Metagenome Family F003929

Overview

Basic Information

• Family ID: F003929
• Family Type: Metagenome
• Number of Sequences: 461
• Average Sequence Length: 39 residues
• Representative Sequence: MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKFD
• Number of Associated Samples: 117
• Number of Associated Scaffolds: 461

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 4.22 %
• % of genes near scaffold ends (potentially truncated): 62.47 %
• % of genes from short scaffolds (< 2000 bps): 74.40 %
• Associated GOLD sequencing projects: 100
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (78.308 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (24.729 % of family members)
• Environment Ontology (ENVO): Unclassified (51.410 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (41.215 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 52.31%
  β-sheet: 0.00%
  Coil/Unstructured: 47.69%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 461 Family Scaffolds
PF00005	ABC_tran	1.74
PF06808	DctM	1.52
PF07992	Pyr_redox_2	1.52
PF13561	adh_short_C2	1.30
PF13458	Peripla_BP_6	1.30
PF00528	BPD_transp_1	1.30
PF03480	DctP	1.08
PF04055	Radical_SAM	1.08
PF02653	BPD_transp_2	1.08
PF07331	TctB	0.87
PF00441	Acyl-CoA_dh_1	0.87
PF00072	Response_reg	0.87
PF03060	NMO	0.87
PF02321	OEP	0.65
PF01040	UbiA	0.65
PF01558	POR	0.65
PF09312	SurA_N	0.65
PF02915	Rubrerythrin	0.65
PF00465	Fe-ADH	0.65
PF02769	AIRS_C	0.65
PF02737	3HCDH_N	0.65
PF02954	HTH_8	0.65
PF03069	FmdA_AmdA	0.65
PF01808	AICARFT_IMPCHas	0.65
PF00106	adh_short	0.65
PF01520	Amidase_3	0.65
PF00501	AMP-binding	0.43
PF00873	ACR_tran	0.43
PF04993	TfoX_N	0.43
PF04773	FecR	0.43
PF01850	PIN	0.43
PF03972	MmgE_PrpD	0.43
PF00009	GTP_EFTU	0.43
PF01592	NifU_N	0.43
PF13193	AMP-binding_C	0.43
PF13378	MR_MLE_C	0.43
PF01545	Cation_efflux	0.43
PF03450	CO_deh_flav_C	0.43
PF04963	Sigma54_CBD	0.43
PF00912	Transgly	0.43
PF01145	Band_7	0.43
PF00011	HSP20	0.43
PF01048	PNP_UDP_1	0.43
PF00378	ECH_1	0.43
PF14833	NAD_binding_11	0.43
PF00903	Glyoxalase	0.43
PF00440	TetR_N	0.43
PF16576	HlyD_D23	0.43
PF16868	NMT1_3	0.43
PF08984	DUF1858	0.43
PF13607	Succ_CoA_lig	0.43
PF01208	URO-D	0.43
PF00950	ABC-3	0.43
PF05853	BKACE	0.43
PF01434	Peptidase_M41	0.43
PF00152	tRNA-synt_2	0.43
PF01609	DDE_Tnp_1	0.43
PF00266	Aminotran_5	0.43
PF02673	BacA	0.43
PF13744	HTH_37	0.43
PF00202	Aminotran_3	0.43
PF00920	ILVD_EDD	0.43
PF03401	TctC	0.22
PF01925	TauE	0.22
PF00164	Ribosom_S12_S23	0.22
PF00582	Usp	0.22
PF00994	MoCF_biosynth	0.22
PF09992	NAGPA	0.22
PF01979	Amidohydro_1	0.22
PF11219	DUF3014	0.22
PF02374	ArsA_ATPase	0.22
PF01661	Macro	0.22
PF02775	TPP_enzyme_C	0.22
PF01951	Archease	0.22
PF00107	ADH_zinc_N	0.22
PF00395	SLH	0.22
PF00578	AhpC-TSA	0.22
PF00586	AIRS	0.22
PF02080	TrkA_C	0.22
PF02540	NAD_synthase	0.22
PF02771	Acyl-CoA_dh_N	0.22
PF11897	DUF3417	0.22
PF13288	DXPR_C	0.22
PF14559	TPR_19	0.22
PF00177	Ribosomal_S7	0.22
PF01795	Methyltransf_5	0.22
PF02195	ParBc	0.22
PF02682	CT_C_D	0.22
PF02803	Thiolase_C	0.22
PF00675	Peptidase_M16	0.22
PF00580	UvrD-helicase	0.22
PF01970	TctA	0.22
PF12419	DUF3670	0.22
PF02310	B12-binding	0.22
PF08901	DUF1847	0.22
PF13358	DDE_3	0.22
PF04715	Anth_synt_I_N	0.22
PF14358	DUF4405	0.22
PF02629	CoA_binding	0.22
PF09339	HTH_IclR	0.22
PF00291	PALP	0.22
PF00857	Isochorismatase	0.22
PF13231	PMT_2	0.22
PF07927	HicA_toxin	0.22
PF01370	Epimerase	0.22
PF01425	Amidase	0.22
PF13453	zf-TFIIB	0.22
PF03358	FMN_red	0.22
PF00216	Bac_DNA_binding	0.22
PF13411	MerR_1	0.22
PF02361	CbiQ	0.22
PF03144	GTP_EFTU_D2	0.22
PF00561	Abhydrolase_1	0.22
PF14815	NUDIX_4	0.22
PF02502	LacAB_rpiB	0.22
PF00550	PP-binding	0.22
PF08843	AbiEii	0.22
PF00497	SBP_bac_3	0.22
PF01121	CoaE	0.22
PF04851	ResIII	0.22
PF13847	Methyltransf_31	0.22
PF08281	Sigma70_r4_2	0.22
PF12399	BCA_ABC_TP_C	0.22
PF13776	DUF4172	0.22
PF02579	Nitro_FeMo-Co	0.22
PF09917	DUF2147	0.22
PF13801	Metal_resist	0.22
PF01641	SelR	0.22
PF02347	GDC-P	0.22
PF13011	LZ_Tnp_IS481	0.22
PF02397	Bac_transf	0.22
PF05015	HigB-like_toxin	0.22
PF09976	TPR_21	0.22
PF11249	DUF3047	0.22
PF01702	TGT	0.22
PF06429	Flg_bbr_C	0.22
PF16916	ZT_dimer	0.22
PF01887	SAM_HAT_N	0.22
PF00725	3HCDH	0.22
PF02405	MlaE	0.22
PF00313	CSD	0.22
PF02190	LON_substr_bdg	0.22
PF13175	AAA_15	0.22
PF09861	Lar_N	0.22
PF13533	Biotin_lipoyl_2	0.22
PF01799	Fer2_2	0.22
PF13380	CoA_binding_2	0.22
PF16321	Ribosom_S30AE_C	0.22
PF02667	SCFA_trans	0.22
PF12838	Fer4_7	0.22
PF02075	RuvC	0.22
PF00881	Nitroreductase	0.22
PF01568	Molydop_binding	0.22
PF07963	N_methyl	0.22
PF09285	Elong-fact-P_C	0.22
PF02596	DUF169	0.22
PF02585	PIG-L	0.22
PF03205	MobB	0.22
PF01882	DUF58	0.22
PF13727	CoA_binding_3	0.22
PF00206	Lyase_1	0.22
PF11304	DUF3106	0.22
PF07729	FCD	0.22
PF04536	TPM_phosphatase	0.22
PF02391	MoaE	0.22
PF13432	TPR_16	0.22
PF09190	DALR_2	0.22
PF14076	DUF4258	0.22
PF03129	HGTP_anticodon	0.22
PF01041	DegT_DnrJ_EryC1	0.22
PF02754	CCG	0.22
PF13646	HEAT_2	0.22
PF01546	Peptidase_M20	0.22
PF01761	DHQ_synthase	0.22
PF13597	NRDD	0.22
PF00588	SpoU_methylase	0.22
PF00117	GATase	0.22
PF04972	BON	0.22
PF08442	ATP-grasp_2	0.22
PF06865	Ppnp	0.22
PF09335	SNARE_assoc	0.22
PF13401	AAA_22	0.22
PF03992	ABM	0.22
PF03748	FliL	0.22
PF13344	Hydrolase_6	0.22
PF11453	DUF2950	0.22
PF08299	Bac_DnaA_C	0.22
PF02683	DsbD	0.22
PF13692	Glyco_trans_1_4	0.22
PF02784	Orn_Arg_deC_N	0.22
PF13187	Fer4_9	0.22
PF01175	Urocanase	0.22
PF00988	CPSase_sm_chain	0.22
PF13181	TPR_8	0.22
PF00330	Aconitase	0.22
PF17147	PFOR_II	0.22
PF00166	Cpn10	0.22
PF01726	LexA_DNA_bind	0.22
PF13450	NAD_binding_8	0.22
PF13511	DUF4124	0.22
PF00753	Lactamase_B	0.22
PF00905	Transpeptidase	0.22
PF01139	RtcB	0.22
PF01977	UbiD	0.22
PF00483	NTP_transferase	0.22
PF03699	UPF0182	0.22
PF01137	RTC	0.22
PF02018	CBM_4_9	0.22
PF00977	His_biosynth	0.22
PF01464	SLT	0.22
PF05947	T6SS_TssF	0.22
PF06835	LptC	0.22
PF04020	Phage_holin_4_2	0.22
PF03061	4HBT	0.22
PF02581	TMP-TENI	0.22
PF00425	Chorismate_bind	0.22
PF00294	PfkB	0.22
PF01790	LGT	0.22
PF00496	SBP_bac_5	0.22
PF01321	Creatinase_N	0.22
PF05635	23S_rRNA_IVP	0.22
PF01106	NifU	0.22
PF15892	BNR_4	0.22
PF04358	DsrC	0.22
PF00092	VWA	0.22
PF01116	F_bP_aldolase	0.22
PF00521	DNA_topoisoIV	0.22
PF16124	RecQ_Zn_bind	0.22
PF13589	HATPase_c_3	0.22
PF09084	NMT1	0.22
PF13307	Helicase_C_2	0.22
PF13207	AAA_17	0.22
PF13177	DNA_pol3_delta2	0.22
PF03739	LptF_LptG	0.22
PF13189	Cytidylate_kin2	0.22
PF08340	DUF1732	0.22
PF02826	2-Hacid_dh_C	0.22
PF06050	HGD-D	0.22
PF05167	DUF711	0.22
PF01312	Bac_export_2	0.22
PF03328	HpcH_HpaI	0.22
PF13145	Rotamase_2	0.22
PF04015	DUF362	0.22
PF00701	DHDPS	0.22
PF04468	PSP1	0.22
PF08402	TOBE_2	0.22
PF01171	ATP_bind_3	0.22
PF01066	CDP-OH_P_transf	0.22
PF01613	Flavin_Reduct	0.22
PF04295	GD_AH_C	0.22
PF00069	Pkinase	0.22
PF10996	Beta-Casp	0.22
PF00361	Proton_antipo_M	0.22
PF05973	Gp49	0.22
PF01182	Glucosamine_iso	0.22
PF13365	Trypsin_2	0.22
PF12441	CopG_antitoxin	0.22
PF01039	Carboxyl_trans	0.22
PF11010	DUF2848	0.22

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 461 Family Scaffolds
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.30
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	1.08
COG0129	Dihydroxyacid dehydratase/phosphogluconate dehydratase	Carbohydrate transport and metabolism [G]	0.87
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	0.87
COG0516	IMP dehydrogenase/GMP reductase	Nucleotide transport and metabolism [F]	0.87
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.87
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	0.87
COG0138	AICAR transformylase/IMP cyclohydrolase PurH	Nucleotide transport and metabolism [F]	0.65
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.65
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	0.65
COG0337	3-dehydroquinate synthetase	Amino acid transport and metabolism [E]	0.65
COG0371	Glycerol dehydrogenase or related enzyme, iron-containing ADH family	Energy production and conversion [C]	0.65
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.65
COG0760	Peptidyl-prolyl isomerase, parvulin family	Posttranslational modification, protein turnover, chaperones [O]	0.65
COG0860	N-acetylmuramoyl-L-alanine amidase	Cell wall/membrane/envelope biogenesis [M]	0.65
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.65
COG1014	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit	Energy production and conversion [C]	0.65
COG1454	Alcohol dehydrogenase, class IV	Energy production and conversion [C]	0.65
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	0.65
COG1979	Alcohol dehydrogenase YqhD, Fe-dependent ADH family	Energy production and conversion [C]	0.65
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.65
COG2421	Acetamidase/formamidase	Energy production and conversion [C]	0.65
COG0017	Aspartyl/asparaginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.43
COG0053	Divalent metal cation (Fe/Co/Zn/Cd) efflux pump	Inorganic ion transport and metabolism [P]	0.43
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.43
COG0147	Anthranilate/para-aminobenzoate synthases component I	Amino acid transport and metabolism [E]	0.43
COG0173	Aspartyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.43
COG0329	4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase	Cell wall/membrane/envelope biogenesis [M]	0.43
COG0407	Uroporphyrinogen-III decarboxylase HemE	Coenzyme transport and metabolism [H]	0.43
COG0458	Carbamoylphosphate synthase large subunit	Amino acid transport and metabolism [E]	0.43
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	0.43
COG0505	Carbamoylphosphate synthase small subunit	Amino acid transport and metabolism [E]	0.43
COG0609	ABC-type Fe3+-siderophore transport system, permease component	Inorganic ion transport and metabolism [P]	0.43
COG0744	Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase	Cell wall/membrane/envelope biogenesis [M]	0.43
COG0775	Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB	Nucleotide transport and metabolism [F]	0.43
COG0813	Purine-nucleoside phosphorylase	Nucleotide transport and metabolism [F]	0.43
COG0822	Fe-S cluster assembly scaffold protein IscU, NifU family	Posttranslational modification, protein turnover, chaperones [O]	0.43
COG1108	ABC-type Mn2+/Zn2+ transport system, permease component	Inorganic ion transport and metabolism [P]	0.43
COG1190	Lysyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.43
COG1230	Co/Zn/Cd efflux system component	Inorganic ion transport and metabolism [P]	0.43
COG1508	DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog	Transcription [K]	0.43
COG1968	Undecaprenyl pyrophosphate phosphatase	Lipid transport and metabolism [I]	0.43
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.43
COG2269	Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)	Translation, ribosomal structure and biogenesis [J]	0.43
COG2820	Uridine phosphorylase	Nucleotide transport and metabolism [F]	0.43
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.43
COG3070	Transcriptional regulator of competence genes, TfoX/Sxy family	Transcription [K]	0.43
COG3246	Uncharacterized conserved protein, DUF849 family	Function unknown [S]	0.43
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.43
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.43
COG3965	Predicted Co/Zn/Cd cation transporter, cation efflux family	Inorganic ion transport and metabolism [P]	0.43
COG4606	ABC-type enterochelin transport system, permease component	Inorganic ion transport and metabolism [P]	0.43
COG4953	Membrane carboxypeptidase/penicillin-binding protein PbpC	Cell wall/membrane/envelope biogenesis [M]	0.43
COG5009	Membrane carboxypeptidase/penicillin-binding protein	Cell wall/membrane/envelope biogenesis [M]	0.43
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.43
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.43
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.43
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	0.22
COG0019	Diaminopimelate decarboxylase	Amino acid transport and metabolism [E]	0.22
COG0026	Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)	Nucleotide transport and metabolism [F]	0.22
COG0037	tRNA(Ile)-lysidine synthase TilS/MesJ	Translation, ribosomal structure and biogenesis [J]	0.22
COG0043	3-polyprenyl-4-hydroxybenzoate decarboxylase	Coenzyme transport and metabolism [H]	0.22
COG0045	Succinyl-CoA synthetase, beta subunit	Energy production and conversion [C]	0.22
COG0049	Ribosomal protein S7	Translation, ribosomal structure and biogenesis [J]	0.22
COG0124	Histidyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0151	Phosphoribosylamine-glycine ligase	Nucleotide transport and metabolism [F]	0.22
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.22
COG0183	Acetyl-CoA acetyltransferase	Lipid transport and metabolism [I]	0.22
COG0188	DNA gyrase/topoisomerase IV, subunit A	Replication, recombination and repair [L]	0.22
COG0191	Fructose/tagatose bisphosphate aldolase	Carbohydrate transport and metabolism [G]	0.22
COG0210	Superfamily I DNA or RNA helicase	Replication, recombination and repair [L]	0.22
COG0215	Cysteinyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.22
COG0229	Peptide methionine sulfoxide reductase MsrB	Posttranslational modification, protein turnover, chaperones [O]	0.22
COG0234	Co-chaperonin GroES (HSP10)	Posttranslational modification, protein turnover, chaperones [O]	0.22
COG0237	Dephospho-CoA kinase	Coenzyme transport and metabolism [H]	0.22
COG0247	Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF	Energy production and conversion [C]	0.22
COG0275	16S rRNA C1402 N4-methylase RsmH	Translation, ribosomal structure and biogenesis [J]	0.22
COG0301	Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.22
COG0314	Molybdopterin synthase catalytic subunit MoaE	Coenzyme transport and metabolism [H]	0.22
COG0343	Queuine/archaeosine tRNA-ribosyltransferase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0352	Thiamine monophosphate synthase	Coenzyme transport and metabolism [H]	0.22
COG0363	6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase	Carbohydrate transport and metabolism [G]	0.22
COG0398	Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family	Function unknown [S]	0.22
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.22
COG0403	Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain	Amino acid transport and metabolism [E]	0.22
COG0423	Glycyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.22
COG0430	RNA 3'-terminal phosphate cyclase	RNA processing and modification [A]	0.22
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.22
COG0441	Threonyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0469	Pyruvate kinase	Carbohydrate transport and metabolism [G]	0.22
COG0482	tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain	Translation, ribosomal structure and biogenesis [J]	0.22
COG0519	GMP synthase, PP-ATPase domain/subunit	Nucleotide transport and metabolism [F]	0.22
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.22
COG0558	Phosphatidylglycerophosphate synthase	Lipid transport and metabolism [I]	0.22
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.22
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.22
COG0586	Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family	Cell wall/membrane/envelope biogenesis [M]	0.22
COG0593	Chromosomal replication initiation ATPase DnaA	Replication, recombination and repair [L]	0.22
COG0603	7-cyano-7-deazaguanine synthase (queuosine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.22
COG0619	ECF-type transporter transmembrane protein EcfT	Coenzyme transport and metabolism [H]	0.22
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.22
COG0682	Prolipoprotein diacylglyceryltransferase	Cell wall/membrane/envelope biogenesis [M]	0.22
COG0694	Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain	Posttranslational modification, protein turnover, chaperones [O]	0.22
COG0698	Ribose 5-phosphate isomerase RpiB	Carbohydrate transport and metabolism [G]	0.22
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.22
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.22
COG0767	Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla	Cell wall/membrane/envelope biogenesis [M]	0.22
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.22
COG0777	Acetyl-CoA carboxylase beta subunit	Lipid transport and metabolism [I]	0.22
COG0795	Lipopolysaccharide export LptBFGC system, permease protein LptF	Cell wall/membrane/envelope biogenesis [M]	0.22
COG0817	Holliday junction resolvasome RuvABC endonuclease subunit RuvC	Replication, recombination and repair [L]	0.22
COG0825	Acetyl-CoA carboxylase alpha subunit	Lipid transport and metabolism [I]	0.22
COG1003	Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain	Amino acid transport and metabolism [E]	0.22
COG1042	Acyl-CoA synthetase (NDP forming)	Energy production and conversion [C]	0.22
COG1074	3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)	Replication, recombination and repair [L]	0.22
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.22
COG1166	Arginine decarboxylase (spermidine biosynthesis)	Amino acid transport and metabolism [E]	0.22
COG1183	Phosphatidylserine synthase	Lipid transport and metabolism [I]	0.22
COG1238	Uncharacterized membrane protein YqaA, VTT domain	Function unknown [S]	0.22
COG1256	Flagellar hook-associated protein FlgK	Cell motility [N]	0.22
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.22
COG1371	Archease, activates RNA ligation by RtcB (tRNA splicing)	Translation, ribosomal structure and biogenesis [J]	0.22
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.22
COG1549	Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains	Translation, ribosomal structure and biogenesis [J]	0.22
COG1558	Flagellar basal body rod protein FlgC	Cell motility [N]	0.22
COG1561	Endoribonuclease YloC, YicC family	Translation, ribosomal structure and biogenesis [J]	0.22
COG1580	Flagellar basal body-associated protein FliL	Cell motility [N]	0.22
COG1606	ATP-utilizing enzyme, PP-loop superfamily	General function prediction only [R]	0.22
COG1615	Uncharacterized membrane protein, UPF0182 family	Function unknown [S]	0.22
COG1690	RNA-splicing ligase RtcB, repairs tRNA damage	Translation, ribosomal structure and biogenesis [J]	0.22
COG1721	Uncharacterized conserved protein, DUF58 family, contains vWF domain	Function unknown [S]	0.22
COG1724	Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family	General function prediction only [R]	0.22
COG1749	Flagellar hook protein FlgE	Cell motility [N]	0.22
COG1763	Molybdopterin-guanine dinucleotide biosynthesis protein	Coenzyme transport and metabolism [H]	0.22
COG1774	Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development)	Signal transduction mechanisms [T]	0.22
COG1775	Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB	Amino acid transport and metabolism [E]	0.22
COG1784	TctA family transporter	General function prediction only [R]	0.22
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.22
COG1853	FMN reductase RutF, DIM6/NTAB family	Energy production and conversion [C]	0.22
COG1912	Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)	Defense mechanisms [V]	0.22
COG1950	Uncharacterized membrane protein YvlD, DUF360 family	Function unknown [S]	0.22
COG2006	Uncharacterized conserved protein, DUF362 family	Function unknown [S]	0.22
COG2031	Short chain fatty acids transporter	Lipid transport and metabolism [I]	0.22
COG2043	Uncharacterized conserved protein, DUF169 family	Function unknown [S]	0.22
COG2048	Heterodisulfide reductase, subunit B	Energy production and conversion [C]	0.22
COG2049	5-oxoprolinase subunit B/Allophanate hydrolase subunit 1	Amino acid transport and metabolism [E]	0.22
COG2110	O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain	Translation, ribosomal structure and biogenesis [J]	0.22
COG2120	N-acetylglucosaminyl deacetylase, LmbE family	Carbohydrate transport and metabolism [G]	0.22
COG2148	Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)	Cell wall/membrane/envelope biogenesis [M]	0.22
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.22
COG2253	Predicted nucleotidyltransferase component of viral defense system	Defense mechanisms [V]	0.22
COG2301	Citrate lyase beta subunit	Carbohydrate transport and metabolism [G]	0.22
COG2721	Altronate dehydratase	Carbohydrate transport and metabolism [G]	0.22
COG2848	Uncharacterized conserved protein, UPF0210 family	Cell cycle control, cell division, chromosome partitioning [D]	0.22
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.22
COG2920	Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)	Translation, ribosomal structure and biogenesis [J]	0.22
COG2978	p-Aminobenzoyl-glutamate transporter AbgT	Coenzyme transport and metabolism [H]	0.22
COG2987	Urocanate hydratase	Amino acid transport and metabolism [E]	0.22
COG3123	Pyrimidine/purine nucleoside phosphorylase YaiE/PpnP, UPF0345/DUF1255 family	Nucleotide transport and metabolism [F]	0.22
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.22
COG3333	TctA family transporter	General function prediction only [R]	0.22
COG3519	Type VI protein secretion system component VasA	Intracellular trafficking, secretion, and vesicular transport [U]	0.22
COG3549	Plasmid maintenance system killer protein	Defense mechanisms [V]	0.22
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	0.22
COG3836	2-keto-3-deoxy-L-rhamnonate aldolase RhmA	Carbohydrate transport and metabolism [G]	0.22
COG3973	DNA helicase IV	Replication, recombination and repair [L]	0.22
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.22
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	0.22
COG4786	Flagellar basal body rod protein FlgG	Cell motility [N]	0.22
COG4787	Flagellar basal body rod protein FlgF	Cell motility [N]	0.22
COG4799	Acetyl-CoA carboxylase, carboxyltransferase component	Lipid transport and metabolism [I]	0.22
COG4887	Uncharacterized metal-binding protein MJ0455, DUF1847 family	Function unknown [S]	0.22
COG5050	sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases	Lipid transport and metabolism [I]	0.22

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	78.96 %
Unclassified	root	N/A	21.04 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	78.96 %
Unclassified	root	N/A	21.04 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	78.31 %
Unclassified	root	N/A	21.04 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.65 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	44.69 %
Unclassified	root	N/A	21.04 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.95 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.43 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.22 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.22 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.22 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.65 %

Level 5

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	39.70 %
Unclassified	root	N/A	21.04 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.43 %
Armatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes	0.22 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.22 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.22 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.22 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	0.22 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.65 %

Level 6

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	39.70 %
Unclassified	root	N/A	21.04 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.22 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.22 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.22 %
Candidatus Sumerlaeota	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota	0.22 %
unclassified Planctomycetota	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Negativicutes	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes	0.22 %
unclassified Armatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.65 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	0.65 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	14.10 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	3.90 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
unclassified Bacteroidetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes	0.22 %
Deltaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis	0.22 %
Halanaerobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales	0.22 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	0.22 %
Selenomonadales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales	0.22 %
unclassified Candidatus Sumerlaeota	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	0.87 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.65 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.65 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	2.60 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	0.43 %
Syntrophobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	0.43 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Halanaerobiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Geobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deferrisoma	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma	0.22 %
unclassified Desulfobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales	0.22 %
unclassified Syntrophobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
Sporomusaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.65 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
unclassified Syntrophaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae	1.74 %
Syntrophus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus	0.43 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Halanaerobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Syntrophobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
unclassified Desulfobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae	0.22 %
Sporolituus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfatiglans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.65 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
unclassified Syntrophus (in: Bacteria)	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria)	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.65 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.65 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.65 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.65 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.65 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.65 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.65 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.65 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.65 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.65 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Coleoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera	0.65 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Polyphaga	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga	0.65 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Cucujiformia	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia	0.65 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Curculionoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea	0.65 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Curculionidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae	0.65 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Entiminae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae	0.65 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Celeuthetini	tribe	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini	0.65 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	21.04 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	12.15 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1.74 %
Deltaproteobacteria bacterium RBG_16_49_23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	0.43 %
Syntrophus sp. (in: d-proteobacteria)	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	0.22 %
Halanaerobium saccharolyticum	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	0.22 %
Syntrophus gentianae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	0.22 %
Desulfatiglans anilini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	0.22 %
Syntrophobacter fumaroxidans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	0.22 %
Sporolituus thermophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	0.22 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.22 %
Geobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	0.22 %
Desulfobacca	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	0.22 %
Deferrisoma camini	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	0.22 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	0.22 %
Syntrophobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	0.22 %
Microbacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	0.22 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.22 %
Deltaproteobacteria bacterium SM23_61	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	0.22 %
Bacteroidetes bacterium RBG_13_46_8	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	0.22 %
Deltaproteobacteria bacterium RBG_13_51_10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	0.22 %
candidate division BRC1 bacterium ADurb.BinA364	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	0.22 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.22 %
Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	0.22 %
Planctomycetota bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	0.22 %
candidate division NC10	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	0.22 %
Spirochaetota bacterium	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	0.22 %
Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	0.87 %
Syntrophus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	0.65 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000231|TB_LI09_4DRAFT_10030053	All Organisms → cellular organisms → Bacteria	2386
3300000231|TB_LI09_4DRAFT_10078769	All Organisms → cellular organisms → Bacteria → Proteobacteria	1269
3300000231|TB_LI09_4DRAFT_10081880	All Organisms → cellular organisms → Bacteria	1234
3300001213|JGIcombinedJ13530_107344742	Not Available	584
3300001752|JGI2173J19968_10099463	Not Available	848
3300002053|SMTZ23_10021601	All Organisms → cellular organisms → Bacteria	15470
3300002961|JGI11641J44799_10092293	Not Available	852
3300003432|JGI20214J51088_10320143	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1055
3300003861|Ga0031654_10116444	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	751
3300003861|Ga0031654_10122974	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	730
3300003993|Ga0055468_10161458	All Organisms → cellular organisms → Bacteria	673
3300004282|Ga0066599_100920582	Not Available	628
3300004481|Ga0069718_10117812	All Organisms → cellular organisms → Bacteria	7227
3300004481|Ga0069718_15992716	All Organisms → cellular organisms → Bacteria → Proteobacteria	4761
3300004481|Ga0069718_16175596	All Organisms → cellular organisms → Bacteria	1133
3300004481|Ga0069718_16375666	Not Available	1053
3300005144|Ga0068711_1028439	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	1446
3300005144|Ga0068711_1047348	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	993
3300005833|Ga0074472_10292964	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	729
3300005833|Ga0074472_10618164	Not Available	617
3300005833|Ga0074472_11224627	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	647
3300006224|Ga0079037_100000346	All Organisms → cellular organisms → Bacteria	20074
3300006224|Ga0079037_100001262	All Organisms → cellular organisms → Bacteria	12983
3300006224|Ga0079037_100003590	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	8942
3300006224|Ga0079037_100013256	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5499
3300006224|Ga0079037_100033712	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3821
3300006224|Ga0079037_100071893	All Organisms → cellular organisms → Bacteria	2802
3300006224|Ga0079037_100189598	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1836
3300006224|Ga0079037_100214835	Not Available	1736
3300006224|Ga0079037_100611350	All Organisms → cellular organisms → Bacteria	1058
3300006224|Ga0079037_100677473	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1006
3300006224|Ga0079037_100709946	Not Available	982
3300006224|Ga0079037_100960406	Not Available	844
3300006224|Ga0079037_101239070	All Organisms → cellular organisms → Bacteria	742
3300006224|Ga0079037_101824586	Not Available	608
3300006930|Ga0079303_10007863	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3097
3300006930|Ga0079303_10100406	All Organisms → cellular organisms → Bacteria	1091
3300006930|Ga0079303_10431640	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	562
3300009009|Ga0105105_10252617	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	935
3300009009|Ga0105105_10319625	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	844
3300009009|Ga0105105_10482781	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	705
3300009037|Ga0105093_10067317	All Organisms → cellular organisms → Bacteria	1662
3300009037|Ga0105093_10224292	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	975
3300009053|Ga0105095_10225980	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1026
3300009053|Ga0105095_10243083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus	987
3300009053|Ga0105095_10641288	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	592
3300009075|Ga0105090_10207256	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1213
3300009075|Ga0105090_10312105	All Organisms → cellular organisms → Bacteria	963
3300009075|Ga0105090_10321256	Not Available	947
3300009075|Ga0105090_10604398	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10	666
3300009075|Ga0105090_11000810	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	510
3300009078|Ga0105106_10008691	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	7326
3300009078|Ga0105106_10016330	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	5433
3300009078|Ga0105106_10023377	All Organisms → cellular organisms → Bacteria	4557
3300009078|Ga0105106_10024888	All Organisms → cellular organisms → Bacteria	4416
3300009078|Ga0105106_10027637	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4191
3300009078|Ga0105106_10036462	All Organisms → cellular organisms → Bacteria	3643
3300009078|Ga0105106_10060552	All Organisms → cellular organisms → Bacteria	2790
3300009078|Ga0105106_10102953	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2102
3300009078|Ga0105106_10109331	All Organisms → cellular organisms → Bacteria	2033
3300009078|Ga0105106_10209447	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae	1421
3300009078|Ga0105106_10235936	All Organisms → cellular organisms → Bacteria	1331
3300009078|Ga0105106_10321554	All Organisms → cellular organisms → Bacteria	1119
3300009078|Ga0105106_10336532	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1091
3300009078|Ga0105106_10773296	All Organisms → cellular organisms → Bacteria	684
3300009078|Ga0105106_10956070	Not Available	609
3300009078|Ga0105106_10995119	Not Available	596
3300009081|Ga0105098_10035744	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1971
3300009081|Ga0105098_10098166	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1261
3300009081|Ga0105098_10107127	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1213
3300009081|Ga0105098_10109333	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1202
3300009081|Ga0105098_10126892	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	1126
3300009081|Ga0105098_10302898	All Organisms → cellular organisms → Bacteria → Proteobacteria	768
3300009085|Ga0105103_10045678	All Organisms → cellular organisms → Bacteria	2204
3300009085|Ga0105103_10051590	All Organisms → cellular organisms → Bacteria	2079
3300009085|Ga0105103_10075724	All Organisms → cellular organisms → Bacteria	1725
3300009085|Ga0105103_10117979	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1389
3300009085|Ga0105103_10133355	All Organisms → cellular organisms → Bacteria	1306
3300009085|Ga0105103_10276561	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	911
3300009085|Ga0105103_10282763	All Organisms → cellular organisms → Bacteria	901
3300009085|Ga0105103_10677905	Not Available	591
3300009087|Ga0105107_10046063	All Organisms → cellular organisms → Bacteria	3085
3300009087|Ga0105107_10078524	Not Available	2327
3300009087|Ga0105107_10468527	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	878
3300009087|Ga0105107_10732547	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	688
3300009091|Ga0102851_10024597	All Organisms → cellular organisms → Bacteria	4497
3300009091|Ga0102851_10107354	All Organisms → cellular organisms → Bacteria	2437
3300009091|Ga0102851_10205081	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1852
3300009091|Ga0102851_10510488	All Organisms → cellular organisms → Bacteria	1238
3300009091|Ga0102851_11256164	All Organisms → cellular organisms → Bacteria	817
3300009091|Ga0102851_11434052	All Organisms → cellular organisms → Bacteria	768
3300009091|Ga0102851_11666732	All Organisms → cellular organisms → Bacteria	715
3300009091|Ga0102851_11873180	All Organisms → cellular organisms → Bacteria	677
3300009091|Ga0102851_13253516	All Organisms → cellular organisms → Bacteria	522
3300009091|Ga0102851_13274582	Not Available	520
3300009111|Ga0115026_10003348	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5988
3300009111|Ga0115026_10124744	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	1616
3300009111|Ga0115026_10247423	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1219
3300009111|Ga0115026_10480028	All Organisms → cellular organisms → Bacteria	920
3300009111|Ga0115026_11542434	All Organisms → cellular organisms → Bacteria	554
3300009111|Ga0115026_11838239	Not Available	514
3300009131|Ga0115027_10249062	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1165
3300009131|Ga0115027_10551466	All Organisms → cellular organisms → Bacteria	840
3300009131|Ga0115027_11193512	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	608
3300009131|Ga0115027_11377694	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	573
3300009146|Ga0105091_10194221	All Organisms → cellular organisms → Bacteria → Proteobacteria	965
3300009146|Ga0105091_10345793	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	733
3300009153|Ga0105094_10059000	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	2134
3300009153|Ga0105094_10081935	All Organisms → cellular organisms → Bacteria	1809
3300009153|Ga0105094_10105852	All Organisms → cellular organisms → Bacteria	1589
3300009153|Ga0105094_10120429	All Organisms → cellular organisms → Bacteria	1488
3300009153|Ga0105094_10121220	All Organisms → cellular organisms → Bacteria	1483
3300009153|Ga0105094_10157935	All Organisms → cellular organisms → Bacteria	1293
3300009153|Ga0105094_10308193	All Organisms → cellular organisms → Bacteria	912
3300009153|Ga0105094_10436712	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	759
3300009153|Ga0105094_10778943	Not Available	562
3300009165|Ga0105102_10112653	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	1289
3300009165|Ga0105102_10287283	Not Available	848
3300009165|Ga0105102_10908893	Not Available	508
3300009166|Ga0105100_10090207	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1796
3300009166|Ga0105100_10102955	Not Available	1678
3300009166|Ga0105100_10126791	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1508
3300009166|Ga0105100_10237717	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	1088
3300009166|Ga0105100_10394368	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	837
3300009166|Ga0105100_10753457	Not Available	602
3300009166|Ga0105100_10800090	All Organisms → cellular organisms → Bacteria	584
3300009167|Ga0113563_10055760	All Organisms → cellular organisms → Bacteria	3371
3300009167|Ga0113563_10233852	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1856
3300009167|Ga0113563_10360377	Not Available	1535
3300009167|Ga0113563_11153213	All Organisms → cellular organisms → Bacteria	900
3300009167|Ga0113563_11379492	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	827
3300009167|Ga0113563_11584305	Not Available	774
3300009167|Ga0113563_12257467	All Organisms → cellular organisms → Bacteria → Proteobacteria	654
3300009167|Ga0113563_13941871	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	503
3300009168|Ga0105104_10432088	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca	735
3300009169|Ga0105097_10007371	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5623
3300009169|Ga0105097_10007497	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5575
3300009169|Ga0105097_10023134	All Organisms → cellular organisms → Bacteria	3294
3300009169|Ga0105097_10032295	All Organisms → cellular organisms → Bacteria	2795
3300009169|Ga0105097_10034289	All Organisms → cellular organisms → Bacteria	2715
3300009171|Ga0105101_10017580	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	3440
3300009171|Ga0105101_10253433	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	850
3300009171|Ga0105101_10484444	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	607
3300009179|Ga0115028_10409908	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	955
3300009179|Ga0115028_10413208	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	952
3300009179|Ga0115028_10694456	Not Available	776
3300009430|Ga0114938_1328361	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	556
3300009771|Ga0116155_10340617	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	607
3300011340|Ga0151652_12680331	Not Available	963
3300011340|Ga0151652_13769954	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10	811
3300011340|Ga0151652_13787834	All Organisms → cellular organisms → Bacteria → Proteobacteria	858
3300012964|Ga0153916_12852838	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	545
3300014314|Ga0075316_1205556	Not Available	521
3300017966|Ga0187776_10580028	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	778
3300018029|Ga0187787_10406726	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	538
3300018055|Ga0184616_10306529	Not Available	601
3300018059|Ga0184615_10571625	Not Available	595
3300018059|Ga0184615_10612565	Not Available	566
3300018064|Ga0187773_10743462	Not Available	617
3300018068|Ga0184636_1098445	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1000
3300018068|Ga0184636_1200300	All Organisms → cellular organisms → Bacteria	707
3300018070|Ga0184631_10073790	Not Available	1291
3300020074|Ga0194113_10000045	All Organisms → cellular organisms → Bacteria	115301
3300020074|Ga0194113_10000096	All Organisms → cellular organisms → Bacteria	92254
3300020074|Ga0194113_10000324	All Organisms → cellular organisms → Bacteria → Proteobacteria	60891
3300020172|Ga0211729_11162592	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	616
3300022208|Ga0224495_10041382	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum	2123
(restricted) 3300024054|Ga0233425_10315050	Not Available	688
3300025174|Ga0209324_10030415	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3712
3300025174|Ga0209324_10600755	All Organisms → cellular organisms → Bacteria	648
3300025314|Ga0209323_10085822	All Organisms → cellular organisms → Bacteria	2138
3300025967|Ga0210136_1076872	All Organisms → cellular organisms → Bacteria → Proteobacteria	531
3300027051|Ga0209269_1067596	All Organisms → cellular organisms → Bacteria	562
3300027051|Ga0209269_1073508	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	526
3300027693|Ga0209704_1256600	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	511
3300027713|Ga0209286_1298893	Not Available	561
3300027713|Ga0209286_1336723	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	520
3300027715|Ga0208665_10194148	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	639
3300027721|Ga0209492_1004497	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4514
3300027721|Ga0209492_1012060	All Organisms → cellular organisms → Bacteria → Proteobacteria	2900
3300027721|Ga0209492_1028584	All Organisms → cellular organisms → Bacteria	1934
3300027721|Ga0209492_1032624	All Organisms → cellular organisms → Bacteria	1815
3300027721|Ga0209492_1046865	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1522
3300027721|Ga0209492_1052729	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1434
3300027721|Ga0209492_1062599	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1314
3300027721|Ga0209492_1065119	All Organisms → cellular organisms → Bacteria	1287
3300027721|Ga0209492_1133678	Not Available	869
3300027721|Ga0209492_1146401	All Organisms → cellular organisms → Bacteria	825
3300027721|Ga0209492_1197189	Not Available	692
3300027721|Ga0209492_1211871	All Organisms → cellular organisms → Bacteria	663
3300027721|Ga0209492_1231841	All Organisms → cellular organisms → Bacteria	628
3300027721|Ga0209492_1293878	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	542
3300027726|Ga0209285_10027401	All Organisms → cellular organisms → Bacteria	1639
3300027726|Ga0209285_10059850	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1135
3300027726|Ga0209285_10092733	Not Available	917
3300027726|Ga0209285_10114165	All Organisms → cellular organisms → Bacteria	828
3300027740|Ga0214474_1013812	All Organisms → cellular organisms → Bacteria	3222
3300027740|Ga0214474_1182355	All Organisms → cellular organisms → Bacteria	771
3300027811|Ga0256868_10002426	All Organisms → cellular organisms → Bacteria	9716
3300027818|Ga0209706_10040910	All Organisms → cellular organisms → Bacteria	2342
3300027818|Ga0209706_10044647	All Organisms → cellular organisms → Bacteria	2238
3300027818|Ga0209706_10056628	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1971
3300027818|Ga0209706_10079739	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8	1637
3300027818|Ga0209706_10085373	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1576
3300027818|Ga0209706_10160805	Not Available	1101
3300027818|Ga0209706_10167599	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1075
3300027818|Ga0209706_10264787	Not Available	821
3300027818|Ga0209706_10406016	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	633
3300027841|Ga0209262_10546891	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	563
3300027877|Ga0209293_10109257	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1264
3300027877|Ga0209293_10623634	All Organisms → cellular organisms → Bacteria	570
3300027877|Ga0209293_10757798	All Organisms → cellular organisms → Bacteria	514
3300027887|Ga0208980_10483427	All Organisms → cellular organisms → Bacteria	711
3300027888|Ga0209635_10021322	All Organisms → cellular organisms → Bacteria	5202
3300027890|Ga0209496_10156098	All Organisms → cellular organisms → Bacteria	1047
3300027890|Ga0209496_10238474	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	884
3300027890|Ga0209496_10503656	All Organisms → cellular organisms → Bacteria	644
3300027897|Ga0209254_10016095	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6845
3300027897|Ga0209254_10046333	All Organisms → cellular organisms → Bacteria → Proteobacteria	3815
3300027897|Ga0209254_10047599	All Organisms → cellular organisms → Bacteria	3757
3300027897|Ga0209254_10069105	All Organisms → cellular organisms → Bacteria	3027
3300027897|Ga0209254_10074569	All Organisms → cellular organisms → Bacteria	2893
3300027897|Ga0209254_10076166	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2859
3300027897|Ga0209254_10077613	All Organisms → cellular organisms → Bacteria	2828
3300027897|Ga0209254_10093582	All Organisms → cellular organisms → Bacteria → Proteobacteria	2533
3300027897|Ga0209254_10136710	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364	2021
3300027897|Ga0209254_10413450	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	997
3300027897|Ga0209254_10566946	Not Available	807
3300027897|Ga0209254_10756773	Not Available	663
3300027899|Ga0209668_10226193	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1175
3300027899|Ga0209668_10862432	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	610
3300027900|Ga0209253_10014816	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini	6646
3300027900|Ga0209253_10135135	All Organisms → cellular organisms → Bacteria → Proteobacteria	2005
3300027900|Ga0209253_10238058	Not Available	1438
3300027900|Ga0209253_10238776	Not Available	1435
3300027900|Ga0209253_10561139	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	843
3300027901|Ga0209427_10022990	All Organisms → cellular organisms → Bacteria	6460
3300027901|Ga0209427_10078076	All Organisms → cellular organisms → Bacteria	3026
3300027901|Ga0209427_10477482	Not Available	945
3300027902|Ga0209048_10004117	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	13961
3300027902|Ga0209048_10011446	All Organisms → cellular organisms → Bacteria → Proteobacteria	7945
3300027902|Ga0209048_10012606	All Organisms → cellular organisms → Bacteria	7534
3300027902|Ga0209048_10015722	All Organisms → cellular organisms → Bacteria → Proteobacteria	6661
3300027902|Ga0209048_10022944	All Organisms → cellular organisms → Bacteria	5387
3300027902|Ga0209048_10022963	All Organisms → cellular organisms → Bacteria	5384
3300027902|Ga0209048_10042590	All Organisms → cellular organisms → Bacteria	3759
3300027902|Ga0209048_10048245	All Organisms → cellular organisms → Bacteria	3492
3300027902|Ga0209048_10052838	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3302
3300027902|Ga0209048_10055272	All Organisms → cellular organisms → Bacteria	3216
3300027902|Ga0209048_10060762	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3037
3300027902|Ga0209048_10062271	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2992
3300027902|Ga0209048_10077804	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2607
3300027902|Ga0209048_10081249	All Organisms → cellular organisms → Bacteria	2539
3300027902|Ga0209048_10263145	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1223
3300027902|Ga0209048_10284601	All Organisms → cellular organisms → Bacteria	1164
3300027902|Ga0209048_10347630	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium	1028
3300027902|Ga0209048_10361860	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1003
3300027902|Ga0209048_10400737	Not Available	942
3300027902|Ga0209048_10450553	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	876
3300027902|Ga0209048_10538360	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	785
3300027902|Ga0209048_10648270	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)	700
3300027902|Ga0209048_10789754	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	620
3300027902|Ga0209048_10792601	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	619
3300027902|Ga0209048_10839413	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	597
3300027902|Ga0209048_10938196	Not Available	556
3300027956|Ga0209820_1078679	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	886
3300027979|Ga0209705_10042116	All Organisms → cellular organisms → Bacteria	2529
3300027979|Ga0209705_10064460	All Organisms → cellular organisms → Bacteria	2014
3300027979|Ga0209705_10124188	All Organisms → cellular organisms → Bacteria	1394
3300027979|Ga0209705_10207015	All Organisms → cellular organisms → Bacteria	1028
3300030613|Ga0299915_10538988	All Organisms → cellular organisms → Bacteria	760
3300031746|Ga0315293_10457994	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	993
3300031746|Ga0315293_10978319	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	605
3300031746|Ga0315293_11253636	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	512
3300031772|Ga0315288_10699815	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	956
3300031834|Ga0315290_10034403	All Organisms → cellular organisms → Bacteria	4036
3300031834|Ga0315290_10166002	All Organisms → cellular organisms → Bacteria	1906
3300031834|Ga0315290_10176828	Not Available	1847
3300031834|Ga0315290_10630959	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	928
3300031834|Ga0315290_10718828	Not Available	860
3300031873|Ga0315297_10097996	Not Available	2319
3300031873|Ga0315297_10173724	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1763
3300031873|Ga0315297_10184725	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1710
3300031873|Ga0315297_10282527	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11	1381
3300031873|Ga0315297_10617503	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	910
3300031873|Ga0315297_10659022	Not Available	877
3300031949|Ga0214473_10037359	All Organisms → cellular organisms → Bacteria	5703
3300031949|Ga0214473_10227628	All Organisms → cellular organisms → Bacteria	2150
3300031949|Ga0214473_10303828	All Organisms → cellular organisms → Bacteria → Proteobacteria	1822
3300031949|Ga0214473_10896222	All Organisms → cellular organisms → Bacteria → Proteobacteria	946
3300031949|Ga0214473_10962265	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	905
3300031952|Ga0315294_11040807	Not Available	679
3300031952|Ga0315294_11317610	All Organisms → cellular organisms → Bacteria → Proteobacteria	577
3300031997|Ga0315278_10049215	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4124
3300031997|Ga0315278_10183561	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	2148
3300031997|Ga0315278_10266088	All Organisms → cellular organisms → Bacteria	1770
3300031997|Ga0315278_10631097	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1094
3300031999|Ga0315274_10325179	All Organisms → cellular organisms → Bacteria	1822
3300031999|Ga0315274_10754406	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1041
3300031999|Ga0315274_10789782	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1009
3300032020|Ga0315296_10175557	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1300
3300032020|Ga0315296_10432985	All Organisms → cellular organisms → Bacteria	709
3300032046|Ga0315289_10529340	All Organisms → cellular organisms → Bacteria	1122
3300032053|Ga0315284_10261477	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2200
3300032053|Ga0315284_10379079	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1752
3300032053|Ga0315284_10481707	Not Available	1510
3300032053|Ga0315284_10652830	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1245
3300032053|Ga0315284_11273690	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	800
3300032053|Ga0315284_11585194	All Organisms → cellular organisms → Bacteria → Proteobacteria	689
3300032070|Ga0315279_10052987	All Organisms → cellular organisms → Bacteria → Proteobacteria	3825
3300032070|Ga0315279_10855953	Not Available	526
3300032143|Ga0315292_10073351	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter	2608
3300032143|Ga0315292_10124913	All Organisms → cellular organisms → Bacteria	2039
3300032143|Ga0315292_11454398	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23	556
3300032156|Ga0315295_10082631	All Organisms → cellular organisms → Bacteria	3096
3300032156|Ga0315295_10535507	Not Available	1190
3300032156|Ga0315295_10584585	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1132
3300032156|Ga0315295_10869555	Not Available	901
3300032156|Ga0315295_11221423	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	736
3300032164|Ga0315283_12033611	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	570
3300032177|Ga0315276_10168951	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2281
3300032177|Ga0315276_10392962	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1484
3300032177|Ga0315276_11273823	All Organisms → cellular organisms → Bacteria	772
3300032177|Ga0315276_12110796	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	572
3300032177|Ga0315276_12185888	All Organisms → cellular organisms → Bacteria	560
3300032342|Ga0315286_10065385	All Organisms → cellular organisms → Bacteria	3863
3300032342|Ga0315286_11482985	All Organisms → cellular organisms → Bacteria	650
3300032397|Ga0315287_10306456	All Organisms → cellular organisms → Bacteria	1872
3300032397|Ga0315287_11040051	All Organisms → cellular organisms → Bacteria	951
3300032397|Ga0315287_12261066	Not Available	591
3300032397|Ga0315287_12509344	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	553
3300032401|Ga0315275_10148735	All Organisms → cellular organisms → Bacteria	2597
3300032401|Ga0315275_10209995	Not Available	2171
3300032401|Ga0315275_10633050	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1193
3300032401|Ga0315275_10784433	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1057
3300032401|Ga0315275_11162423	All Organisms → cellular organisms → Bacteria	841
3300032401|Ga0315275_11576634	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	703
3300032401|Ga0315275_12020344	Not Available	607
3300032401|Ga0315275_12678473	Not Available	513
3300032516|Ga0315273_10226246	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2552
3300032516|Ga0315273_10313731	All Organisms → cellular organisms → Bacteria	2127
3300032516|Ga0315273_10325352	All Organisms → cellular organisms → Bacteria	2084
3300032516|Ga0315273_10334773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	2051
3300032516|Ga0315273_10381167	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus	1903
3300032516|Ga0315273_10571126	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1504
3300032516|Ga0315273_10649221	All Organisms → cellular organisms → Bacteria	1394
3300032516|Ga0315273_11358464	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	883
3300032516|Ga0315273_11367956	Not Available	879
3300032516|Ga0315273_12291263	Not Available	630
3300032516|Ga0315273_13045025	Not Available	523
3300033406|Ga0316604_10019623	All Organisms → cellular organisms → Bacteria	3545
3300033406|Ga0316604_10043616	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	2304
3300033406|Ga0316604_10676337	All Organisms → cellular organisms → Bacteria → Proteobacteria	567
3300033408|Ga0316605_10037073	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3324
3300033408|Ga0316605_10059347	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2757
3300033408|Ga0316605_10247818	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	1532
3300033408|Ga0316605_10375092	Not Available	1276
3300033408|Ga0316605_10514915	Not Available	1104
3300033408|Ga0316605_10575631	All Organisms → cellular organisms → Bacteria	1048
3300033408|Ga0316605_10643182	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	995
3300033408|Ga0316605_10959125	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	820
3300033408|Ga0316605_11351074	All Organisms → cellular organisms → Bacteria	690
3300033408|Ga0316605_12077487	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	553
3300033413|Ga0316603_10094725	All Organisms → cellular organisms → Bacteria	2340
3300033413|Ga0316603_10382722	All Organisms → cellular organisms → Bacteria	1267
3300033413|Ga0316603_10412005	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1224
3300033413|Ga0316603_10759167	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	909
3300033413|Ga0316603_11236323	Not Available	707
3300033413|Ga0316603_11736088	Not Available	591
3300033413|Ga0316603_11932136	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	558
3300033413|Ga0316603_12195587	Not Available	521
3300033414|Ga0316619_10138054	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1650
3300033414|Ga0316619_10467855	All Organisms → cellular organisms → Bacteria	1018
3300033414|Ga0316619_10569286	All Organisms → cellular organisms → Bacteria	936
3300033414|Ga0316619_11094352	Not Available	699
3300033414|Ga0316619_11106014	Not Available	695
3300033414|Ga0316619_11933719	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	536
3300033416|Ga0316622_100249431	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1925
3300033418|Ga0316625_100132596	Not Available	1495
3300033418|Ga0316625_101047509	All Organisms → cellular organisms → Bacteria	731
3300033418|Ga0316625_101067067	All Organisms → cellular organisms → Bacteria	726
3300033419|Ga0316601_100005257	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	7254
3300033419|Ga0316601_100440265	Not Available	1236
3300033419|Ga0316601_101140706	Not Available	781
3300033419|Ga0316601_101825493	Not Available	613
3300033419|Ga0316601_102601353	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	508
3300033433|Ga0326726_10093852	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans	2676
3300033433|Ga0326726_10352773	Not Available	1389
3300033433|Ga0326726_10426162	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	1261
3300033433|Ga0326726_11107254	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	770
3300033433|Ga0326726_11859590	All Organisms → cellular organisms → Bacteria	586
3300033434|Ga0316613_10301014	Not Available	1061
3300033480|Ga0316620_10210797	Not Available	1629
3300033480|Ga0316620_10500189	Not Available	1123
3300033480|Ga0316620_10648815	All Organisms → cellular organisms → Bacteria	998
3300033480|Ga0316620_11407919	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	687
3300033480|Ga0316620_11972074	All Organisms → cellular organisms → Bacteria	580
3300033480|Ga0316620_12328589	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	533
3300033481|Ga0316600_10068031	All Organisms → cellular organisms → Bacteria	2067
3300033481|Ga0316600_10146490	All Organisms → cellular organisms → Bacteria → Proteobacteria	1495
3300033481|Ga0316600_10226368	All Organisms → cellular organisms → Bacteria	1232
3300033481|Ga0316600_10528372	All Organisms → cellular organisms → Bacteria → Proteobacteria	821
3300033481|Ga0316600_10985242	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	597
3300033481|Ga0316600_11037664	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae	581
3300033481|Ga0316600_11201016	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	538
3300033482|Ga0316627_100393533	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1186
3300033482|Ga0316627_100419319	All Organisms → cellular organisms → Bacteria	1157
3300033482|Ga0316627_100489197	Not Available	1088
3300033482|Ga0316627_101065664	All Organisms → cellular organisms → Bacteria	789
3300033482|Ga0316627_101504501	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	681
3300033482|Ga0316627_101614932	All Organisms → cellular organisms → Bacteria	660
3300033482|Ga0316627_102259162	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	570
3300033482|Ga0316627_102906760	All Organisms → cellular organisms → Bacteria	509
3300033483|Ga0316629_10202269	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1262
3300033485|Ga0316626_10056543	All Organisms → cellular organisms → Bacteria	2701
3300033485|Ga0316626_10469464	Not Available	1065
3300033485|Ga0316626_10499252	All Organisms → cellular organisms → Bacteria	1035
3300033485|Ga0316626_10564115	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	977
3300033485|Ga0316626_10809934	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	822
3300033485|Ga0316626_10957750	Not Available	757
3300033485|Ga0316626_10987317	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	746
3300033485|Ga0316626_10996330	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	743
3300033486|Ga0316624_10307063	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini	1288
3300033486|Ga0316624_11290454	Not Available	666
3300033486|Ga0316624_11920878	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61	549
3300033487|Ga0316630_10016167	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3928
3300033487|Ga0316630_10574942	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	936
3300033487|Ga0316630_10583877	All Organisms → cellular organisms → Bacteria	930
3300033488|Ga0316621_10166931	Not Available	1337
3300033488|Ga0316621_10336825	All Organisms → cellular organisms → Bacteria	1006
3300033488|Ga0316621_11262758	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	560
3300033489|Ga0299912_10267858	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	1444
3300033489|Ga0299912_10388272	All Organisms → cellular organisms → Bacteria	1148
3300033489|Ga0299912_10456704	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1036
3300033513|Ga0316628_101325745	Not Available	959
3300033513|Ga0316628_101458211	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	912
3300033513|Ga0316628_103443486	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	572
3300033521|Ga0316616_100258807	All Organisms → cellular organisms → Bacteria	1801
3300033521|Ga0316616_100393168	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1532
3300033521|Ga0316616_100650972	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1250
3300033521|Ga0316616_101279020	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	938
3300033521|Ga0316616_102066671	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	756
3300033521|Ga0316616_102940298	All Organisms → cellular organisms → Bacteria	642
3300033521|Ga0316616_103322313	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	606
3300033521|Ga0316616_103755970	Not Available	572
3300033557|Ga0316617_100004217	All Organisms → cellular organisms → Bacteria → Proteobacteria	5608
3300033557|Ga0316617_100665555	Not Available	977
3300033557|Ga0316617_101436868	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28	694
3300033557|Ga0316617_102119325	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	579
3300033557|Ga0316617_102489243	Not Available	537

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.70%
Engineered	Engineered	1.30%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	71.37%
Terrestrial	Environmental → Terrestrial	27.33%
Lab Enrichment	Engineered → Lab Enrichment	1.08%
Wastewater	Engineered → Wastewater	0.22%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	66.81%
Soil	Environmental → Terrestrial → Soil	25.38%
Marine	Environmental → Aquatic → Marine	2.60%
Sediment	Environmental → Aquatic → Sediment	1.95%
Peat	Environmental → Terrestrial → Peat	1.08%
Defined Media	Engineered → Lab Enrichment → Defined Media	1.08%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.87%
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.22%

Type

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Sediment	29.72%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	22.13%
Lake	Environmental → Aquatic → Freshwater → Lake	17.35%
Lentic	Environmental → Aquatic → Freshwater → Lentic	10.41%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	8.03%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.25%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.95%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.08%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.08%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.08%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	1.08%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.87%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.87%
Pond	Environmental → Aquatic → Freshwater → Pond	0.43%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.22%
Sediment	Environmental → Aquatic → Marine → Sediment	0.22%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.22%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	29.72%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	22.13%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	16.27%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	10.41%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	7.38%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	2.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.95%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	1.08%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	1.08%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.08%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.08%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	1.08%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.87%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.87%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.65%
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	0.65%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	0.43%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.22%
Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment	0.22%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.22%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.22%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.22%

Habitat

Habitat	Taxonomy	Distribution
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	24.73%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	20.82%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	16.27%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	10.41%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	7.16%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	4.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	2.17%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.30%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	1.08%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.08%
Enrichment Culture	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture	1.08%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	0.87%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.87%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.87%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.65%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	0.65%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	0.65%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.65%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.65%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.65%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	0.43%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.43%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.22%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.22%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.22%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.22%
Marine Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment	0.22%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.22%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.22%
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.22%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300000231	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4	Environmental
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300001752	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30	Environmental
3300002053	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ	Environmental
3300002961	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk	Environmental
3300003432	Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk	Environmental
3300003861	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR	Environmental
3300003993	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2	Environmental
3300004282	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment	Environmental
3300004481	Combined Assembly of Gp0112041, Gp0112042, Gp0112043	Environmental
3300005144	Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG	Engineered
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental
3300006224	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG	Environmental
3300006930	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC	Environmental
3300009009	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015	Environmental
3300009037	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015	Environmental
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental
3300009085	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015	Environmental
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental
3300009091	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)	Environmental
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental
3300009131	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1	Environmental
3300009146	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015	Environmental
3300009153	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015	Environmental
3300009165	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015	Environmental
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental
3300009169	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015	Environmental
3300009171	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015	Environmental
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental
3300009430	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring	Environmental
3300009771	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG	Engineered
3300011340	Combined Assembly of Wetland Metatranscriptomes	Environmental
3300012964	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG	Environmental
3300014314	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2	Environmental
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental
3300018029	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG	Environmental
3300018055	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex	Environmental
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental
3300018068	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2	Environmental
3300018070	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1	Environmental
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental
3300020172	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1	Environmental
3300022208	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1	Environmental
3300024054 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG	Environmental
3300025174	Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3	Environmental
3300025314	Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2	Environmental
3300025967	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes)	Environmental
3300027051	Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes)	Engineered
3300027693	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)	Environmental
3300027713	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)	Environmental
3300027715	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)	Environmental
3300027721	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)	Environmental
3300027726	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)	Environmental
3300027740	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq	Environmental
3300027811	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq	Environmental
3300027818	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)	Environmental
3300027841	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)	Environmental
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental
3300027887	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk	Environmental
3300027888	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)	Environmental
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental
3300027900	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)	Environmental
3300027901	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)	Environmental
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental
3300027956	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)	Environmental
3300027979	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)	Environmental
3300030613	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227	Environmental
3300031746	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20	Environmental
3300031772	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20	Environmental
3300031834	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0	Environmental
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental
3300032020	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18	Environmental
3300032046	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40	Environmental
3300032053	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16	Environmental
3300032070	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20	Environmental
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental
3300032156	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0	Environmental
3300032163	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0	Environmental
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental
3300033406	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT	Environmental
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental
3300033414	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B	Environmental
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental
3300033418	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A	Environmental
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300033434	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b	Environmental
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental
3300033481	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT	Environmental
3300033482	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C	Environmental
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental
3300033487	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A	Environmental
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental
3300033489	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214	Environmental
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TB_LI09_4DRAFT_100300532	3300000231	Groundwater	MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETITLVL*
TB_LI09_4DRAFT_100787692	3300000231	Groundwater	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIQTR*
TB_LI09_4DRAFT_100818802	3300000231	Groundwater	MQGAQKLRSEAHLGVRRNDEVEAQRRRWIFYETIKFC*
JGIcombinedJ13530_1073447421	3300001213	Wetland	MQGAQKLRSKAQLQARRTDEVAAQRHRLTFYEAIIFCPFPFPIYSRYR
JGI2173J19968_100994631	3300001752	Marine Sediment	MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF*
SMTZ23_100216016	3300002053	Marine Sediment	MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIFIDYLF*
JGI11641J44799_100922932	3300002961	Wetland	QSPQKPGSEEHFGVRRSDEVVTQSFSERDRWTFYETIKFLKGLWE*
JGI20214J51088_103201431	3300003432	Wetland	MQGAQKLRSEAHLQVRRNDEVAAQRSRWTFHEAINIKKTKRKPK*
Ga0031654_101164441	3300003861	Freshwater Lake Sediment	MQGAQKLRREAYLQLRCNDEVAAQRRRWTFYESINLWVSKP
Ga0031654_101229742	3300003861	Freshwater Lake Sediment	MQGAQKLRSEAYLYVRCNDEVEAQRRRWNFYEAIKKNEIN*
Ga0055468_101614581	3300003993	Natural And Restored Wetlands	LQMPGAQKLRSEAHLRVRRSDEVEAQRRRWTFYETIKVRK*
Ga0066599_1009205822	3300004282	Freshwater	MPGAQKLRSEAYYQVRRNDEVAAQRRRWTFYETIKGKGGES*
Ga0069718_101178126	3300004481	Sediment	MQGAQKLRSEAHFQVRRNDEVEAQRRRWAFYVTIKKGGWQ*
Ga0069718_159927166	3300004481	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKLGVALQFFRS*
Ga0069718_161755961	3300004481	Sediment	MQGAQKLRSEAYYQVRCNDEVEAQRRRWIFYETINFEEEI*
Ga0069718_163756662	3300004481	Sediment	MPGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIIIPRRPLPG
Ga0068711_10284392	3300005144	Enrichment Culture	MQGAQKLRSAAYLQVRCNDEGAAQRRRWTFYETINKEET*
Ga0068711_10400232	3300005144	Enrichment Culture	MQGAQKLRSKAHVQVRRNDEVAAQRRRWTFYETLNIRNNILLQEERRGGL*
Ga0068711_10473481	3300005144	Enrichment Culture	MQGPQNLRSEACKPLPGNDEDEAQRRRWTFCETIKYPDWSR
Ga0074472_102929642	3300005833	Sediment (Intertidal)	MQGAQKLRSEAHLQVRRNDDVEAQRRRWTFYEIIKFPQPHS
Ga0074472_106181642	3300005833	Sediment (Intertidal)	MQGAKKLRDEAHLWVRGNDEGEAQSRSARDRWTFYETVKFGI*
Ga0074472_112246271	3300005833	Sediment (Intertidal)	MQGAQKLRSEAHLQVRRSDEVEAQRRRWIFYETIKFAYK*
Ga0079037_10000034610	3300006224	Freshwater Wetlands	MQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK*
Ga0079037_1000012623	3300006224	Freshwater Wetlands	MPGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN*
Ga0079037_1000035902	3300006224	Freshwater Wetlands	MPGAQKLWSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI*
Ga0079037_1000132567	3300006224	Freshwater Wetlands	QMQGAQKLRSEAHLQVRRSDEVAAQSRSERDRWTFCETIIL*
Ga0079037_1000337121	3300006224	Freshwater Wetlands	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKLDSF
Ga0079037_1000718934	3300006224	Freshwater Wetlands	MQGAQKLRSDAHSQLRRNDEVAVQSRSERDRWTFYETIKTG*
Ga0079037_1001895985	3300006224	Freshwater Wetlands	QGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF*
Ga0079037_1002148351	3300006224	Freshwater Wetlands	MQGAQKLRSEAHLQVRRSDEVAAQSRSERDRWTFC
Ga0079037_1006113502	3300006224	Freshwater Wetlands	MQGAQKLRSEAHFQVRRNEEVAAQRRRWTFYETII
Ga0079037_1006774731	3300006224	Freshwater Wetlands	MVSEKAQLQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETI
Ga0079037_1007099461	3300006224	Freshwater Wetlands	AQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG*
Ga0079037_1009604061	3300006224	Freshwater Wetlands	MQGAQNLRSEAYLLVRCNDEGEAQRRRWTFYEVIK
Ga0079037_1012390701	3300006224	Freshwater Wetlands	KKLQMQGVQKPRSAAQLQVHRKDEVEAKRRRRTFYETIIIKGASA*
Ga0079037_1018245861	3300006224	Freshwater Wetlands	EAHLRVRRSDEVAAQSRSERDRWTFYETINFFLP*
Ga0079303_100078631	3300006930	Deep Subsurface	MQGTQKLRSEAHLCVRRNDEVEAQRSRWTFYETIK
Ga0079303_101004061	3300006930	Deep Subsurface	QGVQKLRSEAHISRASRDNDEVEAQSRSARDRRDFCETINGYLTP*
Ga0079303_104316402	3300006930	Deep Subsurface	MQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYETIK
Ga0105105_102526172	3300009009	Freshwater Sediment	MQGAQKLRSETHLRVRRNDEVETHRRRWTFYETIKL*
Ga0105105_103196251	3300009009	Freshwater Sediment	LQMQGAQELRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT*
Ga0105105_104827812	3300009009	Freshwater Sediment	MQGAQKLRSAAHELVRRNDEVAAQPSRWTFYETIKAGRE*
Ga0105093_100673172	3300009037	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC*
Ga0105093_102242922	3300009037	Freshwater Sediment	MQGAQKLRREAHLQVRRNDEVAAQRRRWTFYETINFNRGYPL*
Ga0105095_102259803	3300009053	Freshwater Sediment	MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIK*
Ga0105095_102430831	3300009053	Freshwater Sediment	RSEAHLQVRRNDEVEAQRSRWTFYEIIKPTGTGF*
Ga0105095_106412882	3300009053	Freshwater Sediment	LQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKIRRERKHNG*
Ga0105090_102072561	3300009075	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTGT*
Ga0105090_103121053	3300009075	Freshwater Sediment	MQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY*
Ga0105090_103212563	3300009075	Freshwater Sediment	AQKLRSEAYIKVRCNDEVEAQRRRWTFYETIKDSRDYISVL*
Ga0105090_106043981	3300009075	Freshwater Sediment	MQGAQKLRSEAHLRVRRKDEVEAQRCRWTFYETITS
Ga0105090_110008101	3300009075	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEGAAQRRRWTFYEAIK*
Ga0105106_100086917	3300009078	Freshwater Sediment	MQGAQKLRIEAHLQVRRSDEVEAQRRRWTFYETINPC*
Ga0105106_100163301	3300009078	Freshwater Sediment	AQKLRSEAHLRVRRNDEVEAQRHRWTFYETIKFPAEKRGPLDFA*
Ga0105106_100233773	3300009078	Freshwater Sediment	MLQMQGAQKLRSAAHELVRRNDEVAAQRSRWTFYETIEAGRE*
Ga0105106_100248881	3300009078	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKYRK*
Ga0105106_100276371	3300009078	Freshwater Sediment	AQKLRSEAYLQVRCNDEVEAQRRRWIFYETLKLGG*
Ga0105106_100364624	3300009078	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI*
Ga0105106_100605528	3300009078	Freshwater Sediment	KKLQMQGAQKLRREAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI*
Ga0105106_101029532	3300009078	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKIRRERKHNG*
Ga0105106_101093311	3300009078	Freshwater Sediment	RKKLQMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY*
Ga0105106_102094471	3300009078	Freshwater Sediment	MPGAQKLRSEAYYQVRRNDEVAAQRRRWTFYETIK
Ga0105106_102359361	3300009078	Freshwater Sediment	QMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKKGGWQ*
Ga0105106_103215541	3300009078	Freshwater Sediment	MQGAQELRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT*
Ga0105106_103365323	3300009078	Freshwater Sediment	MQGAQKLRSEPHLQVHRNDEVAAQRRRWTFYETIIF
Ga0105106_107732961	3300009078	Freshwater Sediment	MPGAQKLRSEARFPVRRNDEVEAQRRRWTFYEPIKKGGAMS
Ga0105106_109560702	3300009078	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA*
Ga0105106_109951191	3300009078	Freshwater Sediment	KLRSEAHLQVRRNDEVEAQRSRWTFYETISILLP*
Ga0105098_100357442	3300009081	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS*
Ga0105098_100981663	3300009081	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETITFRIRAPALR
Ga0105098_101071272	3300009081	Freshwater Sediment	AQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIRHFENS*
Ga0105098_101093332	3300009081	Freshwater Sediment	MQGAQKLRSETHLRVRRNDEVETQRRRWTFYETIKL*
Ga0105098_101268923	3300009081	Freshwater Sediment	QKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP*
Ga0105098_103028982	3300009081	Freshwater Sediment	MQGAQKLRREAHFWVRRNAEVAAQRRRWTFYETITL*
Ga0105103_100456782	3300009085	Freshwater Sediment	MQGAQKLRSEAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI*
Ga0105103_100515901	3300009085	Freshwater Sediment	MQGAQKLRSEAHLRVRCNDEVEAQRSRWIFYETINHSRVI
Ga0105103_100644682	3300009085	Freshwater Sediment	MQGAQKLRSEAHFQVRRNDEFAAQRRRWTFYETINSKISGEDDGDG
Ga0105103_100757241	3300009085	Freshwater Sediment	MQRAQKLRSEAHLQVRSNDEVGTQRRRWTFLETIKEENVFMG
Ga0105103_101179792	3300009085	Freshwater Sediment	MQGAQKLRREAHLQVRRNDEVEAQRHRWTFYEAIKE*
Ga0105103_101333551	3300009085	Freshwater Sediment	MQGAQKLRSEAHFGVRRNDEVEAQRRRWTFYETII
Ga0105103_102765612	3300009085	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDKVEAQRSRWTFYEVINVESLQK*
Ga0105103_102827632	3300009085	Freshwater Sediment	MPGAQKLRREAPLQVRRNGEVEAQRRSWAFYETIK*
Ga0105103_106779052	3300009085	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYKTIF
Ga0105107_100460633	3300009087	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKK*
Ga0105107_100785241	3300009087	Freshwater Sediment	GAQKLRSEAYEQVRCNDEVEAQRRRWTFYEAITLAPFFAR*
Ga0105107_104685271	3300009087	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVINIASASKP
Ga0105107_107325471	3300009087	Freshwater Sediment	GAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI*
Ga0102851_100245975	3300009091	Freshwater Wetlands	AQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT*
Ga0102851_101073541	3300009091	Freshwater Wetlands	MPGAQKLRSEAHLRVRRNDEVAAQSRSGRNRWTFYETINN*
Ga0102851_102050812	3300009091	Freshwater Wetlands	MQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYEIITS*
Ga0102851_105104882	3300009091	Freshwater Wetlands	MQVAQKRKSAAHLQVRRNDEVEAQGRRWTSYETIKIDQFGR*
Ga0102851_112561642	3300009091	Freshwater Wetlands	MQGAQKLRSEAHLRVRHNDEVEAQRRRWTFYEIINFDSEFPETER
Ga0102851_114340522	3300009091	Freshwater Wetlands	MQGAQKLRSEAQFQVRRNDEVAAQRSRWTFYETINIEKTMKDHYKTL
Ga0102851_116667321	3300009091	Freshwater Wetlands	KKLQMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKI*
Ga0102851_118731802	3300009091	Freshwater Wetlands	KKLQMQGAQKLRSEAHLRVRRSDEVEAQRCRWTFYEVIKIISP*
Ga0102851_132535162	3300009091	Freshwater Wetlands	MPGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETI
Ga0102851_132745821	3300009091	Freshwater Wetlands	MQGAQKRRSEAHLSVRRNDEVAAQSRSERDRWTFYE
Ga0115026_100033482	3300009111	Wetland	MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT*
Ga0115026_101247443	3300009111	Wetland	MQGAQKLRSEAHDRVRRNDEVTAQSRSERDRWTFYK
Ga0115026_102474232	3300009111	Wetland	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVIK*
Ga0115026_104800282	3300009111	Wetland	KKLQMQGAQKLRSEVHLEVRRRWTFYETINKCRKN*
Ga0115026_115424341	3300009111	Wetland	MQGAQKLRSEAHVQVRRNDEVEAQRSSWTFYEAIKVA*
Ga0115026_118382391	3300009111	Wetland	KLQMQGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN*
Ga0115027_102490621	3300009131	Wetland	MQGAQKLRSEAHIWVRRNDEVAAQSRSERDRWTFYETIKGDGILKGDAR*
Ga0115027_105514661	3300009131	Wetland	MQDAQKLRSEAHLRVRHNDEVEAQRRRWTFYEIINFDSEFPETERGGREN
Ga0115027_111935121	3300009131	Wetland	MQGAQKLRSEAHLPVRRNDEVAAQSRSERDRWTFYETII
Ga0115027_113776942	3300009131	Wetland	QGGQKLRSEAPLRVRRSDEVEAQRSRWTFYETIKKGGWQWLS*
Ga0105091_101942211	3300009146	Freshwater Sediment	MPGAQKLRSAARLRVRRNEEVEARRRRWSFYEVIYYFPIII
Ga0105091_103457932	3300009146	Freshwater Sediment	MQGARKPRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS*
Ga0105094_100590003	3300009153	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKR*
Ga0105094_100819353	3300009153	Freshwater Sediment	MQGAQKLRSEAYLRVRRNDEVEAQRRRWTFYETIKL*
Ga0105094_101058523	3300009153	Freshwater Sediment	QKLRSEAHLQVRRNDEVEAQRRRWTFYETIKYRK*
Ga0105094_101204291	3300009153	Freshwater Sediment	GAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINASVL*
Ga0105094_101212204	3300009153	Freshwater Sediment	QGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKNR*
Ga0105094_101579352	3300009153	Freshwater Sediment	LQMQGAQKLRSEAHLHVRRNDKVEAQRRRWTFYETITY*
Ga0105094_103081931	3300009153	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT*
Ga0105094_104367121	3300009153	Freshwater Sediment	MLQMQGAQELRSEAHLQVRRNDEVAAQRSRWTFYEAIIDRDLKDA
Ga0105094_107789431	3300009153	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIK
Ga0105102_101126531	3300009165	Freshwater Sediment	GAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP*
Ga0105102_102872831	3300009165	Freshwater Sediment	MPGAQKLRSAPHLKVRRNDEVAAQRRRWTFYVTIKGG
Ga0105102_109088932	3300009165	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIV
Ga0105100_100902071	3300009166	Freshwater Sediment	MPGAQKLRRDAHNQVRRNDAVAAQRRRWTFYETISCWPALKPLMNF
Ga0105100_101029552	3300009166	Freshwater Sediment	MQGAQNLRREAHLRVRRNDEVEAQRRRWTFYETIIIGT
Ga0105100_101267911	3300009166	Freshwater Sediment	LQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF*
Ga0105100_102377173	3300009166	Freshwater Sediment	MQGTQKLRSAAHLQVRRNDKVAAQRTKWTFYDTIKILP
Ga0105100_103943681	3300009166	Freshwater Sediment	MQGAKKLRSEAYRWVRCNDEVEAQRRRWIFCETIILSI
Ga0105100_106015491	3300009166	Freshwater Sediment	FLFYGFVKSSRCEAHLRVRRNDEVEAQRRRWTFYETILF*
Ga0105100_107534572	3300009166	Freshwater Sediment	CKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK*
Ga0105100_108000901	3300009166	Freshwater Sediment	MQGAQKLRSEAHLRVCRNDKVEAQRSRWTFYEVINVESLQK*
Ga0113563_100557604	3300009167	Freshwater Wetlands	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETINFTPKR
Ga0113563_102338523	3300009167	Freshwater Wetlands	MQGAQKLRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR*
Ga0113563_103603771	3300009167	Freshwater Wetlands	MQGAQKLRSAAHAYVRRNDEGEAQSRSERDRWAFYE
Ga0113563_111532132	3300009167	Freshwater Wetlands	MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIKN*
Ga0113563_112589082	3300009167	Freshwater Wetlands	QMQGSQKLKGEAHFQVRRNDEVATQSRSEQDRWTFYEAIKNCCSK*
Ga0113563_113794921	3300009167	Freshwater Wetlands	MQGAQKLRSAAHYKVRCNDEVEVQRSSWAFYETINPDQGQQ*
Ga0113563_115843052	3300009167	Freshwater Wetlands	MQGAQKLRSEAHNQVRRNDEVEAQRRRWTFYEPIIF
Ga0113563_122574672	3300009167	Freshwater Wetlands	KKLQMQGAQKLRGEAHLQVRRNDEVEAQRRRGTF*
Ga0113563_139418711	3300009167	Freshwater Wetlands	MQGARKLRSEAHLQVRRSDEVEAQRRRWTFYETIK
Ga0105104_104320882	3300009168	Freshwater Sediment	MQGAQKLRREAHLRVRRNDEVEAQRHRWTFYETIK
Ga0105097_100073717	3300009169	Freshwater Sediment	RSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS*
Ga0105097_100074971	3300009169	Freshwater Sediment	MQGAQKLRNEAHLQVRRNDEVEAQRSRWTFYETIKPTGTGF*
Ga0105097_100231349	3300009169	Freshwater Sediment	MQGAQKLRSEPHLQVRRSDEVEAQRRRWTFYETINF
Ga0105097_100322952	3300009169	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINIDSSTNQKKGG*
Ga0105097_100342891	3300009169	Freshwater Sediment	MQGAQKLRSEAHLRVRRSDEVEAQCRRWTFYETIILDGALETGI*
Ga0105101_100175803	3300009171	Freshwater Sediment	MLQMQGAQKLRSAAHELVRRNDEVATQRSRWTFYETIEAGRE*
Ga0105101_102534332	3300009171	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDKVEAQRSRWNFYETIIL*
Ga0105101_104844442	3300009171	Freshwater Sediment	MQGAQKFRSEAYEQVRCNDEVEAQRRRWTFYETINFHQEIL
Ga0115028_104099081	3300009179	Wetland	MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF*
Ga0115028_104132082	3300009179	Wetland	MQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGF
Ga0115028_106944562	3300009179	Wetland	QGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINFDK*
Ga0114938_13283611	3300009430	Groundwater	MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYEAISPLAGREKPTR*
Ga0116155_103406171	3300009771	Anaerobic Digestor Sludge	MQGAQKLRSEPHLQVRRNDEVEAQRRRWTFYETIKFNS
Ga0151652_126803312	3300011340	Wetland	MQGAQKLRTEAHLQVRCKDEVEAQRRRWDFYETINDDVP*
Ga0151652_137699542	3300011340	Wetland	KKLQMQGAQKLRSEAYVQVRCNDEVEAQRGRWTFYETVNI*
Ga0151652_137878341	3300011340	Wetland	MLGAQKLRSEAHLWVRRNDEVAAQRRRWTFYETIFFKW
Ga0153916_128528382	3300012964	Freshwater Wetlands	QNLRSEAYLPVRCNDKGEAQRRRWTFYEAIKIERKVEGIL*
Ga0075316_11762182	3300014314	Natural And Restored Wetlands	MPGAQKLRSEAHLQVRRNDEEIDGQRRRWTFYETIKITPRKDQRIAG*
Ga0075316_12055562	3300014314	Natural And Restored Wetlands	VQGAQKLRNEAHLRVRRNDEVEAQRRKWTFYEVIKL*
Ga0187776_105800282	3300017966	Tropical Peatland	MQGAQKLRSEAYLHVRCNDEIEAQPRSERDRGTFYETI
Ga0187787_104067261	3300018029	Tropical Peatland	MQGAQKLRSEAHFQVRRNDGVAAQRSRWTFYETINHD
Ga0184616_103065291	3300018055	Groundwater Sediment	MQGAQNLRSEAYWLVRCNDEGEAQRRRWTFYEAISLGILGQRE
Ga0184615_105716251	3300018059	Groundwater Sediment	MPGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKIPFTGSS
Ga0184615_106125651	3300018059	Groundwater Sediment	LQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKD
Ga0187773_107434622	3300018064	Tropical Peatland	FRKKIQMQGAQELRSEAYFHVRCNGEVEAQRRRWTFYEAVKE
Ga0184636_10984452	3300018068	Groundwater Sediment	MQGAQNLRSEAYLVVRCNDEGEAQRRRWTFYETIK
Ga0184636_12003001	3300018068	Groundwater Sediment	MPGAQNLRSEVYLLVRCNDEGEAQRRRWTFYEAIK
Ga0184631_100737901	3300018070	Groundwater Sediment	GAQKLRSEAHKQVRRNDEVAAQRSRWTFYETLKVTSPR
Ga0194113_10000045127	3300020074	Freshwater Lake	KKLQMQGAQNLRSEAYLQVRCNDEGEAQRRRWTFYETIKTFDH
Ga0194113_1000009656	3300020074	Freshwater Lake	MQGAQNLRSEAYLQVRRNDEGEAQRRRWTFYETILIEL
Ga0194113_1000032429	3300020074	Freshwater Lake	MQGAQNLRSEAYLQVHCNDEGEAQRRRWTFYETIFLDAPGKGGEYTPSKKT
Ga0211729_111625922	3300020172	Freshwater	MQGAQKLRSEAHLQVRRNDEVAAQRRRWIFYEAIKIDSA
Ga0224495_100413822	3300022208	Sediment	MQGAQNLRSEAYLLVRCNDEGEAQRRRWTLYETIRF
(restricted) Ga0233425_103150502	3300024054	Freshwater	MKGAQKLRSEAHLQVRCNDEGAAQRRRWTFYETINFDTQSSRK
Ga0209324_100304153	3300025174	Soil	MQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINFW
Ga0209324_106007552	3300025174	Soil	QMQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINH
Ga0209323_100858223	3300025314	Soil	KLQMQGAKKLRSEAYLHVRCNDEVEAQRSRWTFYETINID
Ga0210136_10768722	3300025967	Natural And Restored Wetlands	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINV
Ga0209269_10675962	3300027051	Enrichment Culture	MQGAQKLRRAVHLPVRRNDEVEAQRRRWPFYETIKF
Ga0209269_10735082	3300027051	Enrichment Culture	MPIAQKRRSAAHLQVRRTDEVEAQRRRWTFYETIKNYETKG
Ga0209704_12566002	3300027693	Freshwater Sediment	MLQMQGAQKLRSAAHELVRRNDEVAAQRSRWTFYETIEAGRE
Ga0209286_12988932	3300027713	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKR
Ga0209286_13367232	3300027713	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP
Ga0208665_101941481	3300027715	Deep Subsurface	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYEIITS
Ga0209492_10044975	3300027721	Freshwater Sediment	MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIK
Ga0209492_10120604	3300027721	Freshwater Sediment	MQGAQKLRSEAYYQVRCNDEVEAQRRRWIFYETINFEEEI
Ga0209492_10285845	3300027721	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTGT
Ga0209492_10326246	3300027721	Freshwater Sediment	MQGAQKLRSEAHLRVRRSDEVEAQCRRWTFYETIILDGALETGI
Ga0209492_10468652	3300027721	Freshwater Sediment	MQGAQKLRSEAHLLVRRNDKVEAQRRRWTFYEAIKFR
Ga0209492_10527292	3300027721	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITE
Ga0209492_10625993	3300027721	Freshwater Sediment	KLQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF
Ga0209492_10651192	3300027721	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDKVEAQRSRWTFYEVINVESLQK
Ga0209492_11336781	3300027721	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETINNSFFSA
Ga0209492_11464012	3300027721	Freshwater Sediment	MQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIK
Ga0209492_11971891	3300027721	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIT
Ga0209492_12118711	3300027721	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQ
Ga0209492_12318411	3300027721	Freshwater Sediment	MQGAQKPRSEAHILVRRNDEVEAQRRRWTFYETITGSAWR
Ga0209492_12938781	3300027721	Freshwater Sediment	LQMQGAQKLRSEAHLQVRRNDEGAAQRRRWTFYEAIK
Ga0209285_100274011	3300027726	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRSRWNFYETITF
Ga0209285_100598502	3300027726	Freshwater Sediment	QMPGAQKLRNEAPSRVRRNDEVAAQRRRWIFYETIKIT
Ga0209285_100927333	3300027726	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC
Ga0209285_101141651	3300027726	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYEIIAQGTMTTLIAPSS
Ga0214474_10138123	3300027740	Soil	MQGAQNLRSEAYFQVRCNDEGEAQRRRWTFYEAINV
Ga0214474_11823551	3300027740	Soil	MQGAQNLRSEAYLLERCNDEGEAQSRSERDRCTFYETIISCPMKK
Ga0256868_100024261	3300027811	Soil	MQGAQNLRSEAYLLERCNDEGEAQSRSERDRCTFYETIISCPMKKE
Ga0209706_100409101	3300027818	Freshwater Sediment	MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIVS
Ga0209706_100446472	3300027818	Freshwater Sediment	MQGAQKLRSETHLRVRRNDEVETQRRRWTFYETIKL
Ga0209706_100566283	3300027818	Freshwater Sediment	KKLQMQGAQKLRSAAYLSVRCNDEVEAQRRRWTFYETIIFPG
Ga0209706_100797391	3300027818	Freshwater Sediment	MQGAQKLRSEAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI
Ga0209706_100853731	3300027818	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRCRLTFYETITEE
Ga0209706_101608052	3300027818	Freshwater Sediment	MQGAQKLRSEAHLQVRRKDEVDAQRRRWTFYETINDDPIKSL
Ga0209706_101675992	3300027818	Freshwater Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETITFR
Ga0209706_102647872	3300027818	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA
Ga0209706_104060161	3300027818	Freshwater Sediment	MQGAQKPRSEAHIWVRRNDEVAAQRRRWTFYESIRIFSVRF
Ga0209262_105468911	3300027841	Freshwater	MPGAQKLRSEAHYRVRRNDEVAAQRRRWTFYETINF
Ga0209293_101092571	3300027877	Wetland	MQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK
Ga0209293_106236342	3300027877	Wetland	MPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANTVVVQ
Ga0209293_107577982	3300027877	Wetland	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVIK
Ga0208980_104834272	3300027887	Wetland	MQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIML
Ga0209635_100213224	3300027888	Marine Sediment	MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF
Ga0209496_101560982	3300027890	Wetland	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIIFE
Ga0209496_102384741	3300027890	Wetland	QMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFLLDHLL
Ga0209496_105036562	3300027890	Wetland	MQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMP
Ga0209254_100160956	3300027897	Freshwater Lake Sediment	MQGAQKLRSEAHFLVRCNDEVEAQRRRWTFYETIKFLFGRKL
Ga0209254_100463335	3300027897	Freshwater Lake Sediment	GAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKIGRGIG
Ga0209254_100475992	3300027897	Freshwater Lake Sediment	MQGAQKLRSEAHFQVRRNDEGAAQRRRWNFYEAIKLDP
Ga0209254_100691052	3300027897	Freshwater Lake Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKHIIQP
Ga0209254_100745692	3300027897	Freshwater Lake Sediment	MQGAQKLRREAHFQVRRSDEVEAQRSRWTFYETIPS
Ga0209254_100761663	3300027897	Freshwater Lake Sediment	GAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKFGIFKKNGG
Ga0209254_100776136	3300027897	Freshwater Lake Sediment	GAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKYD
Ga0209254_100935822	3300027897	Freshwater Lake Sediment	QRAPTMPGAQKLRSEAHLRVRRNDEVAAQSRSERDRWTFCETTLIGV
Ga0209254_101367101	3300027897	Freshwater Lake Sediment	MQGAQKLRSEAHLLVRRNDEVAAQRSRWTFYETILIAFYEVHRWREQ
Ga0209254_104134502	3300027897	Freshwater Lake Sediment	MQGAQKLRSEAHLQVRLSDEVEAQRRRWTFYETINIDSSTNQKKGG
Ga0209254_105669462	3300027897	Freshwater Lake Sediment	RKKLQMQGAQKLRSEEHLQVRRNDEVTAQRRRWTFYETINY
Ga0209254_107567732	3300027897	Freshwater Lake Sediment	MQGPQKLRSEAHLQVRCRDEVAGQRSRWTFYEAIDH
Ga0209668_102261932	3300027899	Freshwater Lake Sediment	MQGAQKLRSEVHLRVRRNDEVEAQRRRWTFYETIL
Ga0209668_108624322	3300027899	Freshwater Lake Sediment	MPGTQKLRGEGHLQVRRNGEVEAQRRSWAFCETVQFGLFA
Ga0209668_110339481	3300027899	Freshwater Lake Sediment	VQGGQKLRSEAYYQARGNDEVEAQRRRWTFYETIIFFIIDNQGL
Ga0209253_100148167	3300027900	Freshwater Lake Sediment	MQGAQKLRSEAHFQVRRNDEVAAQRRRWNFYETIKIDSLSLS
Ga0209253_101351353	3300027900	Freshwater Lake Sediment	QMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKF
Ga0209253_102380583	3300027900	Freshwater Lake Sediment	VGASAARPYIQGAQKLRSEAHFRVRRRWTFYETIKIY
Ga0209253_102387762	3300027900	Freshwater Lake Sediment	PPQAGLGAQELRSEAQNQVRRKDEVAAQRSRWTFYETIKAISPR
Ga0209253_105611391	3300027900	Freshwater Lake Sediment	GAQKLRSEAYLQVRCNDEVEAQRRRWTFYETINFSFAKKKGKPCNEK
Ga0209427_100229902	3300027901	Marine Sediment	MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIFIDYLF
Ga0209427_100780762	3300027901	Marine Sediment	MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIILDFYHS
Ga0209427_104774822	3300027901	Marine Sediment	AQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF
Ga0209048_1000411711	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAYLHVRCNDEIEAQRRRWIFYETIKINCG
Ga0209048_1001144610	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAHFQLRRNDEVAAQRRKWTFYEAIRI
Ga0209048_1001260613	3300027902	Freshwater Lake Sediment	QMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIK
Ga0209048_100157221	3300027902	Freshwater Lake Sediment	QMQGAQKLRSEAYLQVRRNDEGEVQRSRWTFYETITLDS
Ga0209048_100229444	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIQIG
Ga0209048_100229636	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAYLQIRCNDEVEAQRRRWTFYETIRFYAT
Ga0209048_100425901	3300027902	Freshwater Lake Sediment	MQGAQKLRSEACLQVRCNDEVEAQRRRWTFYETIN
Ga0209048_100482455	3300027902	Freshwater Lake Sediment	QGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETINDWRG
Ga0209048_100528384	3300027902	Freshwater Lake Sediment	MQGAQNLRSEAYLQVRRNDEGEVQRSRWTFCETIKEGGL
Ga0209048_100552725	3300027902	Freshwater Lake Sediment	GAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIITT
Ga0209048_100607621	3300027902	Freshwater Lake Sediment	QGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETIYNGGF
Ga0209048_100622712	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKFD
Ga0209048_100778043	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAYLYVRCNDEVEAQRRRWNFYEAIKKNEIN
Ga0209048_100812493	3300027902	Freshwater Lake Sediment	QMQGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETIIIIP
Ga0209048_102631452	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAHLQLRRNDEVAAQRSRWTFYETIKFDDLIKSH
Ga0209048_102846012	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETITLMGVKIA
Ga0209048_103476301	3300027902	Freshwater Lake Sediment	GAQKLRSEAHLQVRRNDEVAAQRRRWTFYETISFHE
Ga0209048_103618601	3300027902	Freshwater Lake Sediment	GAQKLRSEGYLQVPCNDEVEAQRRRWTFYETINISLIR
Ga0209048_104007372	3300027902	Freshwater Lake Sediment	QKLRSEAYLHVRCNDEVEAQRRRWIFYETTIIDPCCY
Ga0209048_104505532	3300027902	Freshwater Lake Sediment	MQGAQKLRSEAHLQMRRNKEVAAQRSRWTFYETINLWHIHK
Ga0209048_105383602	3300027902	Freshwater Lake Sediment	QMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKF
Ga0209048_106482701	3300027902	Freshwater Lake Sediment	GAQKLRSEGYLQVPCNDEVEAQRRRWTFYETINFCANYFLS
Ga0209048_107897542	3300027902	Freshwater Lake Sediment	QMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKFTFSD
Ga0209048_107926011	3300027902	Freshwater Lake Sediment	MHGAQKLRSEGYLQVPCNDEVEAQRRRWTFYETIN
Ga0209048_108394131	3300027902	Freshwater Lake Sediment	QGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETINIMSI
Ga0209048_109381962	3300027902	Freshwater Lake Sediment	GAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKEDSLARSQAE
Ga0209820_10786791	3300027956	Freshwater Sediment	MQGALKMRREAYYQVRCNDEVAAQRRRWNFYETITFSTW
Ga0209705_100421162	3300027979	Freshwater Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKVRG
Ga0209705_100644603	3300027979	Freshwater Sediment	MQGAQKLRIEAHLQVRRSDEVEAQRRRWTFYETINPC
Ga0209705_101241883	3300027979	Freshwater Sediment	MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIC
Ga0209705_102070151	3300027979	Freshwater Sediment	MPGAQKLRSEAHSQVRRNDEVEAQRRRWTLYEAIR
Ga0299915_105389883	3300030613	Soil	MPGAQNLRSEAYLPVRRNDEGEAQRRRWTFYEAIKNNI
Ga0315293_104579943	3300031746	Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETICMN
Ga0315293_109783191	3300031746	Sediment	MQGAQNLRSEAYLQVRCNDEGEAQRRRWTFYETMVF
Ga0315293_112536361	3300031746	Sediment	MQGAQKLRSEAHLQVRRSDEVEAQRSRWTFYETIKFKDSEH
Ga0315288_106998152	3300031772	Sediment	QMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYEAIKFRL
Ga0315290_100344034	3300031834	Sediment	MQGAQKLRSEAHFQVRRNDEVEAQRSRWTFYETIMYGPP
Ga0315290_101660022	3300031834	Sediment	MQGAQKLRSEAHFLVRRNDEVEAQRRRWTFYETIISRTLRP
Ga0315290_101768281	3300031834	Sediment	FRKKLQMQGAQKLRSEAYYQVRCNDEVEAQRRRWTFYETINI
Ga0315290_106309592	3300031834	Sediment	MPGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIKTLPAGP
Ga0315290_107188282	3300031834	Sediment	LRSEAYLHVRCNDEVEAQRSRWTFYETIKIHSPKELI
Ga0315297_100979963	3300031873	Sediment	KKLQMQGAQKLRSEVHLRVRRNDEVAAQRRRWTFYETINICNLQ
Ga0315297_101737241	3300031873	Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKT
Ga0315297_101847251	3300031873	Sediment	MQGAQRLRREAHLRVRRNDEVAAQRRRWTFYETIKVIS
Ga0315297_102825273	3300031873	Sediment	MQGAQKLRSQAHFQVRRNDEVEAQRSRWTFYETIMYGPP
Ga0315297_106175031	3300031873	Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNSKKYRWLDGH
Ga0315297_106590222	3300031873	Sediment	GAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP
Ga0214473_100373596	3300031949	Soil	MQGAQKLKGEAYFHVRCNDEVEAQSRSERDRWTFYETIKIEDNPD
Ga0214473_102276284	3300031949	Soil	MQGAQNLRSDAYLLVRCNDEGEAQRRRWTFYEAIFFFF
Ga0214473_103038283	3300031949	Soil	AQNVRSEAYLQVRRNDEGEAQRRRWTFYEAINFLFLAWPVRRRKK
Ga0214473_108962222	3300031949	Soil	MQGAQNLRSEAYLAVRRSDEGEAQRRRWTFYEAIIF
Ga0214473_109622654	3300031949	Soil	AQKLRSEAHLRVRRNDEVAAQSRSERDRWTFYETIKD
Ga0315294_110408071	3300031952	Sediment	QMQDAQKLRSEAYEQVRCNDEVEAQRRRWTFYETI
Ga0315294_113176102	3300031952	Sediment	KLWSEAHLQVRRNDEGAAQRRRWTFYEIIWDRFEVIR
Ga0315278_100492156	3300031997	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETITLT
Ga0315278_101835613	3300031997	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIN
Ga0315278_102660882	3300031997	Sediment	MPGAQKLRSEAYLQVRGNDEVEAQSRSERDRWIFYETIKFGG
Ga0315278_106310971	3300031997	Sediment	MQGAQKLRSEAHLWVRRNDEVAAQRRRWTFYETIKISIAIYHKGRKM
Ga0315274_103251793	3300031999	Sediment	MQGAQKLRSEARLQVRRNDEVEAHRRRWTFYETINH
Ga0315274_107544063	3300031999	Sediment	MQGAQKLRREAHLRVRRNDEVEAQRRRWTFYKAINFAS
Ga0315274_107897821	3300031999	Sediment	QSKKHQMQGAQNVRSEAYLQVRLNDEGEAQRRRWTFYEAIKIH
Ga0315296_101755572	3300032020	Sediment	MQGAQKLRSEAYIRVRCNDEVEAQRSRWIFYETIMLILMLFRIEGD
Ga0315296_104329853	3300032020	Sediment	MQGAQSLRSEAYLLVRCNDKGEAQRRRWTFYETINISSCT
Ga0315289_105293401	3300032046	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIIH
Ga0315284_102614772	3300032053	Sediment	MQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINIHFVGAGFNPAQ
Ga0315284_103790791	3300032053	Sediment	GAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINYDAKVRGTTLL
Ga0315284_104817072	3300032053	Sediment	MQGAQKLRSEAHLQVRRKDEVAAQRRSWTFYETIILILP
Ga0315284_106528302	3300032053	Sediment	KKLQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKFRL
Ga0315284_112736901	3300032053	Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINIC
Ga0315284_115851942	3300032053	Sediment	MQGAQELRSEAHLQVRRNDEVEAQRRRWTFYETIKVDRT
Ga0315279_100529873	3300032070	Sediment	MQGAQNLRSEAYLLVRCNDEGEAQRRRWTFYEAIKFRK
Ga0315279_108559531	3300032070	Sediment	MQGAQNLRSEPYYKVRRNDEGEAQRRRWTFYEAITLE
Ga0315292_100733511	3300032143	Sediment	QMQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYETIKLHRNFSA
Ga0315292_101249133	3300032143	Sediment	MQGAQKLRSEAHLQARRNDEVAAQRSRWTFYETIKNG
Ga0315292_114543982	3300032143	Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFSETIKF
Ga0315295_100826314	3300032156	Sediment	QMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP
Ga0315295_105355074	3300032156	Sediment	GAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNSKKYRWLDGH
Ga0315295_105845851	3300032156	Sediment	QGAQKLRSEAHLRVRRNDEVAAQRRRWTFYEAIKFRL
Ga0315295_108695552	3300032156	Sediment	MQGVQKLRSEAHCQVRCNDEVEAQRSRWTFYETLTTD
Ga0315295_112214231	3300032156	Sediment	ELRSAAYLRVRCNDEVEAQSCSEQDRWTFYEIIKFACA
Ga0315281_108489232	3300032163	Sediment	RSEAHLRVRRNDEVAAQRRRWTFYETIIFYSTSFASRIIL
Ga0315283_120336112	3300032164	Sediment	MQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETINF
Ga0315276_101689511	3300032177	Sediment	GAQKLRSETHLRVRRNDEVEAQRRRWTFYEAINLGRKIWRD
Ga0315276_103929623	3300032177	Sediment	MPGAQKLRSEAHFKMHPNDEVAGQRRRWTFYETINIAISSTSNQE
Ga0315276_112738232	3300032177	Sediment	MQGAQKLRSETHLRVRRNDEVEAQRRRWTFYEAIKIYK
Ga0315276_121107961	3300032177	Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCN
Ga0315276_121858881	3300032177	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETINIGNSGKWT
Ga0315286_100653851	3300032342	Sediment	MQGAQKLRSEANSPVRRNDEVEEQRRRWTFYETIRNKTMALRIYN
Ga0315286_114829851	3300032342	Sediment	MQGAQKLRSEAHFKVRCNDEVKAQRSRWTFYETINFGFQK
Ga0315287_103064563	3300032397	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINLGT
Ga0315287_110400513	3300032397	Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIRNNK
Ga0315287_122610661	3300032397	Sediment	MQGAQKLRSEAYSQVRCNDEVEAQRSRWTFYETIKGFSMRRWER
Ga0315287_125093442	3300032397	Sediment	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINYACFEGG
Ga0315275_101487351	3300032401	Sediment	MQGAQKLRSAAHLRVRRNDEVAAQRSRRTFYETIEGGSCP
Ga0315275_102099951	3300032401	Sediment	MQGAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAVKF
Ga0315275_106330501	3300032401	Sediment	MQGAQKLKSEAHLRVRCNDEVEAQRRRWTFYETINFRHF
Ga0315275_107844332	3300032401	Sediment	QGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKI
Ga0315275_111624231	3300032401	Sediment	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNS
Ga0315275_115766341	3300032401	Sediment	LQMQGAQKLRSEAYLHVRWNDEVEAQRSRWTFYETILIKSLQTREFLVKIK
Ga0315275_120203441	3300032401	Sediment	MQGAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAIIVKNRM
Ga0315275_126784731	3300032401	Sediment	MQGAQKLRSEAYLHVRCNDEVEAQSRSERDRWTFYETIKIGSFAP
Ga0315273_102262462	3300032516	Sediment	MQGAQKLRSAAHLQLRRNEEVAAQRSRWTFYETINYACFEGGGSMSLG
Ga0315273_103137314	3300032516	Sediment	AQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKTKRL
Ga0315273_103253523	3300032516	Sediment	KLQMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKIHFP
Ga0315273_103347733	3300032516	Sediment	KLQMQGAQKLRSEAYLHVRCNDEVEAQSRSERETFYETTTLY
Ga0315273_103811672	3300032516	Sediment	MQGAQKLRSEAYYQVRCNDEVEAQRRRWTFYETINI
Ga0315273_105711262	3300032516	Sediment	MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKISPFEKGG
Ga0315273_106492211	3300032516	Sediment	MQGAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKFC
Ga0315273_113584641	3300032516	Sediment	QGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINFDNSITKGVQAGQ
Ga0315273_113679561	3300032516	Sediment	MQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYEAIKLVS
Ga0315273_122912631	3300032516	Sediment	KKLQMPGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKKP
Ga0315273_130450251	3300032516	Sediment	MPGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIVST
Ga0316604_100196235	3300033406	Soil	MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT
Ga0316604_100436161	3300033406	Soil	RKKLQMPGGQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI
Ga0316604_106763372	3300033406	Soil	LQMQGAQKLRNEAHLQVRLNDEVAAQRRRWTFNETIKVNIFINVP
Ga0316605_100370734	3300033408	Soil	MQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKI
Ga0316605_100593471	3300033408	Soil	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKLDSFLS
Ga0316605_102478182	3300033408	Soil	MQGAQKLWREAHMQVRRNDEVEAQRRRWTFHEVIKKEREHGPSS
Ga0316605_103750922	3300033408	Soil	MQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYEVINN
Ga0316605_105149151	3300033408	Soil	RFCKKLQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV
Ga0316605_105756312	3300033408	Soil	GAQNLRSAAHLPVRRNDEVAAQRRRWTFYETIKFDLANT
Ga0316605_106431823	3300033408	Soil	MQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYEIITS
Ga0316605_109591252	3300033408	Soil	MQGAQELRSGAHMQVRRNDEVEAQRRRWIFYETIMLW
Ga0316605_113510742	3300033408	Soil	MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIKN
Ga0316605_120774872	3300033408	Soil	MQGAQKLRSEPHLRVRRSDEGEAQRRGWTFYETIKKLKGGDSK
Ga0316605_121684651	3300033408	Soil	MQGALKLRNEADLLVRRNNEVAAQRRRWTFYEVILFTFSWELP
Ga0316603_100947254	3300033413	Soil	MPGAQKLWSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI
Ga0316603_103827223	3300033413	Soil	KLQMPGAQKLRSEGHLQVRRNDEVAAQSRSERDRWTFYETIK
Ga0316603_104120054	3300033413	Soil	MQGAQKLRSEAHLQVRRSDEVEVQRRRWTFYETISFHG
Ga0316603_107591672	3300033413	Soil	MQGAQKLRNAAHLQVRRNDEVEAQRSRWTFYETIKKDS
Ga0316603_112363231	3300033413	Soil	MPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYESIKFDL
Ga0316603_117360882	3300033413	Soil	MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIF
Ga0316603_119321362	3300033413	Soil	MQGAQKLRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR
Ga0316603_121955871	3300033413	Soil	MQGTQKLRSEAHLCVRRNDEVEAQRSRWTFYETIKFS
Ga0316619_101380541	3300033414	Soil	QMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK
Ga0316619_104678551	3300033414	Soil	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIK
Ga0316619_105692861	3300033414	Soil	MEGAQNLRSEAHLQVSRNDEVTAQCRRWTFYETIKNYCFLCQRGPSE
Ga0316619_110943521	3300033414	Soil	MQGAQKLRSEAHLWVRRSDVVAAQSRSERDRWTFYETISAGFSSG
Ga0316619_111060142	3300033414	Soil	MQGARKLRSEAYEPVRCNDEGEAQRGRWTFYEDIISRSRIPGSCSKA
Ga0316619_119337191	3300033414	Soil	RKKLQVQGAQKLRSEAHLQVRRNDEVAAQRRRWTFY
Ga0316619_120020931	3300033414	Soil	MQGAQKLRNEAHLLVRRNDEVAAQRRRWTFYEVLRFSWSLRPVSLSP
Ga0316622_1002494311	3300033416	Soil	QKLRSEAHLQVRRNDEVAAQSRSERDGWTFCETIKFGG
Ga0316625_1001325963	3300033418	Soil	MQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITI
Ga0316625_1010475092	3300033418	Soil	LQGTQKLRSEAHLRVRRSDEVEAQRRRWTFYETINNY
Ga0316625_1010670671	3300033418	Soil	MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYQVINFDSEFPET
Ga0316601_1000052571	3300033419	Soil	MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIFFE
Ga0316601_1004402651	3300033419	Soil	KKLQMQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYEVINN
Ga0316601_1011407061	3300033419	Soil	MQGAQKLRSEAHFQVRRNDEVAAQRRRWTFYETIKFGKAVS
Ga0316601_1018254932	3300033419	Soil	QGVQKLRSEAHLQVRRNDEVAAQRRRWTFYETINVGIQE
Ga0316601_1026013531	3300033419	Soil	MQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG
Ga0316601_1026321111	3300033419	Soil	MQGALKLRNEADLLVRRNNEVAAQRRRWTFYEVILFTFSWE
Ga0326726_100938524	3300033433	Peat Soil	LQMQGAQKLRSEAHLQVRRNDEVAAHRRWTFYEAIKKNEIN
Ga0326726_103527732	3300033433	Peat Soil	MQGAQKLRSEVHLQVRRNDEVAAQRSRWTFYETITFF
Ga0326726_104261623	3300033433	Peat Soil	QMQGAQELRREAYLRVRRNDEGEGQRRRWTFYEAIKLR
Ga0326726_111072541	3300033433	Peat Soil	MQGAQKLRSEAHSRVRRNDEVAAQRRRWTFYETIKFSEK
Ga0326726_118595903	3300033433	Peat Soil	KLQMQGAQELRSEAYLLVRCNDEVEAQRRRWTFYETIIFPSP
Ga0316613_103010142	3300033434	Soil	FREKLQLQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINKA
Ga0316620_102107973	3300033480	Soil	QMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV
Ga0316620_105001892	3300033480	Soil	MPGAQKLSSEAHFRVRRNDEVAAQRSRWTFYEIILF
Ga0316620_106488152	3300033480	Soil	MQGAQKLRSEAHVQVRRNDEVEAQRSSWTFYEAIKVA
Ga0316620_114079191	3300033480	Soil	MVSKKLQMQGAQEMRSEAYEHVRCNDEVEARRSRWTSYK
Ga0316620_119720742	3300033480	Soil	MQGAQKLRKEAHEQVRRNDEVAAQRRRRTFYETITC
Ga0316620_123285892	3300033480	Soil	MPGAQKLRSEARLQVRRNDEVEAQRRRWIFYETIKF
Ga0316600_100680311	3300033481	Soil	MPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT
Ga0316600_101464902	3300033481	Soil	MQGAQKLRSEAHLQVRRNDEVAAQSRSGRDRWTFYETIN
Ga0316600_102263681	3300033481	Soil	MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETINFLPLKKDV
Ga0316600_105283721	3300033481	Soil	MQGAQKLRNEAHLQVRLNDEVAAQRRRWTFYETIKVNIFINVP
Ga0316600_109852422	3300033481	Soil	MQGAQKLRSEAHILVRRSDEVEAQRSRWTFYEAIKIVAS
Ga0316600_110376642	3300033481	Soil	MQGAQKLRSAAHAYVRRNDEGEAQSRSERDRWACYE
Ga0316600_112010162	3300033481	Soil	KKLQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV
Ga0316627_1003935332	3300033482	Soil	MQGAQKLRSEAHLQVRRSDEVEAQRSGWTFYETINIE
Ga0316627_1004193193	3300033482	Soil	MPGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIK
Ga0316627_1004891971	3300033482	Soil	LRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKIGGI
Ga0316627_1010656641	3300033482	Soil	MQGAQKLRSEAHLRVRRSDEVEAQSRSEWDRRTFYETI
Ga0316627_1015045011	3300033482	Soil	PQMQGTQKLRSEAHISVRRNDEVEAQRSRWTFYEVI
Ga0316627_1016149321	3300033482	Soil	GAQKLRSEAHLQVRRNDEVAAQRRRWTFCETSKSVKT
Ga0316627_1022591621	3300033482	Soil	MQGAQKLRSEAHFWVCRNDEFEAPHRRETFYETIY
Ga0316627_1029067601	3300033482	Soil	QKLRSEAHNQVRRSDEVEAQSRSERDRWTFYETFNC
Ga0316629_102022691	3300033483	Soil	KLQMQGAQKLRSQAHLRVRRNDEVEAQRRRWTFYEVINFDK
Ga0316626_100382221	3300033485	Soil	KLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG
Ga0316626_100565433	3300033485	Soil	MQGAQKLRSEAYTEVRGNDEVEAQRRRWTFYGTIAKGTGP
Ga0316626_104694642	3300033485	Soil	LAPAMQGAQKLRSGAHLRVRRNDEVAAQRRRWTFYETINKA
Ga0316626_104992522	3300033485	Soil	MQGAQKLRSGAHLQVRRNNEVAAQRRRWTFYETIKN
Ga0316626_105641152	3300033485	Soil	MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKIGGI
Ga0316626_108099341	3300033485	Soil	MQGAQKLRNEAHLQVRRNDEVEAQRSRWTFYETITLDFF
Ga0316626_109577502	3300033485	Soil	MPGTQKLRSEAHLRVRRSDVVAAQSRSERDRWTFYETINFAVFTH
Ga0316626_109873171	3300033485	Soil	MQGGQKLRSEAHLRVRLSDEVEAQRRRWTFYETIKI
Ga0316626_109963302	3300033485	Soil	MQGAQKLRSEAHIWVRRKDEAAAQRRRWTFSEVITL
Ga0316624_103070632	3300033486	Soil	MQGAQKLRSEVHFQVRRNDEVEAERSRWIFYKTIRSRK
Ga0316624_112904541	3300033486	Soil	MQGAQNLKGEAYLQVRRNNEVVAQSRSERDRWTFLQ
Ga0316624_119208781	3300033486	Soil	MQGSQKLRSETYFQARCNDEVEAQRRRWTFYETIKV
Ga0316630_100161675	3300033487	Soil	KLRSEAHLQVRRNDEVAAQSRSERDGWTFCETIKFGG
Ga0316630_105749422	3300033487	Soil	MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFY
Ga0316630_105838771	3300033487	Soil	QGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETSKSVKT
Ga0316621_101669311	3300033488	Soil	GAQKLRSEAHIYVRRSDEVAAQPRSERDRWTFYRTI
Ga0316621_103368251	3300033488	Soil	MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFCETSKSVKT
Ga0316621_112627582	3300033488	Soil	MQGAQNLRSEAHLQVRRNDGVAAQRRRWTFYEVINFIDF
Ga0299912_102678581	3300033489	Soil	QMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKI
Ga0299912_103882723	3300033489	Soil	MQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIK
Ga0299912_104567041	3300033489	Soil	MKGAQKLRSEAYFHVRCNDEVEAQRSRWTFYETIEIEDNPD
Ga0316628_1013257452	3300033513	Soil	MQGAQKLRSEPHNQVRRNDEVEAQRSRWTFYEPVIFRIY
Ga0316628_1014582111	3300033513	Soil	TNHGAQKLRSEAHFQGRRSDEVAAQRHRWTFCETIKFGG
Ga0316628_1034434862	3300033513	Soil	MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYEAIKIY
Ga0316616_1002588072	3300033521	Soil	MQGAQELRSEAHLQVRRNDEVEAQRSRWTFYETIIF
Ga0316616_1003931682	3300033521	Soil	MQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKFLLPPFL
Ga0316616_1006509721	3300033521	Soil	MQGAQELRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR
Ga0316616_1012790201	3300033521	Soil	LRSEAHLQVRRNDEVAAQRSRWTFYETINFRRFSACKAF
Ga0316616_1020666711	3300033521	Soil	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVINLHF
Ga0316616_1029402981	3300033521	Soil	CKKFQMKGAQKLRSEAHLGVRRNDEVAAQRRRWTFYEAIRG
Ga0316616_1033223131	3300033521	Soil	QKLRSEAHSQVRRNDEIKAQRRRGTLYETIKEKIIPYP
Ga0316616_1037559702	3300033521	Soil	MQVAQKRKSAAHLQVRRNDEVEAQGRRWTSYETIKIDQFGR
Ga0316617_1000042173	3300033557	Soil	MQGAQKLRSEAHLGVRRNGEVEAQRRRWTFNEVIKF
Ga0316617_1006655551	3300033557	Soil	KLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYQVINFDSEFPET
Ga0316617_1014368681	3300033557	Soil	MQGTQKLRSEAHLLVRRNDEVEAQRSRWTFYETMKKGR
Ga0316617_1021193251	3300033557	Soil	MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIN
Ga0316617_1024892432	3300033557	Soil	MQGAQKLRSEAHLLVRRNDEIEAQRRRWAFYEFINL