Basic Information | |
---|---|
Family ID | F003930 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 461 |
Average Sequence Length | 45 residues |
Representative Sequence | GIGGDWFLLSGDVRSDDPADVRPPADFLKDIARHTSQGGIVWIFGL |
Number of Associated Samples | 361 |
Number of Associated Scaffolds | 461 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.43 % |
% of genes near scaffold ends (potentially truncated) | 98.26 % |
% of genes from short scaffolds (< 2000 bps) | 88.07 % |
Associated GOLD sequencing projects | 323 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.280 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.850 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.373 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.78% β-sheet: 0.00% Coil/Unstructured: 66.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 461 Family Scaffolds |
---|---|---|
PF13442 | Cytochrome_CBB3 | 74.19 |
PF07885 | Ion_trans_2 | 2.82 |
PF04306 | DUF456 | 2.60 |
PF02897 | Peptidase_S9_N | 1.95 |
PF13462 | Thioredoxin_4 | 1.74 |
PF08281 | Sigma70_r4_2 | 1.08 |
PF00069 | Pkinase | 0.65 |
PF13419 | HAD_2 | 0.65 |
PF01266 | DAO | 0.43 |
PF12710 | HAD | 0.43 |
PF07687 | M20_dimer | 0.43 |
PF00034 | Cytochrom_C | 0.43 |
PF00528 | BPD_transp_1 | 0.22 |
PF13721 | SecD-TM1 | 0.22 |
PF07969 | Amidohydro_3 | 0.22 |
PF07731 | Cu-oxidase_2 | 0.22 |
PF01161 | PBP | 0.22 |
PF13520 | AA_permease_2 | 0.22 |
PF10282 | Lactonase | 0.22 |
PF16980 | CitMHS_2 | 0.22 |
PF12704 | MacB_PCD | 0.22 |
PF00551 | Formyl_trans_N | 0.22 |
PF07690 | MFS_1 | 0.22 |
PF05960 | DUF885 | 0.22 |
PF05962 | HutD | 0.22 |
PF03625 | DUF302 | 0.22 |
PF01915 | Glyco_hydro_3_C | 0.22 |
PF13401 | AAA_22 | 0.22 |
PF03606 | DcuC | 0.22 |
PF00872 | Transposase_mut | 0.22 |
PF07715 | Plug | 0.22 |
PF13570 | PQQ_3 | 0.22 |
PF00486 | Trans_reg_C | 0.22 |
PF07681 | DoxX | 0.22 |
PF04542 | Sigma70_r2 | 0.22 |
PF01035 | DNA_binding_1 | 0.22 |
PF00199 | Catalase | 0.22 |
PF13489 | Methyltransf_23 | 0.22 |
PF03551 | PadR | 0.22 |
PF07635 | PSCyt1 | 0.22 |
PF00730 | HhH-GPD | 0.22 |
PF00106 | adh_short | 0.22 |
COG ID | Name | Functional Category | % Frequency in 461 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.60 |
COG2839 | Uncharacterized conserved protein YqgC, DUF456 family | Function unknown [S] | 2.60 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 1.95 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 1.95 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.22 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.22 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.22 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.22 |
COG3758 | Various environmental stresses-induced protein Ves (function unknown) | Function unknown [S] | 0.22 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.22 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.22 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.22 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.22 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.22 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.22 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.22 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.22 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.22 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.22 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.22 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.22 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.22 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.22 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.22 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.22 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.22 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.22 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100466163 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300000956|JGI10216J12902_114856872 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300001546|JGI12659J15293_10010196 | All Organisms → cellular organisms → Bacteria | 2644 | Open in IMG/M |
3300001593|JGI12635J15846_10570822 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100307122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1470 | Open in IMG/M |
3300002557|JGI25381J37097_1006373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
3300002558|JGI25385J37094_10036718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
3300002886|JGI25612J43240_1050785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 614 | Open in IMG/M |
3300002908|JGI25382J43887_10306344 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300002911|JGI25390J43892_10125662 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
3300002916|JGI25389J43894_1052539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
3300002965|JGI26063J44948_1022337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1405 | Open in IMG/M |
3300003323|rootH1_10214058 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300004114|Ga0062593_103332120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 515 | Open in IMG/M |
3300004156|Ga0062589_100426169 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300004463|Ga0063356_104945670 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300004463|Ga0063356_106439695 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 503 | Open in IMG/M |
3300004633|Ga0066395_10642877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 625 | Open in IMG/M |
3300004808|Ga0062381_10010948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2168 | Open in IMG/M |
3300005093|Ga0062594_100474390 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300005167|Ga0066672_10340376 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300005174|Ga0066680_10058900 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
3300005175|Ga0066673_10344787 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300005175|Ga0066673_10571625 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005178|Ga0066688_10952785 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 526 | Open in IMG/M |
3300005179|Ga0066684_10153402 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
3300005187|Ga0066675_10857384 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300005294|Ga0065705_10825110 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 601 | Open in IMG/M |
3300005327|Ga0070658_11556887 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 573 | Open in IMG/M |
3300005329|Ga0070683_100784965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 913 | Open in IMG/M |
3300005334|Ga0068869_101268443 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300005335|Ga0070666_10758564 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300005335|Ga0070666_11158843 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 575 | Open in IMG/M |
3300005339|Ga0070660_100044393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3400 | Open in IMG/M |
3300005339|Ga0070660_100299918 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300005344|Ga0070661_101747778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 527 | Open in IMG/M |
3300005354|Ga0070675_100687979 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300005355|Ga0070671_100251866 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300005434|Ga0070709_10727068 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 774 | Open in IMG/M |
3300005438|Ga0070701_10003770 | All Organisms → cellular organisms → Bacteria | 6051 | Open in IMG/M |
3300005441|Ga0070700_100863439 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300005446|Ga0066686_10318190 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300005446|Ga0066686_10420687 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 913 | Open in IMG/M |
3300005450|Ga0066682_10465467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 802 | Open in IMG/M |
3300005451|Ga0066681_10654499 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300005455|Ga0070663_101344029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 631 | Open in IMG/M |
3300005455|Ga0070663_101967329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 526 | Open in IMG/M |
3300005458|Ga0070681_11135408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 703 | Open in IMG/M |
3300005458|Ga0070681_11718089 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 554 | Open in IMG/M |
3300005459|Ga0068867_100911264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 792 | Open in IMG/M |
3300005459|Ga0068867_101918543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 559 | Open in IMG/M |
3300005468|Ga0070707_100183112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2042 | Open in IMG/M |
3300005468|Ga0070707_100636659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1029 | Open in IMG/M |
3300005529|Ga0070741_11696804 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 514 | Open in IMG/M |
3300005530|Ga0070679_100203534 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1944 | Open in IMG/M |
3300005534|Ga0070735_10180269 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300005534|Ga0070735_10199573 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300005536|Ga0070697_101268371 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 657 | Open in IMG/M |
3300005539|Ga0068853_102325678 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 519 | Open in IMG/M |
3300005541|Ga0070733_10068205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2238 | Open in IMG/M |
3300005542|Ga0070732_10532078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 713 | Open in IMG/M |
3300005543|Ga0070672_100478368 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300005545|Ga0070695_100065366 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2368 | Open in IMG/M |
3300005545|Ga0070695_100431983 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300005545|Ga0070695_101758768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 519 | Open in IMG/M |
3300005546|Ga0070696_100346257 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300005548|Ga0070665_100883322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 907 | Open in IMG/M |
3300005552|Ga0066701_10442464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 806 | Open in IMG/M |
3300005552|Ga0066701_10955400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 507 | Open in IMG/M |
3300005554|Ga0066661_10778790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 560 | Open in IMG/M |
3300005556|Ga0066707_10036425 | All Organisms → cellular organisms → Bacteria | 2768 | Open in IMG/M |
3300005557|Ga0066704_10324595 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300005558|Ga0066698_10493510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
3300005558|Ga0066698_10499358 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300005560|Ga0066670_10098068 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1635 | Open in IMG/M |
3300005564|Ga0070664_101891108 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005569|Ga0066705_10570588 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300005574|Ga0066694_10343846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 707 | Open in IMG/M |
3300005574|Ga0066694_10571465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
3300005576|Ga0066708_10564642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 732 | Open in IMG/M |
3300005578|Ga0068854_101336470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 646 | Open in IMG/M |
3300005586|Ga0066691_10101058 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300005598|Ga0066706_10097434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2127 | Open in IMG/M |
3300005598|Ga0066706_10115092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1977 | Open in IMG/M |
3300005602|Ga0070762_10818238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 631 | Open in IMG/M |
3300005602|Ga0070762_10917909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 597 | Open in IMG/M |
3300005614|Ga0068856_100754069 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300005614|Ga0068856_102287321 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 549 | Open in IMG/M |
3300005616|Ga0068852_101936638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 611 | Open in IMG/M |
3300005712|Ga0070764_10049905 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
3300005764|Ga0066903_105171464 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300005844|Ga0068862_101064345 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300005921|Ga0070766_11126185 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300006013|Ga0066382_10016141 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
3300006034|Ga0066656_10015805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3930 | Open in IMG/M |
3300006046|Ga0066652_100556911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1075 | Open in IMG/M |
3300006055|Ga0097691_1026781 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
3300006176|Ga0070765_101409679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 656 | Open in IMG/M |
3300006237|Ga0097621_100040024 | All Organisms → cellular organisms → Bacteria | 3766 | Open in IMG/M |
3300006581|Ga0074048_13358261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 619 | Open in IMG/M |
3300006755|Ga0079222_12082452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 560 | Open in IMG/M |
3300006791|Ga0066653_10156862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1115 | Open in IMG/M |
3300006797|Ga0066659_10736533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 809 | Open in IMG/M |
3300006804|Ga0079221_10788922 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300006804|Ga0079221_10883545 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006806|Ga0079220_10442359 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300006806|Ga0079220_11823035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 537 | Open in IMG/M |
3300006806|Ga0079220_12047447 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006852|Ga0075433_10006923 | All Organisms → cellular organisms → Bacteria | 8983 | Open in IMG/M |
3300006852|Ga0075433_10291812 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300006852|Ga0075433_10845535 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300006852|Ga0075433_11939000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 505 | Open in IMG/M |
3300006854|Ga0075425_100318002 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300006854|Ga0075425_100352829 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
3300006854|Ga0075425_100498863 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
3300006881|Ga0068865_102131858 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006903|Ga0075426_10001532 | All Organisms → cellular organisms → Bacteria | 16480 | Open in IMG/M |
3300006904|Ga0075424_100109085 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
3300006904|Ga0075424_100114021 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
3300006904|Ga0075424_100114158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2853 | Open in IMG/M |
3300006914|Ga0075436_100137562 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
3300006954|Ga0079219_10917876 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300006954|Ga0079219_12015277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 549 | Open in IMG/M |
3300007258|Ga0099793_10155128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1086 | Open in IMG/M |
3300007619|Ga0102947_1043942 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300007819|Ga0104322_121681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 1301 | Open in IMG/M |
3300007982|Ga0102924_1261331 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300009012|Ga0066710_100841434 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300009012|Ga0066710_101170388 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300009012|Ga0066710_103701863 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300009038|Ga0099829_10065006 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
3300009088|Ga0099830_10847522 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 755 | Open in IMG/M |
3300009089|Ga0099828_10469018 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300009090|Ga0099827_11926344 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300009092|Ga0105250_10049757 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
3300009101|Ga0105247_11693252 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300009137|Ga0066709_102532800 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300009148|Ga0105243_11056566 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300009148|Ga0105243_13065428 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300009156|Ga0111538_10072400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 4388 | Open in IMG/M |
3300009162|Ga0075423_12833194 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009174|Ga0105241_10473731 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300009176|Ga0105242_10465842 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300009545|Ga0105237_10161720 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300009551|Ga0105238_11962163 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300009553|Ga0105249_11010038 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300009553|Ga0105249_13089777 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300009792|Ga0126374_10183389 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300010038|Ga0126315_11161162 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300010043|Ga0126380_11006551 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300010047|Ga0126382_10074735 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300010047|Ga0126382_11554192 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300010048|Ga0126373_10415725 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300010303|Ga0134082_10045603 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300010303|Ga0134082_10556131 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300010304|Ga0134088_10458862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 625 | Open in IMG/M |
3300010320|Ga0134109_10017297 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
3300010322|Ga0134084_10325471 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
3300010323|Ga0134086_10278539 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300010325|Ga0134064_10099331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 956 | Open in IMG/M |
3300010326|Ga0134065_10267543 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300010329|Ga0134111_10343592 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300010329|Ga0134111_10379380 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300010329|Ga0134111_10552596 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300010335|Ga0134063_10037052 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
3300010337|Ga0134062_10001405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 8159 | Open in IMG/M |
3300010337|Ga0134062_10005324 | All Organisms → cellular organisms → Bacteria | 4603 | Open in IMG/M |
3300010337|Ga0134062_10546242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 589 | Open in IMG/M |
3300010359|Ga0126376_12165567 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300010360|Ga0126372_12548115 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300010361|Ga0126378_12218810 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300010362|Ga0126377_11391624 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300010362|Ga0126377_11901627 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300010362|Ga0126377_13293311 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300010366|Ga0126379_11026856 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300010371|Ga0134125_11377950 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300010371|Ga0134125_12790009 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300010373|Ga0134128_11698437 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300010373|Ga0134128_11728946 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300010376|Ga0126381_103342874 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300010379|Ga0136449_102089468 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300010396|Ga0134126_10035544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 6294 | Open in IMG/M |
3300010396|Ga0134126_11172440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 854 | Open in IMG/M |
3300010396|Ga0134126_12512997 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300010396|Ga0134126_12838271 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300010396|Ga0134126_12956781 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010398|Ga0126383_11680495 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010399|Ga0134127_10322215 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300010399|Ga0134127_12256462 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300010403|Ga0134123_12799486 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010403|Ga0134123_13493888 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300011112|Ga0114947_10530466 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300011269|Ga0137392_10578796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
3300011269|Ga0137392_11387301 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300011271|Ga0137393_10561535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300011271|Ga0137393_10701361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 867 | Open in IMG/M |
3300011420|Ga0137314_1033927 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300011441|Ga0137452_1038738 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300012096|Ga0137389_10709865 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300012189|Ga0137388_10730255 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300012198|Ga0137364_10434006 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 984 | Open in IMG/M |
3300012199|Ga0137383_10914966 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012200|Ga0137382_10231301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1277 | Open in IMG/M |
3300012201|Ga0137365_10325557 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300012203|Ga0137399_10010969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5456 | Open in IMG/M |
3300012203|Ga0137399_10021582 | All Organisms → cellular organisms → Bacteria | 4231 | Open in IMG/M |
3300012203|Ga0137399_10070500 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
3300012204|Ga0137374_10215986 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300012207|Ga0137381_10137856 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
3300012207|Ga0137381_10278665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1455 | Open in IMG/M |
3300012207|Ga0137381_10909543 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 761 | Open in IMG/M |
3300012207|Ga0137381_11265150 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300012285|Ga0137370_10998013 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012349|Ga0137387_10862186 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300012351|Ga0137386_10002944 | All Organisms → cellular organisms → Bacteria | 11099 | Open in IMG/M |
3300012354|Ga0137366_10381997 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
3300012356|Ga0137371_10417434 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300012359|Ga0137385_10283480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1428 | Open in IMG/M |
3300012361|Ga0137360_10096707 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
3300012362|Ga0137361_10750935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 889 | Open in IMG/M |
3300012582|Ga0137358_10472518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 846 | Open in IMG/M |
3300012683|Ga0137398_10392233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
3300012912|Ga0157306_10317349 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012917|Ga0137395_10073037 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
3300012918|Ga0137396_10656185 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300012922|Ga0137394_10697751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 855 | Open in IMG/M |
3300012927|Ga0137416_10459355 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300012929|Ga0137404_10083922 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
3300012930|Ga0137407_10353357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1354 | Open in IMG/M |
3300012930|Ga0137407_11154353 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300012948|Ga0126375_10175227 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300012972|Ga0134077_10212166 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
3300012982|Ga0168317_1007342 | All Organisms → cellular organisms → Bacteria | 3896 | Open in IMG/M |
3300013105|Ga0157369_10114363 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300013105|Ga0157369_12111952 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300013296|Ga0157374_11178885 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300013307|Ga0157372_12019314 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300013307|Ga0157372_12819369 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300014154|Ga0134075_10400933 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300014166|Ga0134079_10237746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
3300014497|Ga0182008_10065040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1795 | Open in IMG/M |
3300014658|Ga0181519_11069694 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300014882|Ga0180069_1159021 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300014968|Ga0157379_11114289 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300014968|Ga0157379_12288020 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300014968|Ga0157379_12523437 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300014969|Ga0157376_11667360 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300015054|Ga0137420_1073824 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300015054|Ga0137420_1231918 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300015200|Ga0173480_10126107 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300015241|Ga0137418_11178439 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300015254|Ga0180089_1086195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 649 | Open in IMG/M |
3300015357|Ga0134072_10105182 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300015359|Ga0134085_10529588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 541 | Open in IMG/M |
3300015372|Ga0132256_100607074 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300015372|Ga0132256_101627919 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300015374|Ga0132255_100703369 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
3300015374|Ga0132255_104894626 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300016270|Ga0182036_10900969 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300016319|Ga0182033_10267173 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300016371|Ga0182034_11012497 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300016387|Ga0182040_10297923 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300016387|Ga0182040_10520088 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300017654|Ga0134069_1099030 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300017654|Ga0134069_1118672 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300017656|Ga0134112_10025250 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300017927|Ga0187824_10048504 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300017930|Ga0187825_10205572 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300017955|Ga0187817_10974805 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300017959|Ga0187779_11067797 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300017974|Ga0187777_10338330 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300017974|Ga0187777_11004999 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300017974|Ga0187777_11072127 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300017975|Ga0187782_11280417 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300017994|Ga0187822_10011930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2095 | Open in IMG/M |
3300018058|Ga0187766_10382114 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300018058|Ga0187766_10908216 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300018063|Ga0184637_10551416 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300018064|Ga0187773_10525819 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300018075|Ga0184632_10407415 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300018078|Ga0184612_10225826 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 970 | Open in IMG/M |
3300018079|Ga0184627_10169461 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300018431|Ga0066655_11078158 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300018433|Ga0066667_10433386 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300018433|Ga0066667_11938462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
3300018476|Ga0190274_11211668 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300018481|Ga0190271_10604704 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300018481|Ga0190271_10625267 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300018482|Ga0066669_10364436 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300018482|Ga0066669_11083174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
3300020022|Ga0193733_1042397 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300020140|Ga0179590_1103229 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300020582|Ga0210395_10680347 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300020582|Ga0210395_10776327 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300020583|Ga0210401_11393303 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300021046|Ga0215015_10720549 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300021080|Ga0210382_10032882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1960 | Open in IMG/M |
3300021088|Ga0210404_10171082 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300021088|Ga0210404_10597618 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300021171|Ga0210405_10984094 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300021180|Ga0210396_10436126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
3300021407|Ga0210383_11669925 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300021474|Ga0210390_10509993 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300021479|Ga0210410_11159358 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300021560|Ga0126371_10832188 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300021560|Ga0126371_13571367 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300021953|Ga0213880_10058536 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300022218|Ga0224502_10017643 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
3300022756|Ga0222622_10722293 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 725 | Open in IMG/M |
3300024182|Ga0247669_1047164 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300024330|Ga0137417_1397260 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300025159|Ga0209619_10552728 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025898|Ga0207692_10836476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 603 | Open in IMG/M |
3300025901|Ga0207688_11099484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 501 | Open in IMG/M |
3300025903|Ga0207680_10994289 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300025906|Ga0207699_10415027 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300025910|Ga0207684_10634140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
3300025912|Ga0207707_10097354 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
3300025912|Ga0207707_10168614 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1913 | Open in IMG/M |
3300025914|Ga0207671_10865617 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300025920|Ga0207649_11267237 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300025922|Ga0207646_10954615 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300025928|Ga0207700_11832396 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300025931|Ga0207644_11074641 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025934|Ga0207686_11798048 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300025938|Ga0207704_10789894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
3300025944|Ga0207661_10067936 | All Organisms → cellular organisms → Bacteria | 2901 | Open in IMG/M |
3300025960|Ga0207651_10874180 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300025986|Ga0207658_11904192 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300026023|Ga0207677_11702625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
3300026035|Ga0207703_11762238 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300026041|Ga0207639_11918976 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300026078|Ga0207702_10548319 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300026078|Ga0207702_11455703 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300026088|Ga0207641_12040878 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
3300026296|Ga0209235_1113388 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300026297|Ga0209237_1006833 | All Organisms → cellular organisms → Bacteria | 6868 | Open in IMG/M |
3300026298|Ga0209236_1124659 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1131 | Open in IMG/M |
3300026301|Ga0209238_1037299 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300026301|Ga0209238_1056639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
3300026301|Ga0209238_1225946 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300026310|Ga0209239_1063423 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
3300026314|Ga0209268_1060331 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1175 | Open in IMG/M |
3300026316|Ga0209155_1211647 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300026318|Ga0209471_1211360 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300026318|Ga0209471_1300855 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026323|Ga0209472_1018693 | All Organisms → cellular organisms → Bacteria | 3342 | Open in IMG/M |
3300026325|Ga0209152_10095644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1113 | Open in IMG/M |
3300026327|Ga0209266_1158507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 902 | Open in IMG/M |
3300026331|Ga0209267_1325210 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300026333|Ga0209158_1093138 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300026334|Ga0209377_1235239 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300026335|Ga0209804_1325570 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300026343|Ga0209159_1119296 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300026536|Ga0209058_1200011 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300026540|Ga0209376_1188226 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300026547|Ga0209156_10271562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 776 | Open in IMG/M |
3300026548|Ga0209161_10023324 | All Organisms → cellular organisms → Bacteria | 4396 | Open in IMG/M |
3300026548|Ga0209161_10067268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2265 | Open in IMG/M |
3300026548|Ga0209161_10539732 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300026551|Ga0209648_10116700 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2162 | Open in IMG/M |
3300027376|Ga0209004_1070201 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300027480|Ga0208993_1101501 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300027643|Ga0209076_1021928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1741 | Open in IMG/M |
3300027655|Ga0209388_1147223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
3300027748|Ga0209689_1202880 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300027748|Ga0209689_1395246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
3300027765|Ga0209073_10145434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 871 | Open in IMG/M |
3300027765|Ga0209073_10219325 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300027787|Ga0209074_10034517 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300027787|Ga0209074_10555255 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027842|Ga0209580_10255003 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300027869|Ga0209579_10430651 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300027869|Ga0209579_10679725 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300027869|Ga0209579_10713127 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027875|Ga0209283_10110934 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300027875|Ga0209283_10276792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
3300027900|Ga0209253_10177977 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300027909|Ga0209382_10488206 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300027964|Ga0256864_1066281 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300028047|Ga0209526_10348458 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300028379|Ga0268266_10157931 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
3300028380|Ga0268265_10442651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → unclassified Caulobacteraceae → Caulobacteraceae bacterium | 1212 | Open in IMG/M |
3300028380|Ga0268265_11047763 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300028380|Ga0268265_11407088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter | 700 | Open in IMG/M |
3300028381|Ga0268264_11541503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
3300028536|Ga0137415_10051228 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4002 | Open in IMG/M |
3300028536|Ga0137415_10807575 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
3300028536|Ga0137415_11200090 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300028589|Ga0247818_11379684 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300028598|Ga0265306_10107265 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
3300028652|Ga0302166_10157117 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300028716|Ga0307311_10020752 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
3300028771|Ga0307320_10275231 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
3300028784|Ga0307282_10147071 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300028802|Ga0307503_10476748 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300028803|Ga0307281_10097757 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
3300028811|Ga0307292_10516143 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300028824|Ga0307310_10452100 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300028828|Ga0307312_10047953 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
3300028906|Ga0308309_11243611 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300030620|Ga0302046_11309400 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300030906|Ga0302314_11306949 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300031114|Ga0308187_10298463 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300031421|Ga0308194_10176650 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300031446|Ga0170820_10554844 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300031545|Ga0318541_10586331 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300031546|Ga0318538_10368381 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300031561|Ga0318528_10785184 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031572|Ga0318515_10639378 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300031573|Ga0310915_10577514 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300031573|Ga0310915_11022582 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300031616|Ga0307508_10564515 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300031719|Ga0306917_10845401 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300031720|Ga0307469_11548500 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300031720|Ga0307469_11946136 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300031740|Ga0307468_102377404 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300031744|Ga0306918_10205975 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300031744|Ga0306918_10939793 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300031748|Ga0318492_10153833 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
3300031754|Ga0307475_11435751 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300031764|Ga0318535_10075631 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300031792|Ga0318529_10459890 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300031795|Ga0318557_10237106 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300031797|Ga0318550_10524407 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300031799|Ga0318565_10551734 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031799|Ga0318565_10641062 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300031805|Ga0318497_10350761 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300031847|Ga0310907_10694522 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031852|Ga0307410_11986631 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031879|Ga0306919_10572397 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300031901|Ga0307406_10721984 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300031910|Ga0306923_10618236 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300031911|Ga0307412_10591434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 938 | Open in IMG/M |
3300031911|Ga0307412_11727330 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300031912|Ga0306921_10092500 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
3300031938|Ga0308175_102620525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 564 | Open in IMG/M |
3300031947|Ga0310909_10477838 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300031947|Ga0310909_11043231 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300031954|Ga0306926_10945029 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300031962|Ga0307479_11060872 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300031962|Ga0307479_11146362 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300032004|Ga0307414_11433596 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300032018|Ga0315272_10362161 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 711 | Open in IMG/M |
3300032066|Ga0318514_10515622 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300032076|Ga0306924_10502816 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
3300032164|Ga0315283_10552004 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300032180|Ga0307471_102807837 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 618 | Open in IMG/M |
3300032256|Ga0315271_11957877 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300032261|Ga0306920_102343678 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300032261|Ga0306920_102806204 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300032516|Ga0315273_12812372 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300032770|Ga0335085_10291422 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
3300032828|Ga0335080_11226454 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300032898|Ga0335072_11325894 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300033134|Ga0335073_10750016 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300033289|Ga0310914_11427735 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300033412|Ga0310810_11331734 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300033550|Ga0247829_10665910 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300033808|Ga0314867_063298 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300034123|Ga0370479_0074546 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.34% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.60% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.82% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.95% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.95% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.30% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.08% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.87% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.87% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.65% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.43% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.43% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.43% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.22% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.22% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.22% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.22% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.22% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.22% |
Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.22% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.22% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.22% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.22% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.22% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.22% |
Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.22% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.22% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.22% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.22% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.22% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.22% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.22% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.22% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.22% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.22% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.22% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.22% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300002965 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007619 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG | Environmental | Open in IMG/M |
3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1004661632 | 3300000364 | Soil | GDWFLMAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
JGI10216J12902_1148568721 | 3300000956 | Soil | QYVAVYAGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGLGE* |
JGI12659J15293_100101964 | 3300001546 | Forest Soil | TRSDDPADIRPPADFLKDIARYTSQGGIIWIFGL* |
JGI12635J15846_105708222 | 3300001593 | Forest Soil | SGDVRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL* |
JGIcombinedJ26739_1003071221 | 3300002245 | Forest Soil | VYAGFGGDWALLSGDVRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL* |
JGI25381J37097_10063731 | 3300002557 | Grasslands Soil | GDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
JGI25385J37094_100367183 | 3300002558 | Grasslands Soil | YAGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
JGI25612J43240_10507852 | 3300002886 | Grasslands Soil | GIGGDWFLLSGDVRSDDPADVRPPADFAPELARHTSQGGIVWIFGL* |
JGI25382J43887_103063441 | 3300002908 | Grasslands Soil | FLLSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL* |
JGI25390J43892_101256622 | 3300002911 | Grasslands Soil | DWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGVVWIFGL* |
JGI25389J43894_10525391 | 3300002916 | Grasslands Soil | GGDWFLLSGDVRSDAPADVRPPADFAPDLARHTSQGGIVWVFGL* |
JGI26063J44948_10223373 | 3300002965 | Marine | GIGGDWFLVAGDVRSDDPADVRPPADFMPDLARHTSQGGILWIFALD* |
rootH1_102140581 | 3300003323 | Sugarcane Root And Bulk Soil | AVYAGIGGDWFLLSGDVVSSDPADVRPPADFMKDIGRHTSQGGIVWIFGL* |
Ga0062593_1033321202 | 3300004114 | Soil | IAIYAGIGGDWFLIAGDVRSDDPADIRPPADFAPKLGRHTSQGGIVWVFGL* |
Ga0062589_1004261693 | 3300004156 | Soil | SLISGDLNADDPSDVRDPADFIKDLARYTTQGGMVWIFAL* |
Ga0063356_1049456702 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AGIGGDWFLLSGDVVSNDPADVRPPADFMKDIGRHTSQGGMVWIFGL* |
Ga0063356_1064396951 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GGDWGLISGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL* |
Ga0066395_106428771 | 3300004633 | Tropical Forest Soil | AVYAGFGGDWALIAGDTRSDDPADIRAPADPVKDIARYTSQGGMVWIFGL* |
Ga0062381_100109481 | 3300004808 | Wetland Sediment | AGFGGDWGLLSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWLFGL* |
Ga0062594_1004743902 | 3300005093 | Soil | YAGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0066672_103403761 | 3300005167 | Soil | GIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0066680_100589001 | 3300005174 | Soil | IGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0066673_103447871 | 3300005175 | Soil | LLSGDVRSDDPADVRPPADFMPEIARHTSQGGIVWIFAL* |
Ga0066673_105716252 | 3300005175 | Soil | YAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0066688_109527851 | 3300005178 | Soil | AGIGGDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP* |
Ga0066684_101534021 | 3300005179 | Soil | FGGDWALLSGDVRSDDPADVRPPADFIKDIARHTSQGGIIWIFGL* |
Ga0066675_108573841 | 3300005187 | Soil | QYVAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0065705_108251101 | 3300005294 | Switchgrass Rhizosphere | WSLISGDLNADDPSDVRDPADFISDLARYTTQGGMVWIFAL* |
Ga0070658_115568872 | 3300005327 | Corn Rhizosphere | DWFLLAGDVRSDDPADVRPPADFMKDIARYTSQGGMVWIFGL* |
Ga0070683_1007849651 | 3300005329 | Corn Rhizosphere | YAGIGGDWLLLSGDYKSDDPADVRDPADFVRDLARHTSQGGIVWIFALEGTPQ* |
Ga0068869_1012684431 | 3300005334 | Miscanthus Rhizosphere | YAGIGGDWLLLAGDVNSADPADVRAPPDFAKDIGRHTSQGGIVWIFGL* |
Ga0070666_107585642 | 3300005335 | Switchgrass Rhizosphere | AVYAGIGGDLSLFANDTSADATDVRPPADFMPDLARHTSHGGIVWIFGL* |
Ga0070666_111588432 | 3300005335 | Switchgrass Rhizosphere | VYAGFGGDWALIAGDTRSDDPADIRAPADPVKDIARYTSQGGMVWIFGL* |
Ga0070660_1000443936 | 3300005339 | Corn Rhizosphere | YVAIYAGIGGDWFLLAGDVRSDDPADVRPPADFMQDIARYTSQGGMVWIFGL* |
Ga0070660_1002999181 | 3300005339 | Corn Rhizosphere | LAGIGGDWFLLSGDVRSDDPADVRPPADFARELGRHTSQGGMIWIFGL* |
Ga0070661_1017477781 | 3300005344 | Corn Rhizosphere | GIGGDWFLLSGDVRSDDPADVRPPADFLKDIARHTSQGGIVWIFGL* |
Ga0070675_1006879791 | 3300005354 | Miscanthus Rhizosphere | IGGDWLLLAGDVNSADPADVRSPSDPYKDIGRHTSQGGIVWIFGLGE* |
Ga0070671_1002518661 | 3300005355 | Switchgrass Rhizosphere | LISGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL* |
Ga0070709_107270681 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LAVYAGIGGDWFLLAGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFAL* |
Ga0070701_1000377010 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | IGGDWFLLSGDVRSDDPADVRPPADFAPELGRHTSQGGIVWIFGL* |
Ga0070700_1008634391 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | AGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGLGE* |
Ga0066686_103181903 | 3300005446 | Soil | YAGFGGDWFLLSGDVISKDPDDIRPPATFMPDIARHTSQGGIVWIFGL* |
Ga0066686_104206871 | 3300005446 | Soil | QYVAVYAGIGGDWFLLAGDIRSDDPADVRPPADFSPDLARHTSQGGIVWLFGL* |
Ga0066682_104654671 | 3300005450 | Soil | LLSGDVRSDDPADVRPRADFAPDLARHTSQGGIVWVFGLP* |
Ga0066681_106544992 | 3300005451 | Soil | AVYAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0070663_1013440292 | 3300005455 | Corn Rhizosphere | DGRQYVAILAGIGGDWFLLSGDVRSDDPADVRPPADFARELGRHTSQGGMIWIFGL* |
Ga0070663_1019673291 | 3300005455 | Corn Rhizosphere | KQYIALYAGFGGDWGLLSGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL* |
Ga0070681_111354082 | 3300005458 | Corn Rhizosphere | GIGGDWFLIAGDVRSDDPADIRPPADFAPKLGRHTSQGGIVWVFGL* |
Ga0070681_117180891 | 3300005458 | Corn Rhizosphere | VYAGIGGDWFLIAGDVRSDDPADVRAPAEVVKTLGRYTSQGGIVWIFGL* |
Ga0068867_1009112642 | 3300005459 | Miscanthus Rhizosphere | KQYVAVYAGIGGDWLLLSGDVRSDDPTDVRAPADYIKDIAGHTSQGGIIWIFGL* |
Ga0068867_1019185431 | 3300005459 | Miscanthus Rhizosphere | DWFVIAGDVRSDDPADVRPRADFAPDLSRYTSQGGIVWVFGL* |
Ga0070707_1001831125 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGIVWLFGLGP* |
Ga0070707_1006366591 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VYAGIGGDWALLSGDVRSDDPTDLRDPADFIRDLGRYTSGGGVVWVFGL* |
Ga0070741_116968041 | 3300005529 | Surface Soil | GIGGDWFLIAGDIRSDDPADIRPPADFAPKLGRHTSQGGIVWIFGL* |
Ga0070679_1002035344 | 3300005530 | Corn Rhizosphere | AVYAGIGGDWFLLAGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFAL* |
Ga0070735_101802693 | 3300005534 | Surface Soil | AGDTLSDDPADVRAPADFIKDIARHTSKGGIVWIFGL* |
Ga0070735_101995733 | 3300005534 | Surface Soil | LLAGDTASDDPADVRPPADFLKDIARHTSKGGMLWVFGL* |
Ga0070697_1012683712 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VYAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL* |
Ga0068853_1023256781 | 3300005539 | Corn Rhizosphere | GDWFLIAGDVRSDDPADVRAPADVVKTLGRHTSQGGIVWIFGL* |
Ga0070733_100682055 | 3300005541 | Surface Soil | GDTKADDPADVREPADYIKDIARHTSQGGMVWIFGL* |
Ga0070732_105320782 | 3300005542 | Surface Soil | GRQYVAVYAGFGGDWALLSGDTRSDDPADVRAPADFIKDIARHTSQGGILWIFGL* |
Ga0070672_1004783681 | 3300005543 | Miscanthus Rhizosphere | AVYAGIGGDPELFSGEVVSADQTDVRPPGDFMKDIGRHTSQGGMVWLFGL* |
Ga0070695_1000653665 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LLAGDVRSDDPADVRPPADFSPDIARHTSQGGIVWLFGL* |
Ga0070695_1004319831 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VYAGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGLGE* |
Ga0070695_1017587682 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IGGDWFLLSGDVRSDDPADVRPPADFMPDIGRHTSQGGIVWIFAL* |
Ga0070696_1003462573 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0070665_1008833221 | 3300005548 | Switchgrass Rhizosphere | SGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLH* |
Ga0066701_104424643 | 3300005552 | Soil | LAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL* |
Ga0066701_109554001 | 3300005552 | Soil | IGGDWFLLSGDVRSDDPADVRPPADFAPNLARHTSQGGIVWIFGL* |
Ga0066661_107787902 | 3300005554 | Soil | QYVAVYAGFGGDWGLLSGDVRSDDPADVRPPADVLKDIARHTSQGGIIWIFGL* |
Ga0066707_100364256 | 3300005556 | Soil | IYAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWVFGL* |
Ga0066704_103245954 | 3300005557 | Soil | AGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL* |
Ga0066698_104935103 | 3300005558 | Soil | GGDWFLLAGDIRSDDPADVRPPADFSPDLARHTSQGGIVWLFGL* |
Ga0066698_104993583 | 3300005558 | Soil | GDVRSDDPADVRPPAGFMPDIARHTSLGGIIWLFAL* |
Ga0066670_100980681 | 3300005560 | Soil | LLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0070664_1018911081 | 3300005564 | Corn Rhizosphere | FLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0066705_105705881 | 3300005569 | Soil | VAIYAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0066694_103438462 | 3300005574 | Soil | VYAGFGGDWALLSGDVRSDDPADVRPPADFLKDIARHTSQGGIIWIFGL* |
Ga0066694_105714652 | 3300005574 | Soil | IGGDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP* |
Ga0066708_105646421 | 3300005576 | Soil | QYVAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGILWLFAL* |
Ga0068854_1013364702 | 3300005578 | Corn Rhizosphere | KQYIALYAGIGGDWFLLSGDVRADDPADVRPPADFLKDIGRHTSQGGMVWIFGL* |
Ga0066691_101010583 | 3300005586 | Soil | DWALLSGDTRSDDPADVRAPADYLKDIGRHTSQGGIVWIFGL* |
Ga0066706_100974341 | 3300005598 | Soil | YAGIGGDWFLLAGDVRSDDPADVRPPAEFMRDIARHTSQGGMVWLFGLGP* |
Ga0066706_101150921 | 3300005598 | Soil | DVRSDDPADVRPRADFAPDLARLTSQGGIVWVFGLP* |
Ga0070762_108182381 | 3300005602 | Soil | IGGDWFLLSGDYRSDDPADVRDPADFARDLARYTSQGGIVWIFAL* |
Ga0070762_109179091 | 3300005602 | Soil | VYAGIGGDWALLAGDTRSDDPTDVRAPADYIKDIARHTSQGGMIWIFGL* |
Ga0068856_1007540693 | 3300005614 | Corn Rhizosphere | LLSGDVRSDDPADIRPPADFLKDIARHTSQGGIVWIFGL* |
Ga0068856_1022873211 | 3300005614 | Corn Rhizosphere | GIGGDWALLAGDTRSDDPADVRPPIDFMKQIARHTSQGGMIWIFGL* |
Ga0068852_1019366382 | 3300005616 | Corn Rhizosphere | LLAGDVRSDDPADVRPPADFAKDLARHTSQGGIVWIFAL* |
Ga0070764_100499051 | 3300005712 | Soil | GIGGDWLLLAGDVRADDPTDVRAPADYVKDIGRHTSQGGMIWIFAL* |
Ga0066903_1051714641 | 3300005764 | Tropical Forest Soil | AVYAGVGGDPFLCAGDVRADDPADVRPPAEFLPDIGRHTSQGGIVWIFAL* |
Ga0068862_1010643451 | 3300005844 | Switchgrass Rhizosphere | IGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGLGE* |
Ga0070766_111261852 | 3300005921 | Soil | AGDFRSDDPSDVRAPADFAKDLARHTSQGGMIWIFGL* |
Ga0066382_100161415 | 3300006013 | Marine | DVRSDDPADVRPPADFMPDLARHTSQGGILWIFALD* |
Ga0066656_100158051 | 3300006034 | Soil | LSGDVRSDDPADVRPRADFAPDLARHTSQGGIVWVFGLP* |
Ga0066652_1005569113 | 3300006046 | Soil | WFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP* |
Ga0097691_10267813 | 3300006055 | Arctic Peat Soil | WLLLSGDYISNDPADVRDPADFARNLARHTSQGGIVWIFAL* |
Ga0070765_1014096792 | 3300006176 | Soil | GGDWSLLAGDMRSDDPRDIRLPADFMKDIARHTSQGGIIWIFGL* |
Ga0097621_1000400241 | 3300006237 | Miscanthus Rhizosphere | KQYVAVYAGIGGDWFLIAGDVRSDDPADVRAPAEVVKTLGRYTSQGGIVWIFGL* |
Ga0074048_133582611 | 3300006581 | Soil | KQYVAIYAGIGGDWFLLAGDVLSSDPADVRPVPDYMKDIGRHTSQGGIVWVFGL* |
Ga0079222_120824522 | 3300006755 | Agricultural Soil | IGGDWFLLSGDVRSDDPADIRPPADFMPDIARHTSQGGMVWIFALP* |
Ga0066653_101568623 | 3300006791 | Soil | ALLAGDVRSDDPADVRPPASFMPDIARHTSLGGIVWLFAL* |
Ga0066659_107365333 | 3300006797 | Soil | RSDDPADVRPPAEFMRDIARHTSQGGMVWLFGLGP* |
Ga0079221_107889222 | 3300006804 | Agricultural Soil | GDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0079221_108835453 | 3300006804 | Agricultural Soil | GDVRSDDPADVRPPADFSPDIARHTSQGGIVWLFGL* |
Ga0079220_104423592 | 3300006806 | Agricultural Soil | DWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0079220_118230351 | 3300006806 | Agricultural Soil | YVAVYAGIGGDWFLIAGDVRSDDPADVRAPADVVKTLGRHTSQGGIVWIFGL* |
Ga0079220_120474473 | 3300006806 | Agricultural Soil | FLISGDVRSDDPADVRAPADFLKDIARHTSQGGMVWIFGL* |
Ga0075433_1000692311 | 3300006852 | Populus Rhizosphere | GDWFLFSGDVRADDPADVRPPADFMKDIGRHTSQGGIVWIFGL* |
Ga0075433_102918124 | 3300006852 | Populus Rhizosphere | YVAVYAGFGGDPFLLSGDVRADDPADVRPPADFMKDIGRHTSQGGIVWIFGL* |
Ga0075433_108455351 | 3300006852 | Populus Rhizosphere | VYAGIGGDWFLLAGDVRSDDPADVRATSDPYKDIGRHTSQGGIVWIFGL* |
Ga0075433_119390002 | 3300006852 | Populus Rhizosphere | SGDVRSDDPTDVRDPADFIKDLGRYTSGGGMVWVFGL* |
Ga0075425_1003180021 | 3300006854 | Populus Rhizosphere | AVYAGIGGDWFLLAGDVRSDDPADVRATSDPYKDIGRHTSQGGIVWIFGL* |
Ga0075425_1003528291 | 3300006854 | Populus Rhizosphere | SGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0075425_1004988631 | 3300006854 | Populus Rhizosphere | SGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFGL* |
Ga0068865_1021318582 | 3300006881 | Miscanthus Rhizosphere | GDVRSDDPADVRAPADVVKTLGRHTSQGGIVWIFGL* |
Ga0075426_1000153217 | 3300006903 | Populus Rhizosphere | YIAICDGIGGDWFLLAGDVRSDDPADVRPPADFIPDIARHTSQGGTVWVFALGGER* |
Ga0075424_1001090855 | 3300006904 | Populus Rhizosphere | FLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0075424_1001140211 | 3300006904 | Populus Rhizosphere | GGDWALLAGDIRSDDPSDIRAPVDPVKDIARHTSQGGIVWIFGL* |
Ga0075424_1001141581 | 3300006904 | Populus Rhizosphere | IAVYAGIGGDWFLLSGDVRSDDPADVRPPADFAPELARHTSQGGIVWIFGL* |
Ga0075436_1001375621 | 3300006914 | Populus Rhizosphere | YVAVYAGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0079219_109178761 | 3300006954 | Agricultural Soil | MAFQTRCAFLLSDDLRSDDPADVRPPADFARELGWHTSQGGMI* |
Ga0079219_120152771 | 3300006954 | Agricultural Soil | GIGGDWFLLAGDVRSDDPADVRPPADFSPDIARHTSQGGIVWLFGL* |
Ga0099793_101551281 | 3300007258 | Vadose Zone Soil | VRSDDPTDVRDPADFIRDLGRYTSQGGMVWIFAL* |
Ga0102947_10439423 | 3300007619 | Soil | IAGDVRSDDPADVRPPADFAPDLARYTSRGGMLWIFAL* |
Ga0104322_1216814 | 3300007819 | Permafrost Soil | YKSDDPADVRDPADFARNLARHTSQGGIVWIFAL* |
Ga0102924_12613311 | 3300007982 | Iron-Sulfur Acid Spring | AIYAGIGGDWFLLSGDVRSDDPADVRDPADFARDLARHTSQGGIVWIFAL* |
Ga0066710_1008414343 | 3300009012 | Grasslands Soil | FLLSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL |
Ga0066710_1011703882 | 3300009012 | Grasslands Soil | GIGGDWFLLSGDVRSDDPADVRPPADFAPELARHTSQGGIVWIFGL |
Ga0066710_1037018632 | 3300009012 | Grasslands Soil | VAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL |
Ga0099829_100650061 | 3300009038 | Vadose Zone Soil | VAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0099830_108475223 | 3300009088 | Vadose Zone Soil | GDVRSDDPADVRPPADFAPELARHTSQGGIVWIFGL* |
Ga0099828_104690181 | 3300009089 | Vadose Zone Soil | LLAGDVRSDDPGDVRPPADFAPDLARHTSQGGIVWIFAR* |
Ga0099827_119263441 | 3300009090 | Vadose Zone Soil | RQYVAVYAGIGGDWFLLSGDVRSDDPADVRPPAAFMPDIARYTSQGGIVWLFAL* |
Ga0105250_100497573 | 3300009092 | Switchgrass Rhizosphere | QYVAVYAGIGGDWALLSGDVRSDDPADVRPPADFMKNIARHTSQGGMIWIFGL* |
Ga0105247_116932522 | 3300009101 | Switchgrass Rhizosphere | AVYAGIGGDWLLLAGDVNSADPADVRPPPDFAKNIGRHTSQGGIVWIFGL* |
Ga0066709_1025328001 | 3300009137 | Grasslands Soil | DWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL* |
Ga0105243_110565662 | 3300009148 | Miscanthus Rhizosphere | YVAVYAGVGGDPFLFAGDVRADDPADVRPPADFMKDLGRHTSQGGLVWIFAL* |
Ga0105243_130654282 | 3300009148 | Miscanthus Rhizosphere | SGDVRSDDPADIRDPADFIKDLARYTSTGGMVWVFAL* |
Ga0111538_100724007 | 3300009156 | Populus Rhizosphere | SGDVRADDPADLRPPADFAPDLARHTSQGGMVWIFGL* |
Ga0075423_128331942 | 3300009162 | Populus Rhizosphere | IAGDIRSDDPADVRPRADFAPDLSRYTSLGGTVWVFAL* |
Ga0105241_104737311 | 3300009174 | Corn Rhizosphere | QYVAILAGIGGDWFLLSGDVRSDDPADVRPPADFARELGRHTSQGGMIWIFGL* |
Ga0105242_104658423 | 3300009176 | Miscanthus Rhizosphere | AGIGGDWFLIAGDVRSDDPADVRAPADVVKTLGRHTSQGGIVWIFGL* |
Ga0105237_101617201 | 3300009545 | Corn Rhizosphere | IGGDWFLLSGDVRADDPADVRPPADFLKDIGRHTSQGGMVWIFGL* |
Ga0105238_119621632 | 3300009551 | Corn Rhizosphere | AIYAGIGGDWFLISGDVRSDDPADVRAPADFLKDIARHTSQGGMVWIFGL* |
Ga0105249_110100381 | 3300009553 | Switchgrass Rhizosphere | AVYAGVGGDPFLFAGDVRADDPTDVRPPADFMKDIGRHTSQGGIVWIFTL* |
Ga0105249_130897771 | 3300009553 | Switchgrass Rhizosphere | IAGDVRSDDPADVRPRADFAPDLAKYTSRGGILWIFGF* |
Ga0126374_101833893 | 3300009792 | Tropical Forest Soil | GDTRSDDPADIRAPADPVKDIARYTSQGGMVWIFGL* |
Ga0126315_111611622 | 3300010038 | Serpentine Soil | YAGFGGDWGLLSGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWVFGL* |
Ga0126380_110065511 | 3300010043 | Tropical Forest Soil | YVAVYAGIGGDWALLAGDTRSDDPADVRAPADYVKDIARYTSQGGIIWIFSL* |
Ga0126382_100747351 | 3300010047 | Tropical Forest Soil | GDWFLLAGDVRSDDPADVRPPADFIPDIARRTSQGGTVWVFGLGTGP* |
Ga0126382_115541921 | 3300010047 | Tropical Forest Soil | YVAVYAGFGGDWFLSSGDVRADDPADVRPPANFMKDIGRHTSQGGIVWIFGL* |
Ga0126373_104157251 | 3300010048 | Tropical Forest Soil | QYVAVYAGFGGDWALLSGDVFSSDPDDVRAPADFMKDIGRYTSQGGIIWIFSL* |
Ga0134082_100456031 | 3300010303 | Grasslands Soil | GGDWLLRSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFGL* |
Ga0134082_105561312 | 3300010303 | Grasslands Soil | ALLAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL* |
Ga0134088_104588622 | 3300010304 | Grasslands Soil | QYIAVYAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0134109_100172971 | 3300010320 | Grasslands Soil | GDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP* |
Ga0134084_103254712 | 3300010322 | Grasslands Soil | VYAGIGGDWFLLAGDVRSDDPADVRPPADFIRDIARHTSQGGMVWLFALGP* |
Ga0134086_102785392 | 3300010323 | Grasslands Soil | VYAGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0134064_100993311 | 3300010325 | Grasslands Soil | AGDVRSDDPAEVRPPADFMRDIARHTSQGGMVWLFGLGP* |
Ga0134065_102675431 | 3300010326 | Grasslands Soil | QYVAVYAGLGGDWALLAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL* |
Ga0134111_103435921 | 3300010329 | Grasslands Soil | VYAGFGGDWFLLSGDVRSDDPADVRPPAGFMSDIARHTSLGGIIWLFAL* |
Ga0134111_103793802 | 3300010329 | Grasslands Soil | WALLAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL* |
Ga0134111_105525962 | 3300010329 | Grasslands Soil | VYAGIGRDWFLLSGDVRSDDPADVRPPADFAPELARHTSQGGIVWIFGL* |
Ga0134063_100370524 | 3300010335 | Grasslands Soil | VAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFGL* |
Ga0134062_1000140512 | 3300010337 | Grasslands Soil | DVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0134062_100053242 | 3300010337 | Grasslands Soil | VYAGIGGDWALLAGDVRSDDPTDVRPPPDYMKNIARHTSQGGMIWIFGL* |
Ga0134062_105462421 | 3300010337 | Grasslands Soil | GDVRSDDPADVRPRADFAPDLARHTSQGGIVWVFGL* |
Ga0126376_121655673 | 3300010359 | Tropical Forest Soil | QYIAVYAGIGGDWFLLSGDVRSDDPADVRPPADFLKDIARHTSQGGMVWIFGL* |
Ga0126372_125481152 | 3300010360 | Tropical Forest Soil | DPDLFSGDVVSGDQTDVRPPADFMKDLGRHTSQGGMVWLFGL* |
Ga0126378_122188102 | 3300010361 | Tropical Forest Soil | GGDWFLLSGDARSDDPADVRAPADFLKDIARRTSQGGIVWIFGL* |
Ga0126377_113916241 | 3300010362 | Tropical Forest Soil | LAGDVRSDDPADVRPPADFIPDIARRTSQGGTVWVFGLGTER* |
Ga0126377_119016272 | 3300010362 | Tropical Forest Soil | VYAGFGGDPFLFSGDVLSDDPADVRPPADFMKDIGRHTSQGGIVWIFGL* |
Ga0126377_132933111 | 3300010362 | Tropical Forest Soil | GDWFLLAGDVRADDPADVRPVPDFAKNIGRHTSQGGIVWIFGL* |
Ga0126379_110268561 | 3300010366 | Tropical Forest Soil | GIGGDWFLLAGDVRSDDPADVRPPADFIPDIARRTSQGGTVWVFGLGGQ* |
Ga0134125_113779501 | 3300010371 | Terrestrial Soil | AGIGGDWFLLAGDVRSDDPADVRPPADFAKDLARHTSQGGIVWIFAL* |
Ga0134125_127900092 | 3300010371 | Terrestrial Soil | AGDVNSADPADVRPPADFAKNIGRHTSQGGIVWIFGL* |
Ga0134128_116984372 | 3300010373 | Terrestrial Soil | WFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0134128_117289462 | 3300010373 | Terrestrial Soil | DGRQYVAVYAGFGGDWALIAGDARSDDPADVRGPADPVKSIARHTSLGGIIWIFAL* |
Ga0126381_1033428742 | 3300010376 | Tropical Forest Soil | YAGIGGDWALLSGDTRSDDPADVRAPADFIKDIARHTSQGGIIWIFGL* |
Ga0136449_1020894681 | 3300010379 | Peatlands Soil | DGRQYVAVYAGVGGDWSLLAGDMRSDDPRDIRLPADFMKDIARHTSQGGIIWIFAL* |
Ga0134126_100355448 | 3300010396 | Terrestrial Soil | ALYAGIGGDWFLLSGDVRADDPADVRPPADFLKDIGRHTSQGGMVWIFGL* |
Ga0134126_111724401 | 3300010396 | Terrestrial Soil | DVRSDDPADLRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0134126_125129971 | 3300010396 | Terrestrial Soil | ARSDDPADVRAPADPVKAIARHTSLGGIVWIFAL* |
Ga0134126_128382711 | 3300010396 | Terrestrial Soil | DVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL* |
Ga0134126_129567811 | 3300010396 | Terrestrial Soil | QYVAVFAGIGGDWQLLAGDTHSDDPADVRAPLDMMKQIARHTSQGGMVWIFGL* |
Ga0126383_116804951 | 3300010398 | Tropical Forest Soil | AGIGGDWALLAGDTRSDDPADVRAPADYVKDIARYTSQGGIIWIFAL* |
Ga0134127_103222154 | 3300010399 | Terrestrial Soil | DWFLLSGDVRSDDPADLRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0134127_122564621 | 3300010399 | Terrestrial Soil | GGDWFLIAGDVRSDDPADIRPPADFAPKLGRHTSQGGIVWVFGL* |
Ga0134123_127994861 | 3300010403 | Terrestrial Soil | VAVYAGIGGDWFLLSGDVRSDDPADLRPPADFAPELGRHTSQGGIVWIFGL* |
Ga0134123_134938881 | 3300010403 | Terrestrial Soil | QYVAIYAGIGGDWFLLSGDVRSDDPADVRPPADFAPQLGRHTSQGGMVWVFGL* |
Ga0114947_105304662 | 3300011112 | Deep Subsurface | WFLIAGDVRSDDPADIRPPADFVSDLARYTSRGGMLWIFAL* |
Ga0137392_105787963 | 3300011269 | Vadose Zone Soil | VRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0137392_113873011 | 3300011269 | Vadose Zone Soil | LAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0137393_105615353 | 3300011271 | Vadose Zone Soil | GGDWFLLAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0137393_107013613 | 3300011271 | Vadose Zone Soil | FLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0137314_10339273 | 3300011420 | Soil | LLSGDVRSDDPADLRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0137452_10387381 | 3300011441 | Soil | ISGDVRSDDPADVRAPATFMPDIARHTSQGGIVWIFGLP* |
Ga0137389_107098652 | 3300012096 | Vadose Zone Soil | GIGGDWFLLSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL* |
Ga0137388_107302553 | 3300012189 | Vadose Zone Soil | AVYAGIGGDWFLLAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0137364_104340061 | 3300012198 | Vadose Zone Soil | GDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL* |
Ga0137383_109149662 | 3300012199 | Vadose Zone Soil | QYVAVYAGIGGDWFLLAGDVRSDDPTDVRPPADFAPDLARHTSQGGIVWVFGF* |
Ga0137382_102313013 | 3300012200 | Vadose Zone Soil | YAGIGGDWFLLAGDVRSDDPADVRPPADFMPNIARHTSQGGIVWIFAL* |
Ga0137365_103255573 | 3300012201 | Vadose Zone Soil | AGIGGDWFLLSGDVRSDDPADVRPPADFAPQLARHTSQGGIVWIFGL* |
Ga0137399_100109697 | 3300012203 | Vadose Zone Soil | SGDTRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL* |
Ga0137399_100215823 | 3300012203 | Vadose Zone Soil | VYAGIGGDWFLLSGDVRSDDPADVRPPADFVPDLARHTSQGGTVWIFGL* |
Ga0137399_100705001 | 3300012203 | Vadose Zone Soil | VYAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0137374_102159863 | 3300012204 | Vadose Zone Soil | VRSDDPADVRPPAAFMPDLARHTSLGGIVWLFAL* |
Ga0137381_101378561 | 3300012207 | Vadose Zone Soil | AVYSGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL* |
Ga0137381_102786651 | 3300012207 | Vadose Zone Soil | DVRSDDPADVRPPASFMPDIARHTSLGGIVWLFAL* |
Ga0137381_109095431 | 3300012207 | Vadose Zone Soil | GIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWVFGL* |
Ga0137381_112651501 | 3300012207 | Vadose Zone Soil | WFLLSGDVRSDDPADVRPPADFAPNLARHTSQGGIVWIFGL* |
Ga0137370_109980132 | 3300012285 | Vadose Zone Soil | FLLAGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0137387_108621863 | 3300012349 | Vadose Zone Soil | VRSDDPADVRPPASFMPEIARHTSQGGIVWLFAL* |
Ga0137386_100029441 | 3300012351 | Vadose Zone Soil | VYAGFGGDPFLLAGDVRSDDPADVRPPASFMPEIARHTSQGGIVWLFAL* |
Ga0137366_103819971 | 3300012354 | Vadose Zone Soil | AGFGGDPFLLAGDVRSDDPADVRPPASFMPEIARHTSLGGIVWLFAL* |
Ga0137371_104174341 | 3300012356 | Vadose Zone Soil | DVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0137385_102834801 | 3300012359 | Vadose Zone Soil | DWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0137360_100967071 | 3300012361 | Vadose Zone Soil | VAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL* |
Ga0137361_107509353 | 3300012362 | Vadose Zone Soil | YAGIGGDWFLLSGDVRSDDPADVRPPADFASDLARHTSQGGIVWIFGL* |
Ga0137358_104725183 | 3300012582 | Vadose Zone Soil | GGDWFLLSGDVRSDDPADVRPPADFAPDRARHTSQGGIVWIFGL* |
Ga0137398_103922331 | 3300012683 | Vadose Zone Soil | GIGGDWFLLAGDVRADDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0157306_103173492 | 3300012912 | Soil | GKQNVAVYAGIGGDWFLLSGDVRSDDPADVRPPADFAPELGRHTSQGGIVWIFGL* |
Ga0137395_100730371 | 3300012917 | Vadose Zone Soil | LLAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0137396_106561851 | 3300012918 | Vadose Zone Soil | AGIGGDWALLSGDVRSDDPADVRPPADFMKNIARHTSQGGLIWIFCL* |
Ga0137394_106977512 | 3300012922 | Vadose Zone Soil | FLLAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL* |
Ga0137416_104593553 | 3300012927 | Vadose Zone Soil | GDVRSDDPADVRPPADFLKDIARHTSQGGIIWIFGL* |
Ga0137404_100839225 | 3300012929 | Vadose Zone Soil | SGDVRSDDPADVWPPADLMPEIARHTSQGGIVWIFAL* |
Ga0137407_103533571 | 3300012930 | Vadose Zone Soil | AGDVRSDDPADVRPPADFVPDIARHTSQGGIVWIFAL* |
Ga0137407_111543532 | 3300012930 | Vadose Zone Soil | AVYAGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0126375_101752271 | 3300012948 | Tropical Forest Soil | YVAVYAGIGGDWFLIAGDVRSDDPADVRSPADVVKTLGRHTSQGGIIWIFGL* |
Ga0134077_102121663 | 3300012972 | Grasslands Soil | GDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWVFGL* |
Ga0168317_10073424 | 3300012982 | Weathered Mine Tailings | VYAGIGGDWALLAGDTRSDDPADVRPPVDFIKEIARHTSQGGMIWIFAL* |
Ga0157369_101143635 | 3300013105 | Corn Rhizosphere | AGIGGDWFLLAGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFAL* |
Ga0157369_121119522 | 3300013105 | Corn Rhizosphere | LLAGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFAL* |
Ga0157374_111788852 | 3300013296 | Miscanthus Rhizosphere | AVYAGIGGDLFLLSGDVRSDDPADVRPPADYLKTLGRHTSQGGIVSIFGL* |
Ga0157372_120193142 | 3300013307 | Corn Rhizosphere | YAGIGGDWFLLAGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFAL* |
Ga0157372_128193691 | 3300013307 | Corn Rhizosphere | VRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL* |
Ga0134075_104009332 | 3300014154 | Grasslands Soil | VYAGIGGDWFLLAGDVRSDDPADVRPPAEFMRDIARHTSQGGMVWLFGLGP* |
Ga0134079_102377461 | 3300014166 | Grasslands Soil | IAVYAGIGGDWFLLSGDVRSDDPADVRPPADFAPELARHTSQGGIVWVFGL* |
Ga0182008_100650401 | 3300014497 | Rhizosphere | QYVAIYAGIGGDWLLLSGDYKSDDPADVREPADFARDLARHTSQGGIVWIFAL* |
Ga0181519_110696942 | 3300014658 | Bog | GGDWLLLTGDVRSDDPTDVRAPADYMKDIARHTSQGGLIWIFGL* |
Ga0180069_11590212 | 3300014882 | Soil | AGIGGDWFLLSGDVRSDDPADIRPPADFAPDLARHTSQGGIVWIFGL* |
Ga0157379_111142893 | 3300014968 | Switchgrass Rhizosphere | AGVGGDWALLSGDMDSADPADVRVPLDMMKQIARHTSQGGMVWMFGL* |
Ga0157379_122880202 | 3300014968 | Switchgrass Rhizosphere | YVAIYAGIGGDPYLFSGDFISGDQTDVRPPADFMKDIGRHTSQGGMVWIFGL* |
Ga0157379_125234372 | 3300014968 | Switchgrass Rhizosphere | VYAGVGGDPFLFAGDVRADDPTDVRPPADFMKDIGRHTSQGGIVWIFTL* |
Ga0157376_116673601 | 3300014969 | Miscanthus Rhizosphere | GDWFLLSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLP* |
Ga0137420_10738241 | 3300015054 | Vadose Zone Soil | GHCCPGDTRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL* |
Ga0137420_12319183 | 3300015054 | Vadose Zone Soil | FGGDWALLSGDTRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL* |
Ga0173480_101261073 | 3300015200 | Soil | YAGFGGDWGLLSGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL* |
Ga0137418_111784392 | 3300015241 | Vadose Zone Soil | DVMSSPPDDIRPPATFMPDIARHTSQGGIVWIFGL* |
Ga0180089_10861951 | 3300015254 | Soil | GDVRSDDPADVRPPADFASDLGRHTSQGGIVWIFGL* |
Ga0134072_101051823 | 3300015357 | Grasslands Soil | AGIGGDWFLLAGDVRSDDPADVRLPADFMRDIARHTSQGGMVWLFGLGP* |
Ga0134085_105295882 | 3300015359 | Grasslands Soil | YVAVYAGIGGDWFLLSGDVRSDDPADVRPRADFAPDLARHTSQGGIVWVFGL* |
Ga0132256_1006070743 | 3300015372 | Arabidopsis Rhizosphere | AGIGGDWFVIAGDVRSDDPADVRPRADFAPDLSRYTSQGGIVWVFGL* |
Ga0132256_1016279191 | 3300015372 | Arabidopsis Rhizosphere | TRSDDPADIRAPVDPVKDIARYTSQGGIVWIFGL* |
Ga0132255_1007033693 | 3300015374 | Arabidopsis Rhizosphere | MAFQTRCAFLLSDDLRSDDPADVRPPADFARELAQHTSQGGMIWIFGL* |
Ga0132255_1048946261 | 3300015374 | Arabidopsis Rhizosphere | LSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLP* |
Ga0182036_109009691 | 3300016270 | Soil | DGRQYVAVYAGFGGDWALIAGDTRSDDPADIRAPADPVKDIARCTSQGGIVWIFGL |
Ga0182033_102671731 | 3300016319 | Soil | VYAGIGGDWALLAGDTRSDDPTDVRPPADFVPDIARHTSQGGIVWIFGL |
Ga0182034_110124971 | 3300016371 | Soil | LLAGDTRSDDPTDVRAPADYAKDIARYTSQGGILWIFGL |
Ga0182040_102979231 | 3300016387 | Soil | AGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0182040_105200883 | 3300016387 | Soil | GGDWALLAGDTRSDDPADVRAPADYVKDIARYTSQGGIVWIFGL |
Ga0134069_10990303 | 3300017654 | Grasslands Soil | LAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL |
Ga0134069_11186721 | 3300017654 | Grasslands Soil | VAVYAGIGGDWFLLSGDVRSDDPADVRPPADFMPEIARHTSQGGIVWIFAL |
Ga0134112_100252504 | 3300017656 | Grasslands Soil | AVYAGFGGDPYLLAGDVRSDDPADVRPPASFMPDIARHTSLGGIVWLFGL |
Ga0187824_100485044 | 3300017927 | Freshwater Sediment | GDVRSDDPADVRPPADFAKDLARHTSQGGIVWIFAL |
Ga0187825_102055722 | 3300017930 | Freshwater Sediment | LLVGDTRSDDPRDIRLPADYMKDIARHTSQGGIIWIFGL |
Ga0187817_109748052 | 3300017955 | Freshwater Sediment | FLLSGDVRSDDPSDVRPPADFAKDIARHTSQGGLIWIFGL |
Ga0187779_110677971 | 3300017959 | Tropical Peatland | VAVYAGYGGDWFLLAGDTRSDDPADVRPPADYIKDIARYTSQGGIVWIFGL |
Ga0187777_103383303 | 3300017974 | Tropical Peatland | ALLAGDTRSDDPTDVRLRPDFMKDIARHTSQGGLIWIFGL |
Ga0187777_110049992 | 3300017974 | Tropical Peatland | YVAVYAGFRGDWALISGDTLAADPADVRPPADFPKDLARHTSQGGIVWIFGL |
Ga0187777_110721272 | 3300017974 | Tropical Peatland | WALIAGDARSDDPSDIRAPAEPVKDIGRHTSQGGIVWIFGL |
Ga0187782_112804171 | 3300017975 | Tropical Peatland | YWALISGDTLAADPTDVRGPAEFLKDLARHTSQGGLVWIFGL |
Ga0187822_100119305 | 3300017994 | Freshwater Sediment | VAVYAGFGGDWALLSGDTRSDDPADVRAPADFIKDIARHTSQGGIIWIFGL |
Ga0187766_103821143 | 3300018058 | Tropical Peatland | LLAGDTRSDDPTDVREPAEFMKDIARHTSQGGIVWIFGL |
Ga0187766_109082161 | 3300018058 | Tropical Peatland | IGGDWALLAGDTRSDDPNDVRAPADYVKDIARYTSQGGIIWIFAL |
Ga0184637_105514162 | 3300018063 | Groundwater Sediment | DVRSDDPADVRPPADFASDLGRYTSQGGIVWIFGL |
Ga0187773_105258191 | 3300018064 | Tropical Peatland | ICDGIGGDWFLLSGDVRSDDPADVRPPADFIPDIASRTSQGGTVWVFALGGEP |
Ga0184632_104074152 | 3300018075 | Groundwater Sediment | LSGDVRSDDPSDVRPPADFMKDIGRHTSQGGIVWIFGL |
Ga0184612_102258261 | 3300018078 | Groundwater Sediment | QYVAVYAGFGGDWFLISGDVRSDDPADVRAPASFMPDIARHTSQGGIVWVFGLP |
Ga0184627_101694613 | 3300018079 | Groundwater Sediment | SGDVRSDDPADLRPPADFAPDLARYTSQGGMVWIFGL |
Ga0066655_110781582 | 3300018431 | Grasslands Soil | LAGDVRSDDPADVRSPADFMRDIARHTSQGGMVWLFGLGP |
Ga0066667_104333863 | 3300018433 | Grasslands Soil | QYVAVYAGLGGDWALLAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL |
Ga0066667_119384622 | 3300018433 | Grasslands Soil | FLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP |
Ga0190274_112116683 | 3300018476 | Soil | LSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWIFGLQ |
Ga0190271_106047041 | 3300018481 | Soil | DNKQYVAVYAGFGGDWFLLSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLR |
Ga0190271_106252671 | 3300018481 | Soil | LLSGDVNSQDPADVRPPADFMKDIGRHTSQGGLIWIFAL |
Ga0066669_103644361 | 3300018482 | Grasslands Soil | GFGGDWFLLSGDVRSDDPADVRPPAGFMPDIARHTSLGGIIWLFAL |
Ga0066669_110831741 | 3300018482 | Grasslands Soil | DWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL |
Ga0193733_10423971 | 3300020022 | Soil | LSGDVMSSDPADIRPPATFMPDIARHTSQGGIVWIFGL |
Ga0179590_11032293 | 3300020140 | Vadose Zone Soil | IGGDIFLLSGDLRSDDPADVRAPAEYMKTLARHTSQGGIVWIFGL |
Ga0210395_106803472 | 3300020582 | Soil | GGDWALLAGDTRSDDPTDVRAPADYIKDIARHTSQGGIIWIFGL |
Ga0210395_107763271 | 3300020582 | Soil | GIGGDWALLAGDTRYDDPTDVREPAEFMKDIARHTSQGGIVWIFGL |
Ga0210401_113933032 | 3300020583 | Soil | LSGDVRSDDPTDVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0215015_107205492 | 3300021046 | Soil | SSAASDVYKRQVYAGIGGDWFLLAGDVCSDDPADVRAPADFIKDIARHTSQGGIVWLFALTP |
Ga0210382_100328821 | 3300021080 | Groundwater Sediment | IGGDWFLLSGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFGL |
Ga0210404_101710821 | 3300021088 | Soil | QYVAVYAGFGGDWALLSGDVRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL |
Ga0210404_105976182 | 3300021088 | Soil | CGGDWGLLSGDVRSDDPADVRPPADFLKDIARHTSQGGIIWIFAL |
Ga0210405_109840942 | 3300021171 | Soil | SLLSGDYRSDDPADVRDPADFARDLARYTSQGGIVWIFAL |
Ga0210396_104361263 | 3300021180 | Soil | GDYRSDDPADVRDPADFARDLARYTSQGGIVWIFAL |
Ga0210383_116699251 | 3300021407 | Soil | LAGDMRSDDPRDIRLPADFMKDIARHTSQGGIIWIFGL |
Ga0210390_105099933 | 3300021474 | Soil | LLLSGDVRSDDPTDVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0210410_111593581 | 3300021479 | Soil | GDTRSDDPTDVRSPADYMKDIARHTSQGGIVWIFGL |
Ga0126371_108321883 | 3300021560 | Tropical Forest Soil | DWALLSGDTRSDDPADVRPPAGYLKDIARHTSEGGIIWIFGL |
Ga0126371_135713671 | 3300021560 | Tropical Forest Soil | AVYAGIGGDWFLLSGDVRSDDPADVRPPADFAKDLARHTSQGGLVWVFGLP |
Ga0213880_100585361 | 3300021953 | Exposed Rock | WALIAGDMRSDDPADIRAPADPVNDIARHTSLGGMLWIFGL |
Ga0224502_100176431 | 3300022218 | Sediment | GDWFLIAGDVRSDDPADVRPPADFAPDLARYTSRGGMLWIFAL |
Ga0222622_107222931 | 3300022756 | Groundwater Sediment | GDWALLSGDTRADDPADIRDPADYIRDLARYTSQGGMVWVFALP |
Ga0247669_10471641 | 3300024182 | Soil | DGRQYVAVYAGFGGDWALIAGDARSDDPADVRAPADPVKAIARHTSLGGIVWIFAL |
Ga0137417_13972601 | 3300024330 | Vadose Zone Soil | AGFGGDWGLLSGDVRSDDPADVRPPADLLKDIARHTSQGGIIWIFGL |
Ga0209619_105527281 | 3300025159 | Soil | GDWALLTGDVRSVDPTDVRPPTSFMPDIARHTSLGGIVWLFGL |
Ga0207692_108364761 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AVYAGFGGDWALLSGDTRSDDPADVRPPADFLKDIARHTSQGGIVWIFGL |
Ga0207688_110994841 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | GDVVANDPADVRPPADFMKDIGRHTSQGGMVWIFGL |
Ga0207680_109942892 | 3300025903 | Switchgrass Rhizosphere | GRQYVAVYAGFGGDWALIAGDTRSDDPADIRAPADPVKDIARYTSQGGMVWIFGL |
Ga0207699_104150273 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | YVCVYAGIGGDWALLVGDTRSDDPADVRPPVDFIKEIARHTSQGGMIWIFAL |
Ga0207684_106341401 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | FLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL |
Ga0207707_100973546 | 3300025912 | Corn Rhizosphere | LLAGDVGSDDPADVRPPADFVKDLARHTSRGGLVWIFAL |
Ga0207707_101686141 | 3300025912 | Corn Rhizosphere | LAVYAGIGGDWFLLAGDVRSDDPADVRPPADFAKDLARHTSQGGMVWIFAL |
Ga0207671_108656172 | 3300025914 | Corn Rhizosphere | AVYAGIGGDWFLLAGDVRSDDPADVRAPADYIKTIGRHTSQGGIVWIFGL |
Ga0207649_112672372 | 3300025920 | Corn Rhizosphere | LSGDVRADDPADVRPPADFLKDIGRHTSQGGMVWIFGL |
Ga0207646_109546153 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLSGDVRSDDPADIRDPADFIKDLARYTSAGGMVWVFALGPPR |
Ga0207700_118323961 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DWFLLSGDVRSDDPADVRAPADFIKDIARHTSQGGIVWIFGL |
Ga0207644_110746411 | 3300025931 | Switchgrass Rhizosphere | DWALIAGDARSDDPSDIRAPAEPVKDIGRHTSQGGIVWIFGL |
Ga0207686_117980482 | 3300025934 | Miscanthus Rhizosphere | LLLAGDVNSADPADVRPPPDFAKNIGRHTSQGGIVWIFGL |
Ga0207704_107898942 | 3300025938 | Miscanthus Rhizosphere | WALLSGDTRADDPADIRDPADYIRDLARYTSQGGMVWVFALP |
Ga0207661_100679361 | 3300025944 | Corn Rhizosphere | YAGIGGDWLLLSGDYKSDDPADVRDPADFVRDLARHTSQGGIVWIFALEGTPQ |
Ga0207651_108741803 | 3300025960 | Switchgrass Rhizosphere | WFLIAGDIRSDDPADVRPRADFAPDLSRYTSQGGIVWVFGL |
Ga0207658_119041922 | 3300025986 | Switchgrass Rhizosphere | QYVAVYAGIGGDWLLLAGDVNSADPADVRPPPDFAKNMGRHTSQGGIVWIFGL |
Ga0207677_117026252 | 3300026023 | Miscanthus Rhizosphere | MSLIYSGIGGDWFLIAGDIRSDDPADVRPRADFAPDLSRYTSQGGIVWVFAL |
Ga0207703_117622381 | 3300026035 | Switchgrass Rhizosphere | YLFSGDFISGDQTDVRPPADFMKDIGRHTSQGGMVWIFGL |
Ga0207639_119189762 | 3300026041 | Corn Rhizosphere | GDWGLISGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0207702_105483191 | 3300026078 | Corn Rhizosphere | LAVYAGIGGDWFLLAGDVGSDDPADVRPPADFVKDLARHTSRGGLVWIFAL |
Ga0207702_114557031 | 3300026078 | Corn Rhizosphere | AVFAGVGGDWALLSGDMRSDDPADIRVPLDMMKQIARHTSQGGMVWMFGL |
Ga0207641_120408781 | 3300026088 | Switchgrass Rhizosphere | FLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL |
Ga0209235_11133881 | 3300026296 | Grasslands Soil | GDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWVFAR |
Ga0209237_10068338 | 3300026297 | Grasslands Soil | IGGDWFLLSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL |
Ga0209236_11246593 | 3300026298 | Grasslands Soil | LLSGDVRSDDPADVRPRADFAPDLARHTSQGGIVWIFGLP |
Ga0209238_10372991 | 3300026301 | Grasslands Soil | KQYVAVYAGFGGDWALLSGDVRSDDPADVRPPADFLKDIARHTSQGGIIWIFGL |
Ga0209238_10566391 | 3300026301 | Grasslands Soil | LSGDVRSDDPADVRPPADFMPEIARHTSQGGIVWIFAL |
Ga0209238_12259461 | 3300026301 | Grasslands Soil | VYAGIGGDWFLLSGDVRSDDPADVRPRADFAPDLARHTSQGGIVWIFGLP |
Ga0209239_10634233 | 3300026310 | Grasslands Soil | RQYVAVYAGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL |
Ga0209268_10603313 | 3300026314 | Soil | YAGIGGDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP |
Ga0209155_12116471 | 3300026316 | Soil | LLAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL |
Ga0209471_12113601 | 3300026318 | Soil | KQHLAVYAGIGGDWALLAGDVRSDDPADVRPPLSVMPDIARHTSLGGIVWLFAL |
Ga0209471_13008552 | 3300026318 | Soil | QYVALYAGYGGDPGLLTGDVSADDPADVRLPADYMKDIARHTSKGGLVWIFGL |
Ga0209472_10186932 | 3300026323 | Soil | VAVYAGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFGL |
Ga0209152_100956441 | 3300026325 | Soil | YVAVYAGIGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL |
Ga0209266_11585071 | 3300026327 | Soil | RQYVAVYAGIGGDWFLLSGDVRSDDPADVRPRADFAPDLARHTSQGGIVWVFALP |
Ga0209267_13252102 | 3300026331 | Soil | IGGDWFLLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFAL |
Ga0209158_10931381 | 3300026333 | Soil | DWALLSGDTRSDDPADVRAPADYLKDIGRHTSQGGIVWIFGL |
Ga0209377_12352391 | 3300026334 | Soil | LSGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL |
Ga0209804_13255702 | 3300026335 | Soil | YAGLGGDWALLAGDVRSDDPADVRPPASFMPDLARHTSLGGIVWLFAL |
Ga0209159_11192963 | 3300026343 | Soil | GDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL |
Ga0209058_12000113 | 3300026536 | Soil | GDVRSDDPADVRPPAGFMPDIARHTSLGGIIWLFAL |
Ga0209376_11882263 | 3300026540 | Soil | LLSGDVRSDDPADVRPPADFMPDIARHTSQGGIVWIFGL |
Ga0209156_102715621 | 3300026547 | Soil | LSGDVRSDDPADVRPPADFLKDIARHTSQGGIIWIFGL |
Ga0209161_100233246 | 3300026548 | Soil | QYVAVYAGIGGDWFLLAGDVRSDDPADVRPPAEFMRDIARHTSQGGMVWLFGLGP |
Ga0209161_100672681 | 3300026548 | Soil | GDVRSDDPADVRPPLSVMPDIARHTSLGGIVWLFAL |
Ga0209161_105397321 | 3300026548 | Soil | GFGGDWALLSGDVRSDDPADVRPPADFLKDIARHTSQGGIIWIFGL |
Ga0209648_101167001 | 3300026551 | Grasslands Soil | AGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWVFGL |
Ga0209004_10702012 | 3300027376 | Forest Soil | GLGGDWALLSGDTRVDDPADVRPPADFLKDIARHTSQGGIVWIFGL |
Ga0208993_11015012 | 3300027480 | Forest Soil | WLLLSGDVRSDDPADLRPAAPFMPDIAKHTSQGGIVWIFGL |
Ga0209076_10219281 | 3300027643 | Vadose Zone Soil | LLAGDVRADDPADVRPPADFMSDIARHTSQGGIVWIFAL |
Ga0209388_11472232 | 3300027655 | Vadose Zone Soil | IGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL |
Ga0209689_12028801 | 3300027748 | Soil | VYAGIGGDWFLLSGDVRSDDPADVRPPADFMPEIARHTSQGGIVWIFAL |
Ga0209689_13952462 | 3300027748 | Soil | VAVYAGIGGDWFLLAGDVRSDDPADVRPPADFMRDIARHTSQGGMVWLFGLGP |
Ga0209073_101454341 | 3300027765 | Agricultural Soil | WFLLSGDVRSDDPADVRPPADFVPDLARHTSQGGIVWIFGL |
Ga0209073_102193251 | 3300027765 | Agricultural Soil | GDWFLLAGDVRSDDPADVRPPADFSPDIARHTSQGGIVWLFGL |
Ga0209074_100345175 | 3300027787 | Agricultural Soil | GGDWFLLSGDVRSDDPADVRPPADFAKDLARHTSQGGMVWVFGLP |
Ga0209074_105552552 | 3300027787 | Agricultural Soil | DWFLLAGDVRSDDPADVRPPADFSPDLARHTSQGGIVWLFGL |
Ga0209580_102550031 | 3300027842 | Surface Soil | GDWALLAGDTRSDDPRDIRLPADYMKDIARHTSQGGIIWIFGL |
Ga0209579_104306511 | 3300027869 | Surface Soil | ALLVGDTRSDDPRDIRLPADYMKDIARHTSQGGIIWIFGL |
Ga0209579_106797251 | 3300027869 | Surface Soil | ALIAGETRSDDPADVRDPADYLKALWRHTSQGGIVWIFGL |
Ga0209579_107131272 | 3300027869 | Surface Soil | GGDWLLLAGDVRADDPTDVRAPADYVKDIGRHTSQGGMIWIFGL |
Ga0209283_101109341 | 3300027875 | Vadose Zone Soil | QYVAVYAGIGGDWFLLAGDVRSDDPADVRAPADFIKDIARHTSQGGIVWLFALTP |
Ga0209283_102767921 | 3300027875 | Vadose Zone Soil | YAGIGGDWFLLAGDVRSDDPADVRPPADFMSDIARHTSQGGIVWIFAL |
Ga0209253_101779771 | 3300027900 | Freshwater Lake Sediment | WALLAGDLRADDPKDVRDPADYVRALGRYTSQGGMVWVFGL |
Ga0209382_104882063 | 3300027909 | Populus Rhizosphere | SGDVRSDDPADLRPPADFAPDLARYTSQGGMVWVFGL |
Ga0256864_10662811 | 3300027964 | Soil | DPDLFAGDVVSGDQTDVRPPSDFMKDIGRHTSQGGMVWLFGL |
Ga0209526_103484581 | 3300028047 | Forest Soil | RQYVAVYAGFGGDWALLSGDVRSDDPADVRAPADFLKDIARHTSQGGMIWIFGL |
Ga0268266_101579316 | 3300028379 | Switchgrass Rhizosphere | SGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLH |
Ga0268265_104426511 | 3300028380 | Switchgrass Rhizosphere | AVYAGIGGDWFLLAGDTRSDDPADVRPPSDPYKDIGRYTSQGGIVWIFGL |
Ga0268265_110477632 | 3300028380 | Switchgrass Rhizosphere | VSGDVRADDPTDVRPPADFMKDIGRHTSQGGIVWIFAL |
Ga0268265_114070881 | 3300028380 | Switchgrass Rhizosphere | DWGLLSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLH |
Ga0268264_115415031 | 3300028381 | Switchgrass Rhizosphere | QYVAVYAGIGGDWFLLSGDVRSDDPADVRPPADFAPELGRHTSQGGIVWIFGL |
Ga0137415_100512281 | 3300028536 | Vadose Zone Soil | GDWALLSGDTRSDDPADVRPPADFLKDIARHTSQGGMIWIFGL |
Ga0137415_108075751 | 3300028536 | Vadose Zone Soil | DWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL |
Ga0137415_112000901 | 3300028536 | Vadose Zone Soil | SGDVRSDDPADVRPPADFMPDIARYTSQGGIVWLFAL |
Ga0247818_113796841 | 3300028589 | Soil | GDWGLLSGDVRSDDPDDVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0265306_101072653 | 3300028598 | Sediment | FLIAGDVRSDDPADIRPPSDFAPDLARYTSRGGMLWIFAL |
Ga0302166_101571172 | 3300028652 | Fen | GGDWQLLSGDTRSDDPADVRPPLDFLRNIAKHTSQGGIVWIFGL |
Ga0307311_100207521 | 3300028716 | Soil | QYVAVYAGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL |
Ga0307320_102752312 | 3300028771 | Soil | GIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGIVWIFGL |
Ga0307282_101470711 | 3300028784 | Soil | AGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL |
Ga0307503_104767482 | 3300028802 | Soil | KQYVAVYAGFGGDWFLLSGDVRSDDPADVRPPADFMKDIGRHTSQGGMVWIFAL |
Ga0307281_100977571 | 3300028803 | Soil | YAGIGGDWFLLAGDVRADDPADVRPPSDPYKDIGRHTSQGGIVWIFGL |
Ga0307292_105161431 | 3300028811 | Soil | VYAGIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL |
Ga0307310_104521001 | 3300028824 | Soil | FLIAGDVRSDDPADVRAPADVVKTLGRYTSQGGIVWIFGL |
Ga0307312_100479531 | 3300028828 | Soil | DWFLLAGDVRSDDPADVRPPSDPYKDIGRHTSQGGIVWIFGL |
Ga0308309_112436111 | 3300028906 | Soil | AVYAGVGGDWSLLAGDMRSDDPRDIRLPADFMKDIARHTSQGGIIWIFGL |
Ga0302046_113094001 | 3300030620 | Soil | LSGDVRSDDPADVRPPADFMKDIGRHTSQGGMVWIFAL |
Ga0302314_113069491 | 3300030906 | Palsa | YVAVYAGIGGDWLLLAGDFRSDDPSDVRAPADFVKDLARHTSQGGMIWIFGL |
Ga0308187_102984631 | 3300031114 | Soil | DWFLISGDVMSSDPADVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0308194_101766501 | 3300031421 | Soil | GFGGDWFLISGDVISSDPADVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0170820_105548442 | 3300031446 | Forest Soil | LLSGDVRSDDPADVRPPADFMKNIARHTSQGGMIWIFGL |
Ga0318541_105863312 | 3300031545 | Soil | QYVAVYAGIGGDWALLAGDTRSDDPADVRPPADYMKDIARRTSQGGIVWIFGL |
Ga0318538_103683811 | 3300031546 | Soil | QYVAVYAGIGGDWTLLVGDIRSDEPTDVRAPTDYMKDIGRYTSQGGMVWIFGL |
Ga0318528_107851842 | 3300031561 | Soil | SAGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0318515_106393782 | 3300031572 | Soil | YAGIGGDWALLAGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0310915_105775143 | 3300031573 | Soil | DWALIAGDTRSDDPADIRAPADPVKDIARYTSQGGIVWIFGL |
Ga0310915_110225821 | 3300031573 | Soil | VYAGFGGDWALLTGDTRSDDPADVRAPADYMKDIARYTSQGGIVWIFGL |
Ga0307508_105645153 | 3300031616 | Ectomycorrhiza | ALLSGDVRSDDPADVRPPADFMKNIARHTSQGGMIWIFGL |
Ga0306917_108454011 | 3300031719 | Soil | ALLAGDTRSDDPADVRPPADYMKDIARRTSQGGIVWIFGL |
Ga0307469_115485002 | 3300031720 | Hardwood Forest Soil | YAGIGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGMVWIFGL |
Ga0307469_119461361 | 3300031720 | Hardwood Forest Soil | AGIGGDPDLFSGDVVSGDQTDVRPPADFMKDLGRHTSQGGMVWLFGL |
Ga0307468_1023774042 | 3300031740 | Hardwood Forest Soil | YAGIGGDPDLFSGEVVSGDQTDVRSPADFMKDIGRHTSQGGMVWLFGL |
Ga0306918_102059751 | 3300031744 | Soil | WALLAGDTRSDDPADVRAPADYVKDIARYTSQGGIIWIFAL |
Ga0306918_109397931 | 3300031744 | Soil | VAVYAGIGGDWTLLVGDIRSDEPTDVRAPTDYMKDIGRYTSQGGMVWIFGL |
Ga0318492_101538331 | 3300031748 | Soil | YVAVYAGIGGDWALLAGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0307475_114357512 | 3300031754 | Hardwood Forest Soil | ELLAGDTDSDDPADVRPPMDMMKQIARHTSRGGLVWMFGL |
Ga0318535_100756314 | 3300031764 | Soil | LAGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0318529_104598901 | 3300031792 | Soil | VYAGIGGDWALLAGDTRSDDPADVRAPADYVKDIARYTSQGGIIWIFAL |
Ga0318557_102371063 | 3300031795 | Soil | GIGGDWALLAGDTRSDDPNDVRAPADYVKDIARYTSQGGIIWIFAL |
Ga0318550_105244071 | 3300031797 | Soil | QYVAVYAGIGGDWALIAGDTRSDDPADVRAPAEPVKEIARYTSQGGMIWIFGL |
Ga0318565_105517341 | 3300031799 | Soil | DWTLLVGDIRSDEPTDVRAPTDYMKDIGRYTSQGGMVWIFGL |
Ga0318565_106410621 | 3300031799 | Soil | GIGGDWALLAGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0318497_103507611 | 3300031805 | Soil | YVAVYAGIGGDWALIAGDTRSDDPADVRAPAEPVKEIARYTSQGGMIWIFGL |
Ga0310907_106945221 | 3300031847 | Soil | WFLIAGDVRSDDPADVRPRADFAPDLAKYTSRGGILWIFGF |
Ga0307410_119866312 | 3300031852 | Rhizosphere | LYAGFGGDWGLLSGDVRSDDPDDVRPPASFMTDIARHTSQGGIVWVFGL |
Ga0306919_105723971 | 3300031879 | Soil | WALLAGDTRSDDPADVRAPADYVKDIARYTSQGGIVWVFGL |
Ga0307406_107219843 | 3300031901 | Rhizosphere | GFGGDWLLLSGDVRSDDPTDVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0306923_106182361 | 3300031910 | Soil | AGDTRSDDPTDVRAPADYAKDIARYTSQGGILWIFGL |
Ga0307412_105914343 | 3300031911 | Rhizosphere | ALLSGDLRSDDPTDVRDPADFIRDLGRYTSGGGMVWVFAL |
Ga0307412_117273302 | 3300031911 | Rhizosphere | QYVAVYAGIGGDWLLLSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0306921_100925001 | 3300031912 | Soil | GDIRSDEPTDVRAPTDYMKDIGRYTSQGGMVWIFGL |
Ga0308175_1026205251 | 3300031938 | Soil | IYAGIGGDWLLLSGDYKSDDPADVREPADFARDLAKHTSQGGIVWIFAL |
Ga0310909_104778383 | 3300031947 | Soil | LLAGDTRSDDPADVRAPADYVKDIARHTSQGGIIWIFGL |
Ga0310909_110432312 | 3300031947 | Soil | LLAGDTRSDDPADVRPPADYMKDIARRTSQGGIVWIFGL |
Ga0306926_109450291 | 3300031954 | Soil | VAVYAGIGGDWALIAGDTRSDDPADVRAPAEPVKEIARYTSQGGMIWIFGL |
Ga0307479_110608722 | 3300031962 | Hardwood Forest Soil | LLTGDVRSDDPADVRLPADFMKDIARHTSYGGLVWIFGL |
Ga0307479_111463621 | 3300031962 | Hardwood Forest Soil | AVYAGFGGDWALLSGDIRSDDPADVRAPADFMKDIARHTSQGGIIWIFGL |
Ga0307414_114335962 | 3300032004 | Rhizosphere | SGDVRSDDPADVRPPASFMPDIARHTSQGGIVWIFGL |
Ga0315272_103621611 | 3300032018 | Sediment | YVAIYAGIGGDWFLLSGDVRSDDPTDIREPADFAKDLARHTSQGGLVWVFALPGGR |
Ga0318514_105156221 | 3300032066 | Soil | GDTRSDDPTDVRPPADYVKDIARYTSQGGIIWIFAL |
Ga0306924_105028163 | 3300032076 | Soil | GGDWALLAGDTRSDDPNDVRAPADYVKDIARYTSQGGIIWIFAL |
Ga0315283_105520041 | 3300032164 | Sediment | QYVAVYAGFGGDWFLISGDVRSDDPADVRAPATFMPDIARHTSQGGIVWVFGLD |
Ga0307471_1028078372 | 3300032180 | Hardwood Forest Soil | IGGDWFLLSGDVRSDDPADVRPPADFAPDLARHTSQGGVVWIFGL |
Ga0315271_119578771 | 3300032256 | Sediment | FLISGDVRSDDPADVRAPATFMPDIARHTSQGGIVWVFGLD |
Ga0306920_1023436781 | 3300032261 | Soil | QYIAVYAGIGGDWFLLAGDYRSDDPADVRDPSDFAPQLARHTSQGGLVWIFGVE |
Ga0306920_1028062041 | 3300032261 | Soil | YAGFGGDWALLSGDVRSDDPNDVRAPADFIKDIGRYTSQGGIIWIFSL |
Ga0315273_128123722 | 3300032516 | Sediment | SGIGGDWFLIAGDVRSDDPADVRAPPDFMPDLWRYTSQGGMLWIFAL |
Ga0335085_102914223 | 3300032770 | Soil | DVHAADPTDVRAPADYIKDLGARTSQGGIIWIFGL |
Ga0335080_112264543 | 3300032828 | Soil | AVYAGFGGDWSLLAGDTRSDDPADVRPAADFLKDIARHTSQGGIVWIFGL |
Ga0335072_113258941 | 3300032898 | Soil | FLLSGDVRSDDPADVRAPADYMKDIARRTSQGGIVWIFGL |
Ga0335073_107500163 | 3300033134 | Soil | LLSGDVRSDDPADVRAPADWMKDIARHTSQGGIVWIFGL |
Ga0310914_114277352 | 3300033289 | Soil | RQYVAVYAGIGGDWALIAGDTRSDDPADVRAPAEPVKEIARYTSQGGMIWIFGL |
Ga0310810_113317341 | 3300033412 | Soil | GIGGDWFLLAGDVRSDDPADVRPPSDPYKDIGRYTSQGGIVWIFGL |
Ga0247829_106659101 | 3300033550 | Soil | DWFLLSGDVRSDDPADVRPPASFMPDIARHTSQGGIVWVFGLQ |
Ga0314867_063298_2_145 | 3300033808 | Peatland | AGIGGDWALIAGDTRSDDPRDVREPADFMKDIARHTSQGGIVWIFGL |
Ga0370479_0074546_704_859 | 3300034123 | Untreated Peat Soil | VAVYAGYGGDWSLLSGDTKSDDPADVRPPLDFLRNIAKHTSQGGIVWIFGI |
⦗Top⦘ |