKHIEMRVEGMT |
| Ga0208984_10814282 | 3300027546 | Forest Soil | MHTKKLALLVLFGSIFMPVAQAQIKHIEMRVEGMT |
| Ga0209735_10005812 | 3300027562 | Forest Soil | MKTKTIALLVLLGSMLVPATQAQIKHIEMRVEGMT |
| Ga0209735_10026704 | 3300027562 | Forest Soil | MNGKKLVLAALLGLMVVPAAQAQIKHIEMRVEGMT |
| Ga0209219_10106293 | 3300027565 | Forest Soil | MNRKSLALLVLLGSLLAPAAQAQIKHIEMGVEGMT |
| Ga0209003_10570292 | 3300027576 | Forest Soil | MTTKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0208044_10031192 | 3300027625 | Peatlands Soil | MNRKRVALLVLLGSMVVVPVAQAKIKHIEMRVEGMT |
| Ga0208044_11957661 | 3300027625 | Peatlands Soil | KKGGTMNTKRVAMLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0208827_10850502 | 3300027641 | Peatlands Soil | MNTKRVAMLVLLGSMVVVPVAQAQVKHIEMRVEGMT |
| Ga0209117_10084133 | 3300027645 | Forest Soil | MNTKRIALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209217_10155913 | 3300027651 | Forest Soil | MKTRRITLLVLLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0209118_100001396 | 3300027674 | Forest Soil | MNRKRIALLVLLGPIVVVPVAQAQINHIEMRVEGMT |
| Ga0208991_12455692 | 3300027681 | Forest Soil | MNTKRMALVLLLGSMVVVPMAQAQIKHIEMRVEGMT |
| Ga0209446_10127992 | 3300027698 | Bog Forest Soil | MNRENFALLILLGLMVGPMVQAQIKHIEMRVEGMT |
| Ga0209447_1000080810 | 3300027701 | Bog Forest Soil | MRAKKFALLVLLGSMFTPVAQAQIKHIEMRVEGMT |
| Ga0209581_100111620 | 3300027706 | Surface Soil | MKSKAAIFLVLLGSILVMPMATAQVKHIEMRVEGMT |
| Ga0209248_100440251 | 3300027729 | Bog Forest Soil | KGGTMKRKGLLLLALAGLMVVPAAQAQIKHIEMRVEGMT |
| Ga0209038_100088472 | 3300027737 | Bog Forest Soil | MKRKGLLLLALAGLMVVPAAQAQIKHIEMRVEGMT |
| Ga0209908_100001703 | 3300027745 | Thawing Permafrost | MKMKRVALLVLLGSIAVVPVVQAQIKHIEMRVEGMT |
| Ga0209073_101209752 | 3300027765 | Agricultural Soil | MNPKKIALLVLLGCQLAPVTEAQVKHIEMRVEGMT |
| Ga0209772_100193054 | 3300027768 | Bog Forest Soil | MVKGGTMKRKGLLLLALAGLMVVPAAQAQIKHIEMRVEGMT |
| Ga0209448_100033722 | 3300027783 | Bog Forest Soil | MNSKSFALLALLGLMVVPVAQAQIKHIEMRVEGMT |
| Ga0209448_100059174 | 3300027783 | Bog Forest Soil | MNKKNFALLILLGLMVGPMAQAQIKHIEMRVEGMT |
| Ga0209448_100504632 | 3300027783 | Bog Forest Soil | MKRKNLALLALLGLLIAPLAQAQIKHIEMRVEGMT |
| Ga0209448_100689643 | 3300027783 | Bog Forest Soil | MNTKRVAMLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209656_100038182 | 3300027812 | Bog Forest Soil | MNTKRMAFLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209039_103704632 | 3300027825 | Bog Forest Soil | MNRKNFALLVLFGLMVGPMAQAQIQHIEMRVEGMT |
| Ga0209773_100753653 | 3300027829 | Bog Forest Soil | MKTNKLALLALLGLMFVPTAQAQIKHIEMRVEGMT |
| Ga0209773_101482432 | 3300027829 | Bog Forest Soil | MRAKKFALLVLLGSLIGPVAQAQIKHIEMRVEGMT |
| Ga0209515_100505966 | 3300027835 | Groundwater | MSTKKLALLALLIAMVAPVAQAQIKHIEMRVEGMT |
| Ga0209580_101150552 | 3300027842 | Surface Soil | MNMKRVAQLVLLGSMVVVPIAQAQIKHIEMRVEGMT |
| Ga0209580_101622462 | 3300027842 | Surface Soil | MHIKRVALLVLLGAMVVVPVAEAQIKHIEMRVEGMT |
| Ga0209580_101718371 | 3300027842 | Surface Soil | MNTRKIALLALFVSIAAPAAQAQIKHIEMRVEGMT |
| Ga0209580_103297672 | 3300027842 | Surface Soil | MNRKRITLLVLLGSIVVVPVPQAQIKHIEMQVEGMT |
| Ga0209180_100491502 | 3300027846 | Vadose Zone Soil | MNTKKLALLALLGSMVAPMAQAQIKHIEMRVEGMT |
| Ga0209180_102528272 | 3300027846 | Vadose Zone Soil | MNRKKLALLVLLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0209166_100864192 | 3300027857 | Surface Soil | MNMKGVALLVLLGSMVVMPVAQAQVKHIEMRVEGMT |
| Ga0209701_100291121 | 3300027862 | Vadose Zone Soil | CTVKKGGTMNTKKLTLLALFVAIVSPVAQAQIKHIEMRVEGMT |
| Ga0209167_100710493 | 3300027867 | Surface Soil | MKTRTIALLALLGSTLVPAAQAQIKHIEMRVEGMT |
| Ga0209167_100993882 | 3300027867 | Surface Soil | MNTKKKRIALLVLLGSIVVVPVAQAQIKHIEMRVEGMT |
| Ga0209167_105618091 | 3300027867 | Surface Soil | GGSMKTKGLLLAALAGFLAVPAAQAQIKHIEMRVEGMT |
| Ga0209167_107774732 | 3300027867 | Surface Soil | GGTMKTRTIALLVLLGSTLVPAAQAQIKHIEMRVEGMT |
| Ga0209283_100052897 | 3300027875 | Vadose Zone Soil | MNTKRIALVLLGCSMVVVSVAQAQIKHLEMRVEGMT |
| Ga0209380_1000230214 | 3300027889 | Soil | MNRKNIALLILLGMMVGPMAQAQIKHIEMRVEGMT |
| Ga0209380_100600453 | 3300027889 | Soil | MNMKRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209068_1000026012 | 3300027894 | Watersheds | MKTKRVALLVLLGSIMVVPVAQAQIKHIEMRVEGMT |
| Ga0209068_106443482 | 3300027894 | Watersheds | RKGGTMKTKKIALLVLLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0209067_101328642 | 3300027898 | Watersheds | MNTKKLALLALLVSIVGPVAQAQIKHIEMRVEGMT |
| Ga0209067_102246932 | 3300027898 | Watersheds | MSTKRIALLVLLGSMVVVPVDQAQIKHIEMRVEGMT |
| Ga0209488_100070724 | 3300027903 | Vadose Zone Soil | MNTKRIALVVLLGSMIVAPMAQAQIKHIEMRVEGMT |
| Ga0209488_100134275 | 3300027903 | Vadose Zone Soil | MNRKRLALLVLLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0209488_100922123 | 3300027903 | Vadose Zone Soil | MKAKKIALLVLLGCALGPVAQAQIKHIEMRVEGMT |
| Ga0209415_100214638 | 3300027905 | Peatlands Soil | MIRKKLALLALLGLFVVPAAQAQIKHIEMRVEGMT |
| Ga0209415_102099205 | 3300027905 | Peatlands Soil | LRRGGTVNRKKLALLALLVSVVSPVAQAQIKHIEMRVEGMT |
| Ga0209006_110051072 | 3300027908 | Forest Soil | MKRKNLLLVALAGFMVVPAAQAQIKHIEMRVEGMT |
| Ga0209583_101041562 | 3300027910 | Watersheds | MNMQRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209698_100306685 | 3300027911 | Watersheds | MNTKRVALMVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209698_100864602 | 3300027911 | Watersheds | MNAKKLALLALLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0209698_101478493 | 3300027911 | Watersheds | MNTRRVALLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0209698_105527542 | 3300027911 | Watersheds | MKTRRLALLVLLGSIVVVPAAKAQVKHIEMRVEGMT |
| Ga0209698_112274122 | 3300027911 | Watersheds | MNTKRVAFLVLLASTVVVPVAQAQIKHIEMRVEGMT |
| Ga0222749_100598563 | 3300029636 | Soil | MNTKRITLLVLLGSMVVVPVAQAQVKHIEMRVEGMT |
| Ga0222749_106869061 | 3300029636 | Soil | TMNLKRITLLILLGSIVVVPVAQAQVKHIEMRVEGMT |
| Ga0311338_104180543 | 3300030007 | Palsa | MSRKTVVLLASLGVLVVPAAQAQIKHIEMRVEGMT |
| Ga0311370_124439222 | 3300030503 | Palsa | VKGGTMSRKTVVLLASLGVLVVPAAQAQIKHIEMRVEGMT |
| Ga0170834_1136428611 | 3300031057 | Forest Soil | RKEETMNMKRVALLVLLGSMVVVPIAEAQVKHIEMRVEGMT |
| Ga0265760_100113222 | 3300031090 | Soil | MKWKNLALLALLGLLIAPTAQAQIKHIEMRVEGMT |
| Ga0265760_100608352 | 3300031090 | Soil | MNTKRLALLVLLGSIAVVPVAQAQIKHIEMRVEGMT |
| Ga0307498_104591801 | 3300031170 | Soil | MKWKNLALLALLGLLMAAAAQAQIKHIEMRVEGMT |
| Ga0170824_1168447744 | 3300031231 | Forest Soil | MNRKNFAMLVLLGMMVGPMAHAQIKHIEMRVEGMT |
| Ga0310686_1084436432 | 3300031708 | Soil | MNMQRVALLVLLGSMVVVPVAQAQVKHIEMRVEGMT |
| Ga0310686_1117644472 | 3300031708 | Soil | MNRKNFALLALLGLLVAPAAQAQIKHIEMRVEGMT |
| Ga0310686_1152893952 | 3300031708 | Soil | MNKKRVALLVLLGSMVVVPVAEAQIKHIEMRVEGMT |
| Ga0310686_1162115442 | 3300031708 | Soil | MIAEKLALLAVLCFMAVPAAQAQIKHIEMRVEGMT |
| Ga0310686_1177101211 | 3300031708 | Soil | MNTKRVALLVLLGSMVIVPVAQAQIKHIEMRVEGMT |
| Ga0310686_1179955372 | 3300031708 | Soil | MNTKRVALLVLLGSTIAVPVAQAQIKHFEMRVEGMT |
| Ga0307474_100936834 | 3300031718 | Hardwood Forest Soil | MNMKRVALLVLLGSMVVVPIAQAQIKHIEMRVEGMT |
| Ga0307469_101451222 | 3300031720 | Hardwood Forest Soil | MKAKRIALLVLLGSMTVVPLAEAQIKHIEMRVEGMT |
| Ga0307469_102671322 | 3300031720 | Hardwood Forest Soil | MNTKRVALLVLLGSMVVVPVAQGQIKHIEMRVEGMT |
| Ga0307469_102961222 | 3300031720 | Hardwood Forest Soil | MKMKRVALLVLFGSIVVVPMAQAQVKHIEMRVEGMT |
| Ga0307469_104587102 | 3300031720 | Hardwood Forest Soil | MNRKRIVQLVLLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0307469_123743852 | 3300031720 | Hardwood Forest Soil | VKGGMMNTKYVAVVVLLALIIVPTAQAQIKHIEMRVEGMT |
| Ga0307477_100165552 | 3300031753 | Hardwood Forest Soil | MNMKNVALLVLLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0307477_101159214 | 3300031753 | Hardwood Forest Soil | MNRKKLVLLILLGSMVVVPAAQAQIKHIEMRVEGMT |
| Ga0307477_103749081 | 3300031753 | Hardwood Forest Soil | MNTKRLALLVLLGSMVMPMAQAQIKHIEMRVEGMT |
| Ga0307475_100314055 | 3300031754 | Hardwood Forest Soil | MNTKRVAMLVLLGAMVVVPAAQAQIKHIEMRVEGMT |
| Ga0307475_100320378 | 3300031754 | Hardwood Forest Soil | MKTKTIALLALLGSMLVPAAQAQIKHIEMRVEGMT |
| Ga0307475_100472205 | 3300031754 | Hardwood Forest Soil | MNTKRVALLILLGSMVVVPVAQAQIKHIEMRVEGMT |
| Ga0307475_100517974 | 3300031754 | Hardwood Forest Soil | MNTKKLALLALLVSIASPVAQAQIKHIEMRVEGMT |
| Ga0307475_100715533 | 3300031754 | Hardwood Forest Soil | MSKKEMALLALLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0307475_101099382 | 3300031754 | Hardwood Forest Soil | MKRKRKRVAMLVLLGAMAVFPVAQAQIKHIEMRVEGMT |
| Ga0307475_101687623 | 3300031754 | Hardwood Forest Soil | MNTKRVAMLVLLGSMVVVPMAQAQIKHIEMRVEGMT |
| Ga0307475_111957862 | 3300031754 | Hardwood Forest Soil | MNTRRMNMKRVALQLLLGSIVVMPVAQAQIKHIEMRVEGMT |
| Ga0307475_114963881 | 3300031754 | Hardwood Forest Soil | MNKKRLALLVLLGSMVVVPVAEAQIKHIEMRVEGMT |
| Ga0307473_107215592 | 3300031820 | Hardwood Forest Soil | MNTKKLALLVLLGSTLLVPAAQAQIKHIEMRVEGMT |
| Ga0307478_103326542 | 3300031823 | Hardwood Forest Soil | MNMKRVAILVLLGSMVVVPVAQAQVKHIEMRVEGMT |
| Ga0307478_114489132 | 3300031823 | Hardwood Forest Soil | MKTKRLTMLVLLGAIVVAPAAKAQVKHIEMRVEGMT |
| Ga0308175_1001456543 | 3300031938 | Soil | MSRKRVALLVLLGSMLVVPVAQAQIKHIEMRVEGMT |
| Ga0307479_100579825 | 3300031962 | Hardwood Forest Soil | MNKKRLALLVLLASMVVVPVAEAQIKHIEMRVEGMT |
| Ga0307479_103795792 | 3300031962 | Hardwood Forest Soil | MSTRRIAILVLLGSMVVVPVAQAQIKHLELRVEGMT |
| Ga0307479_108392383 | 3300031962 | Hardwood Forest Soil | MNMKRVALLLMFGSMIVVPVAQVQIRHIEMRVEGMT |
| Ga0307479_110156842 | 3300031962 | Hardwood Forest Soil | MNTKKLALLAVLVSIVSPVAQAQIKHIEMRVEGMT |
| Ga0307479_113558122 | 3300031962 | Hardwood Forest Soil | MNMKRVALQLLLGSIVVMPVAQAQIKHIEMRVEGMT |
| Ga0307479_114169191 | 3300031962 | Hardwood Forest Soil | LKKGGTMNTKRLALLALLVSTVGPAAQAQIKHIEMRVEGMT |
| Ga0307479_114964142 | 3300031962 | Hardwood Forest Soil | MYTKTMNTRRRLSLLVLLGSTVVVPVAQAQVKHIEMRVEGMT |
| Ga0311301_100024035 | 3300032160 | Peatlands Soil | MNRKNFALLIFLGLMVGPMAQAQIKHIEMRVEGMT |
| Ga0311301_100209305 | 3300032160 | Peatlands Soil | MRVKKFALLVLLGSIFGPVAQAQIKHIEMRVEGMT |
| Ga0311301_1003035320 | 3300032160 | Peatlands Soil | MRIKNFALLVLLGSMIAPAAQAQIKHIEMRVEGMT |
| Ga0311301_101469673 | 3300032160 | Peatlands Soil | MHRKNFALLVLLGSIIVVVPVAQAQIKHIEMRVEGMT |
| Ga0311301_102592104 | 3300032160 | Peatlands Soil | MNTRILARLVLFASMIVVVPVAQAQIKHIEMRVEGMT |
| Ga0307471_1000039567 | 3300032180 | Hardwood Forest Soil | MKWRNLALLALLGLLIAPAAQTQIRHIEMRVEGMT |
| Ga0307471_1000598132 | 3300032180 | Hardwood Forest Soil | MHTKRIALLVLLGSLVVVPAAKAQIKHIEMRVEGMT |
| Ga0307471_1002021612 | 3300032180 | Hardwood Forest Soil | MNRKKLALLILLGAMVVAPAAQAQIKHIEMRVEGMT |
| Ga0307472_1005108363 | 3300032205 | Hardwood Forest Soil | MNTKKIALLVLLGSLVVVHAAQAQIKDIEMRVEGMT |
| Ga0307472_1010183992 | 3300032205 | Hardwood Forest Soil | MNKKNFALLALLGMMIGPMAQAQIKHIEMRVEGMT |
| Ga0307472_1013960962 | 3300032205 | Hardwood Forest Soil | MNTKRLALLVLLGSMVVVPVAQAQIRHIEMRVEGMT |
| Ga0307472_1017186871 | 3300032205 | Hardwood Forest Soil | SLVRGGTMKWKNLALLALLGLLIAAAAQAQIKHIEMRVEGMT |
| Ga0348332_138278972 | 3300032515 | Plant Litter | NMKRVALLVLFGSMLVVPVAQAQVKHIEMRVEGMT |
| Ga0370484_0085745_361_471 | 3300034125 | Untreated Peat Soil | MNMKRVALLVLLGSMVVVPVARAQVKHIEMRVEGMT |
| ⦗Top⦘ |