Metagenome Family F003452

Overview

Basic Information

• Family ID: F003452
• Family Type: Metagenome
• Number of Sequences: 485
• Average Sequence Length: 46 residues
• Representative Sequence: MRNEILIPSAVAPNVYFLGPMGDPDPSDFIRQETNQIPFKQSVVDLSS
• Number of Associated Samples: 82
• Number of Associated Scaffolds: 485

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Eukaryota
• % of genes with valid RBS motifs: 4.99 %
• % of genes near scaffold ends (potentially truncated): 60.62 %
• % of genes from short scaffolds (< 2000 bps): 94.85 %
• Associated GOLD sequencing projects: 80
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Eukaryota (50.928 % of family members)
• NCBI Taxonomy ID: 2759
• Taxonomy: All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.495 % of family members)
• Environment Ontology (ENVO): Unclassified (96.701 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (96.495 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 13.16%
  β-sheet: 0.00%
  Coil/Unstructured: 86.84%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 485 Family Scaffolds
PF10536	PMD	15.67

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	51.55 %
Unclassified	root	N/A	48.45 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	51.55 %
Unclassified	root	N/A	48.45 %

Level 3

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	50.93 %
Unclassified	root	N/A	48.45 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.62 %

Level 4

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	50.93 %
Unclassified	root	N/A	48.45 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.62 %

Level 5

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	50.93 %
Unclassified	root	N/A	48.45 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.62 %

Level 6

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	0.62 %

Level 7

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	0.62 %

Level 8

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	0.62 %

Level 9

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 10

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 11

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 12

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 13

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 14

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 15

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 16

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 17

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	50.93 %
Unclassified	root	N/A	48.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	32.16 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	32.16 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	5.15 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	31.34 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	5.15 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.82 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	31.34 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	5.15 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.82 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	30.72 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	5.15 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.41 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.41 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	30.72 %
Oryza meyeriana	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana	3.30 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.41 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.41 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.82 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	29.69 %
Oryza meyeriana var. granulata	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	3.30 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.41 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.41 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	0.82 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.82 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	48.45 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	29.69 %
Oryza meyeriana var. granulata	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	3.30 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.41 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	0.41 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	0.82 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.82 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	0.62 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005354|Ga0070675_101954818	Not Available	541
3300005840|Ga0068870_10462122	Not Available	839
3300009148|Ga0105243_11452804	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	708
3300009148|Ga0105243_12449775	Not Available	561
3300009148|Ga0105243_12850899	Not Available	524
3300012070|Ga0153963_1053934	Not Available	657
3300013296|Ga0157374_12268489	Not Available	570
3300013296|Ga0157374_12358473	Not Available	559
3300013297|Ga0157378_12502719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	568
3300013297|Ga0157378_13207958	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508
3300013297|Ga0157378_13296490	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	501
3300015267|Ga0182122_1020028	Not Available	715
3300015267|Ga0182122_1024628	Not Available	677
3300015267|Ga0182122_1033342	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	625
3300015267|Ga0182122_1033598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	623
3300015267|Ga0182122_1042775	Not Available	584
3300015268|Ga0182154_1026415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	668
3300015268|Ga0182154_1032104	Not Available	635
3300015268|Ga0182154_1034748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	622
3300015268|Ga0182154_1037982	Not Available	607
3300015268|Ga0182154_1039816	Not Available	599
3300015268|Ga0182154_1041185	Not Available	594
3300015268|Ga0182154_1046309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	574
3300015268|Ga0182154_1057823	Not Available	540
3300015268|Ga0182154_1073401	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	503
3300015269|Ga0182113_1011191	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	938
3300015269|Ga0182113_1015597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	856
3300015269|Ga0182113_1030139	Not Available	714
3300015269|Ga0182113_1048063	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	624
3300015269|Ga0182113_1051857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	610
3300015269|Ga0182113_1075178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	545
3300015269|Ga0182113_1087014	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	520
3300015274|Ga0182188_1017873	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	695
3300015274|Ga0182188_1021282	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	665
3300015274|Ga0182188_1040187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	566
3300015275|Ga0182172_1011531	Not Available	845
3300015275|Ga0182172_1012617	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	826
3300015275|Ga0182172_1015778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	779
3300015275|Ga0182172_1033782	Not Available	637
3300015275|Ga0182172_1033953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	637
3300015275|Ga0182172_1036986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	622
3300015275|Ga0182172_1069366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	518
3300015275|Ga0182172_1076664	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	502
3300015276|Ga0182170_1018077	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	756
3300015276|Ga0182170_1061089	Not Available	540
3300015277|Ga0182128_1017786	Not Available	763
3300015277|Ga0182128_1036672	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	629
3300015277|Ga0182128_1047216	Not Available	586
3300015277|Ga0182128_1061587	Not Available	543
3300015277|Ga0182128_1066319	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	531
3300015277|Ga0182128_1066450	Not Available	530
3300015277|Ga0182128_1073561	Not Available	515
3300015279|Ga0182174_1014503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	829
3300015279|Ga0182174_1016040	Not Available	807
3300015279|Ga0182174_1018328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	780
3300015279|Ga0182174_1042856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	619
3300015279|Ga0182174_1044184	Not Available	613
3300015279|Ga0182174_1067001	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	543
3300015279|Ga0182174_1067345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	542
3300015279|Ga0182174_1076511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	521
3300015279|Ga0182174_1080470	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	513
3300015281|Ga0182160_1023842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	717
3300015281|Ga0182160_1025171	Not Available	707
3300015281|Ga0182160_1029839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	675
3300015281|Ga0182160_1051147	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	582
3300015281|Ga0182160_1058811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	559
3300015281|Ga0182160_1074515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	521
3300015282|Ga0182124_1008602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	936
3300015282|Ga0182124_1013384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	831
3300015282|Ga0182124_1017779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	770
3300015282|Ga0182124_1025646	Not Available	699
3300015282|Ga0182124_1033300	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	652
3300015282|Ga0182124_1051624	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	577
3300015282|Ga0182124_1054665	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	568
3300015282|Ga0182124_1057939	Not Available	558
3300015282|Ga0182124_1069615	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	529
3300015283|Ga0182156_1013641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	854
3300015283|Ga0182156_1013890	Not Available	850
3300015283|Ga0182156_1020040	Not Available	769
3300015283|Ga0182156_1026711	Not Available	711
3300015283|Ga0182156_1043155	Not Available	620
3300015283|Ga0182156_1053498	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	584
3300015285|Ga0182186_1037464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	635
3300015285|Ga0182186_1037745	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634
3300015285|Ga0182186_1059611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	555
3300015285|Ga0182186_1063515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	545
3300015285|Ga0182186_1084016	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	501
3300015285|Ga0182186_1084018	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	501
3300015286|Ga0182176_1029916	Not Available	699
3300015286|Ga0182176_1034613	Not Available	668
3300015286|Ga0182176_1067887	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	542
3300015286|Ga0182176_1069361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	538
3300015286|Ga0182176_1080595	Not Available	513
3300015287|Ga0182171_1029330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	691
3300015287|Ga0182171_1033168	Not Available	668
3300015287|Ga0182171_1033788	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	665
3300015287|Ga0182171_1046872	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	608
3300015287|Ga0182171_1055523	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	579
3300015287|Ga0182171_1079820	Not Available	519
3300015288|Ga0182173_1004308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1145
3300015288|Ga0182173_1005836	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1055
3300015288|Ga0182173_1033623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	660
3300015288|Ga0182173_1073798	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	527
3300015288|Ga0182173_1073987	Not Available	527
3300015289|Ga0182138_1018651	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	782
3300015289|Ga0182138_1026788	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	710
3300015289|Ga0182138_1031517	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	679
3300015289|Ga0182138_1053844	Not Available	584
3300015289|Ga0182138_1077489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	525
3300015289|Ga0182138_1086513	Not Available	507
3300015291|Ga0182125_1021800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	768
3300015291|Ga0182125_1045935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	624
3300015291|Ga0182125_1060224	Not Available	577
3300015291|Ga0182125_1067002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	558
3300015291|Ga0182125_1070100	Not Available	551
3300015291|Ga0182125_1072380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	545
3300015292|Ga0182141_1033703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	679
3300015292|Ga0182141_1059776	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	577
3300015292|Ga0182141_1060010	Not Available	576
3300015292|Ga0182141_1073020	Not Available	543
3300015294|Ga0182126_1044087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	634
3300015294|Ga0182126_1057868	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	586
3300015295|Ga0182175_1048394	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	623
3300015295|Ga0182175_1089277	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	518
3300015295|Ga0182175_1097602	Not Available	503
3300015296|Ga0182157_1029516	Not Available	727
3300015296|Ga0182157_1033195	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	704
3300015296|Ga0182157_1036031	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	687
3300015296|Ga0182157_1049016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	630
3300015296|Ga0182157_1058179	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	600
3300015296|Ga0182157_1058806	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	598
3300015296|Ga0182157_1090527	Not Available	524
3300015296|Ga0182157_1102007	Not Available	504
3300015298|Ga0182106_1011009	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	967
3300015298|Ga0182106_1015211	Not Available	882
3300015298|Ga0182106_1033661	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	702
3300015298|Ga0182106_1043541	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	652
3300015299|Ga0182107_1059878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	598
3300015300|Ga0182108_1024599	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	777
3300015300|Ga0182108_1029200	Not Available	740
3300015300|Ga0182108_1039323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	680
3300015300|Ga0182108_1039871	Not Available	678
3300015300|Ga0182108_1049807	Not Available	635
3300015300|Ga0182108_1071075	Not Available	571
3300015300|Ga0182108_1089354	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	532
3300015300|Ga0182108_1101218	Not Available	511
3300015302|Ga0182143_1018361	Not Available	833
3300015302|Ga0182143_1023230	Not Available	780
3300015302|Ga0182143_1042502	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	659
3300015302|Ga0182143_1043716	Not Available	654
3300015302|Ga0182143_1068985	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	572
3300015302|Ga0182143_1072874	Not Available	562
3300015302|Ga0182143_1075618	Not Available	556
3300015302|Ga0182143_1104330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	502
3300015303|Ga0182123_1004622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1164
3300015303|Ga0182123_1039920	Not Available	653
3300015303|Ga0182123_1045582	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	630
3300015303|Ga0182123_1063992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	572
3300015303|Ga0182123_1091795	Not Available	514
3300015303|Ga0182123_1094995	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508
3300015303|Ga0182123_1099596	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	501
3300015304|Ga0182112_1085989	Not Available	537
3300015304|Ga0182112_1086806	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	535
3300015304|Ga0182112_1093354	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300015305|Ga0182158_1034443	Not Available	698
3300015305|Ga0182158_1038395	Not Available	677
3300015305|Ga0182158_1038930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	674
3300015305|Ga0182158_1042116	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	660
3300015305|Ga0182158_1050211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	627
3300015305|Ga0182158_1050289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	627
3300015305|Ga0182158_1051854	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	622
3300015305|Ga0182158_1057674	Not Available	603
3300015305|Ga0182158_1058475	Not Available	600
3300015305|Ga0182158_1059353	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	598
3300015305|Ga0182158_1065362	Not Available	581
3300015305|Ga0182158_1086141	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	534
3300015305|Ga0182158_1106075	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	500
3300015307|Ga0182144_1054654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	620
3300015307|Ga0182144_1063663	Not Available	593
3300015307|Ga0182144_1067470	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	583
3300015308|Ga0182142_1006448	Not Available	1157
3300015308|Ga0182142_1019309	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	853
3300015308|Ga0182142_1030350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	750
3300015308|Ga0182142_1038885	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	698
3300015308|Ga0182142_1048480	Not Available	655
3300015308|Ga0182142_1075751	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	573
3300015308|Ga0182142_1098947	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	528
3300015314|Ga0182140_1014454	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	922
3300015314|Ga0182140_1033563	Not Available	730
3300015314|Ga0182140_1040982	Not Available	690
3300015314|Ga0182140_1044448	Not Available	674
3300015314|Ga0182140_1048182	Not Available	658
3300015314|Ga0182140_1057554	Not Available	625
3300015314|Ga0182140_1074460	Not Available	578
3300015314|Ga0182140_1085023	Not Available	555
3300015314|Ga0182140_1117512	Not Available	500
3300015321|Ga0182127_1048784	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	674
3300015321|Ga0182127_1058051	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	640
3300015321|Ga0182127_1077591	Not Available	586
3300015321|Ga0182127_1080151	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	580
3300015321|Ga0182127_1104507	Not Available	532
3300015321|Ga0182127_1107124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	528
3300015322|Ga0182110_1016535	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	917
3300015322|Ga0182110_1027573	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	794
3300015322|Ga0182110_1040587	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	709
3300015322|Ga0182110_1059315	Not Available	634
3300015322|Ga0182110_1106278	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	529
3300015323|Ga0182129_1023234	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	809
3300015323|Ga0182129_1023851	Not Available	803
3300015323|Ga0182129_1061815	Not Available	609
3300015323|Ga0182129_1063261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	605
3300015323|Ga0182129_1086045	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	551
3300015323|Ga0182129_1086592	Not Available	550
3300015323|Ga0182129_1091833	Not Available	541
3300015323|Ga0182129_1115948	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	502
3300015323|Ga0182129_1117646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	500
3300015341|Ga0182187_1015699	Not Available	1180
3300015341|Ga0182187_1048129	Not Available	827
3300015341|Ga0182187_1061289	Not Available	764
3300015341|Ga0182187_1074283	Not Available	716
3300015341|Ga0182187_1087045	Not Available	677
3300015341|Ga0182187_1143725	Not Available	568
3300015341|Ga0182187_1177832	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	525
3300015341|Ga0182187_1187093	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	515
3300015342|Ga0182109_1105432	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	667
3300015342|Ga0182109_1116862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	642
3300015342|Ga0182109_1144368	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	594
3300015342|Ga0182109_1150674	Not Available	585
3300015342|Ga0182109_1157500	Not Available	575
3300015342|Ga0182109_1161657	Not Available	569
3300015342|Ga0182109_1174959	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	552
3300015342|Ga0182109_1207135	Not Available	517
3300015343|Ga0182155_1040111	Not Available	923
3300015343|Ga0182155_1120889	Not Available	633
3300015343|Ga0182155_1137988	Not Available	603
3300015343|Ga0182155_1173584	Not Available	554
3300015343|Ga0182155_1181207	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	545
3300015343|Ga0182155_1201055	Not Available	524
3300015343|Ga0182155_1203570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	522
3300015343|Ga0182155_1218738	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508
3300015344|Ga0182189_1106213	Not Available	670
3300015344|Ga0182189_1134909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	615
3300015344|Ga0182189_1156724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	582
3300015344|Ga0182189_1165711	Not Available	569
3300015345|Ga0182111_1043869	Not Available	952
3300015345|Ga0182111_1050180	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	908
3300015345|Ga0182111_1067922	Not Available	815
3300015345|Ga0182111_1074240	Not Available	789
3300015345|Ga0182111_1117043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	668
3300015345|Ga0182111_1150274	Not Available	608
3300015345|Ga0182111_1182582	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	564
3300015345|Ga0182111_1184058	Not Available	562
3300015345|Ga0182111_1210651	Not Available	533
3300015345|Ga0182111_1213356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	531
3300015345|Ga0182111_1214858	Not Available	529
3300015345|Ga0182111_1222700	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	522
3300015345|Ga0182111_1237389	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	508
3300015345|Ga0182111_1241497	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	504
3300015345|Ga0182111_1242970	Not Available	503
3300015346|Ga0182139_1055527	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	877
3300015346|Ga0182139_1059350	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	857
3300015346|Ga0182139_1087473	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	745
3300015346|Ga0182139_1096204	Not Available	719
3300015346|Ga0182139_1097382	Not Available	716
3300015346|Ga0182139_1143803	Not Available	619
3300015346|Ga0182139_1169533	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581
3300015346|Ga0182139_1175084	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	574
3300015346|Ga0182139_1182845	Not Available	564
3300015346|Ga0182139_1187464	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	559
3300015346|Ga0182139_1188966	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557
3300015346|Ga0182139_1223897	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	521
3300015346|Ga0182139_1244804	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	502
3300015347|Ga0182177_1096539	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	721
3300015347|Ga0182177_1103892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	701
3300015347|Ga0182177_1128290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	648
3300015347|Ga0182177_1144417	Not Available	620
3300015347|Ga0182177_1152565	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	608
3300015347|Ga0182177_1175624	Not Available	576
3300015347|Ga0182177_1183817	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	566
3300015347|Ga0182177_1185276	Not Available	564
3300015347|Ga0182177_1211428	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	536
3300015347|Ga0182177_1217476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	530
3300015347|Ga0182177_1223388	Not Available	524
3300015347|Ga0182177_1232624	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	516
3300015347|Ga0182177_1237449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	512
3300015347|Ga0182177_1238408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	511
3300015351|Ga0182161_1139398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	652
3300015351|Ga0182161_1158899	Not Available	620
3300015351|Ga0182161_1192838	Not Available	574
3300015351|Ga0182161_1235077	Not Available	529
3300015351|Ga0182161_1253487	Not Available	513
3300015351|Ga0182161_1268295	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	501
3300015355|Ga0182159_1001478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	3229
3300015355|Ga0182159_1098616	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	863
3300015355|Ga0182159_1129011	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	773
3300015355|Ga0182159_1164002	Not Available	699
3300015355|Ga0182159_1172852	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	684
3300015355|Ga0182159_1174607	Not Available	681
3300015355|Ga0182159_1200808	Not Available	642
3300015355|Ga0182159_1252568	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581
3300015355|Ga0182159_1263112	Not Available	570
3300015355|Ga0182159_1263537	Not Available	570
3300015355|Ga0182159_1268861	Not Available	565
3300015355|Ga0182159_1270765	Not Available	563
3300015355|Ga0182159_1298031	Not Available	540
3300015355|Ga0182159_1306307	Not Available	534
3300015355|Ga0182159_1313150	Not Available	528
3300015361|Ga0182145_1080632	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	676
3300015361|Ga0182145_1112651	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	604
3300015361|Ga0182145_1143387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	557
3300015361|Ga0182145_1187778	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	508
3300015361|Ga0182145_1190398	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	506
3300017404|Ga0182203_1030690	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	852
3300017404|Ga0182203_1102768	Not Available	587
3300017404|Ga0182203_1120702	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	557
3300017404|Ga0182203_1145275	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	523
3300017404|Ga0182203_1157249	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509
3300017404|Ga0182203_1159550	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	507
3300017407|Ga0182220_1011160	Not Available	928
3300017407|Ga0182220_1035754	Not Available	684
3300017407|Ga0182220_1039792	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	665
3300017409|Ga0182204_1004223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1326
3300017409|Ga0182204_1014778	Not Available	931
3300017409|Ga0182204_1017116	Not Available	894
3300017409|Ga0182204_1037511	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	713
3300017409|Ga0182204_1048953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	659
3300017409|Ga0182204_1063214	Not Available	612
3300017409|Ga0182204_1074970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	581
3300017409|Ga0182204_1103555	Not Available	526
3300017409|Ga0182204_1121259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	500
3300017410|Ga0182207_1037304	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	836
3300017410|Ga0182207_1050066	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	762
3300017410|Ga0182207_1106640	Not Available	597
3300017410|Ga0182207_1109852	Not Available	592
3300017410|Ga0182207_1130438	Not Available	558
3300017410|Ga0182207_1135079	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	551
3300017411|Ga0182208_1026800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	809
3300017411|Ga0182208_1073627	Not Available	601
3300017411|Ga0182208_1077458	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	591
3300017411|Ga0182208_1082662	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	580
3300017411|Ga0182208_1095533	Not Available	554
3300017411|Ga0182208_1120276	Not Available	514
3300017413|Ga0182222_1039321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	654
3300017413|Ga0182222_1046195	Not Available	628
3300017413|Ga0182222_1049267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	618
3300017413|Ga0182222_1060126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	587
3300017413|Ga0182222_1062192	Not Available	582
3300017413|Ga0182222_1070376	Not Available	563
3300017413|Ga0182222_1077297	Not Available	549
3300017413|Ga0182222_1078390	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	547
3300017413|Ga0182222_1090054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	528
3300017415|Ga0182202_1009494	Not Available	1136
3300017415|Ga0182202_1013419	Not Available	1026
3300017415|Ga0182202_1097709	Not Available	565
3300017415|Ga0182202_1099714	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	561
3300017415|Ga0182202_1122017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	525
3300017417|Ga0182230_1062839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	659
3300017417|Ga0182230_1114435	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506
3300017417|Ga0182230_1117672	Not Available	500
3300017420|Ga0182228_1035453	Not Available	818
3300017420|Ga0182228_1061284	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	661
3300017420|Ga0182228_1105343	Not Available	542
3300017420|Ga0182228_1106027	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	541
3300017424|Ga0182219_1057588	Not Available	663
3300017424|Ga0182219_1062589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	646
3300017424|Ga0182219_1077579	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	605
3300017424|Ga0182219_1080591	Not Available	598
3300017424|Ga0182219_1096551	Not Available	566
3300017424|Ga0182219_1105327	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	551
3300017424|Ga0182219_1119961	Not Available	528
3300017424|Ga0182219_1133706	Not Available	510
3300017425|Ga0182224_1074730	Not Available	649
3300017425|Ga0182224_1093531	Not Available	605
3300017425|Ga0182224_1098100	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	596
3300017425|Ga0182224_1101880	Not Available	589
3300017425|Ga0182224_1125569	Not Available	551
3300017427|Ga0182190_1023364	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	965
3300017427|Ga0182190_1029447	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	897
3300017427|Ga0182190_1052951	Not Available	740
3300017427|Ga0182190_1080271	Not Available	644
3300017427|Ga0182190_1089050	Not Available	622
3300017427|Ga0182190_1097846	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	602
3300017427|Ga0182190_1103339	Not Available	591
3300017427|Ga0182190_1113159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	573
3300017427|Ga0182190_1128369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	549
3300017427|Ga0182190_1129712	Not Available	547
3300017427|Ga0182190_1137760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	535
3300017427|Ga0182190_1154975	Not Available	513
3300017430|Ga0182192_1064390	Not Available	708
3300017430|Ga0182192_1064538	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	708
3300017430|Ga0182192_1079783	Not Available	658
3300017430|Ga0182192_1103554	Not Available	602
3300017430|Ga0182192_1125904	Not Available	563
3300017430|Ga0182192_1135858	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	548
3300017430|Ga0182192_1152202	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	526
3300017433|Ga0182206_1045095	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	750
3300017433|Ga0182206_1106013	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	573
3300017436|Ga0182209_1039106	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	805
3300017436|Ga0182209_1058681	Not Available	711
3300017436|Ga0182209_1130790	Not Available	552
3300017438|Ga0182191_1046918	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	789
3300017438|Ga0182191_1076718	Not Available	673
3300017438|Ga0182191_1104408	Not Available	608
3300017438|Ga0182191_1112625	Not Available	593
3300017438|Ga0182191_1135964	Not Available	557
3300017438|Ga0182191_1146405	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	543
3300017438|Ga0182191_1173326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	512
3300017438|Ga0182191_1178613	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	506
3300017442|Ga0182221_1064783	Not Available	678
3300017442|Ga0182221_1086243	Not Available	622
3300017442|Ga0182221_1099217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	596
3300017442|Ga0182221_1111827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	574
3300017442|Ga0182221_1128138	Not Available	550
3300017443|Ga0182193_1089790	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	659
3300017443|Ga0182193_1097814	Not Available	641
3300017443|Ga0182193_1130210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	581
3300017443|Ga0182193_1153345	Not Available	549
3300017443|Ga0182193_1157840	Not Available	544
3300017443|Ga0182193_1183919	Not Available	515
3300017680|Ga0182233_1055834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	699
3300017680|Ga0182233_1076689	Not Available	603
3300017682|Ga0182229_1078419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	572
3300017683|Ga0182218_1037651	Not Available	771
3300017683|Ga0182218_1056864	Not Available	682
3300017683|Ga0182218_1059016	Not Available	675
3300017683|Ga0182218_1067050	Not Available	650
3300017683|Ga0182218_1077249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	623
3300017683|Ga0182218_1079332	Not Available	617
3300017683|Ga0182218_1101496	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	572
3300017683|Ga0182218_1111380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	556
3300017683|Ga0182218_1116585	Not Available	548
3300017683|Ga0182218_1147512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	509
3300017684|Ga0182225_1028957	Not Available	827
3300017684|Ga0182225_1029144	Not Available	826
3300017684|Ga0182225_1037348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	765
3300017684|Ga0182225_1049743	Not Available	699
3300017684|Ga0182225_1053647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	683
3300017684|Ga0182225_1062865	Not Available	650
3300017684|Ga0182225_1076885	Not Available	612
3300017684|Ga0182225_1084158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	595
3300017684|Ga0182225_1101342	Not Available	562
3300017684|Ga0182225_1106454	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	553
3300017684|Ga0182225_1137554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	510
3300017685|Ga0182227_1098494	Not Available	568
3300017686|Ga0182205_1061195	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	709
3300017686|Ga0182205_1107668	Not Available	589
3300017686|Ga0182205_1117578	Not Available	572
3300017689|Ga0182231_1030462	Not Available	1003
3300017689|Ga0182231_1052204	Not Available	768
3300017689|Ga0182231_1097469	Not Available	566
3300017690|Ga0182223_1040792	Not Available	683
3300017690|Ga0182223_1063943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	605
3300017690|Ga0182223_1075042	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	579
3300017690|Ga0182223_1114047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza meyeriana → Oryza meyeriana var. granulata	515
3300017690|Ga0182223_1114418	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	515
3300017690|Ga0182223_1122379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	505
3300025899|Ga0207642_10881860	Not Available	572
3300025908|Ga0207643_10899395	Not Available	574
3300025935|Ga0207709_11384955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	582
3300025942|Ga0207689_10549037	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	970
3300026089|Ga0207648_12215216	Not Available	510

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.79%
Fungi	Host-Associated → Fungi	0.21%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.03%
Mycelium	Host-Associated → Fungi → Mycelium	0.21%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.06%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.03%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.21%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.21%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.49%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.06%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.21%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.21%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.49%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.03%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.21%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.21%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300012070	Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070675_1019548181	3300005354	Miscanthus Rhizosphere	MRNEILIPSAVVPNTYYLGPMGDPDPSDFITKKPTESPSNN
Ga0068870_104621222	3300005840	Miscanthus Rhizosphere	MRNEILISSAAVPNAYFLGPVGDSDPSDFIRQETNQIPF
Ga0105243_114528042	3300009148	Miscanthus Rhizosphere	MRNEILIPSAVASNVYFLGPMGDSDPSDFIRQETNQIPFKESAVDLSSWTIKTPFKN*
Ga0105243_124497751	3300009148	Miscanthus Rhizosphere	MRNEILIPLAAVPNVYFLRAMGDPDPSDFILQETNQIPFK*
Ga0105243_128508991	3300009148	Miscanthus Rhizosphere	ISLEMRNEILIPSAVSPIIYFLGPMGDLDPSDFIR*
Ga0153963_10539341	3300012070	Attine Ant Fungus Gardens	VLRNDILIPLKDIPDTYYLGPMGDPILKDFIVQETNQFP
Ga0157374_122684891	3300013296	Miscanthus Rhizosphere	MRNEILIPSAIASNVYFLRPMGDPDPSDFIYQETNQNPFKQSVVI
Ga0157374_123584732	3300013296	Miscanthus Rhizosphere	LIPSAVVPNTYYLRPMGDPNPSDFINQETNQIPFKQSVIDLSSWNTKTPFRN*
Ga0157378_125027191	3300013297	Miscanthus Rhizosphere	LIPLAIVPNVYFLRPMGDPDPYDFIRQEINQIPFKQSAVDSSS*
Ga0157378_132079581	3300013297	Miscanthus Rhizosphere	MRNKILIPSAVAPNVCFLGPMGDPDPFDFIHQETNQIPFKQSVVDLSS*
Ga0157378_132964901	3300013297	Miscanthus Rhizosphere	MRNKILIPSAVVPNTYYLGPMGDPDLSDFINQETNRIPFKQSVIDLSS
Ga0157376_106803253	3300014969	Miscanthus Rhizosphere	MENEILIPSFVVPNAYYLGPMGDANPSDFINQETNQIPFR*
Ga0182122_10200281	3300015267	Miscanthus Phyllosphere	MKNEILISLVVVPNAYYLGPMSDPESSDFINQETNRIPFKQSEVDLSS*
Ga0182122_10246281	3300015267	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDSDLFDFIHQEINQIPFKQS
Ga0182122_10333421	3300015267	Miscanthus Phyllosphere	IPSVATPNVYFLGPMGDPDPSDFVCQETNQIPFKQSAVIC*
Ga0182122_10335981	3300015267	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPSDFIYQETNQILFKQSVVDLSSWNTKTIFRNWPKMPKG*
Ga0182122_10427751	3300015267	Miscanthus Phyllosphere	MRNKILIPSAIASNVYFLEPMGDPDLSDFIHQETNQIPFKQYVVDPSSCNTKTPFRN*
Ga0182122_10600051	3300015267	Miscanthus Phyllosphere	MENEIMIPSSIVPNAYYLGPMGDANPSDFISQETNQIPFRQSLADLSS*
Ga0182154_10264152	3300015268	Miscanthus Phyllosphere	MRNEILIPSAIVPNVYFLGPIGDPDPSDFIRQETNQIHFKQFVVDSFSWNK
Ga0182154_10321042	3300015268	Miscanthus Phyllosphere	MRNDILIQSAVVPNVYLLGPMGDPDPSDFIHQETNQIPFK*
Ga0182154_10347481	3300015268	Miscanthus Phyllosphere	LIPSAIVPNTYYLGPMGDPDPSDFINQETNQIPFKQSVIDLSSWNTKTLFRN*
Ga0182154_10379821	3300015268	Miscanthus Phyllosphere	MRNKILISSAVASNVYFLRPMGDANPSDFIHQKTNQIPFKQSV
Ga0182154_10398161	3300015268	Miscanthus Phyllosphere	MRNEILISSAVASNIYYLGSMGDPDLSDFISQETN*ISFKQSIVDLSSWNTK
Ga0182154_10411851	3300015268	Miscanthus Phyllosphere	MRNEILIPSAIAPNIYFRGPMGDPDPSDFIHQETNQI
Ga0182154_10456501	3300015268	Miscanthus Phyllosphere	MENEILIPSSIVPNAYYLGPMGDANPSDFINQKTNQIPFRQSL
Ga0182154_10463092	3300015268	Miscanthus Phyllosphere	MRNETLIPSAVVPNAYFLGHMGDPDPSDFIRQETNQIPFKQSTVDSSS*
Ga0182154_10578231	3300015268	Miscanthus Phyllosphere	IRNEILIPSAVASNVYFLGPMGDPDPSDFIRQETN*
Ga0182154_10734012	3300015268	Miscanthus Phyllosphere	MRNEILIPSVVASNVYFLGPMGDLDPSDFIHQETNQIPFKQSAVDLS
Ga0182113_10111911	3300015269	Miscanthus Phyllosphere	MRNEILITSAVAPNIYFLGPMGDPDPSDFIRQETNQIPFKQSTVDLSSWNTKTLFRN*
Ga0182113_10155971	3300015269	Miscanthus Phyllosphere	MRNKILIPSVVVPNAYYLGPMGDPDPSNFINQETSRIPFKQ
Ga0182113_10301391	3300015269	Miscanthus Phyllosphere	MRNDILILSAVAPNVYFLGPVGDPDPSDFVYQETNQISFKQYAVDLSS*
Ga0182113_10480631	3300015269	Miscanthus Phyllosphere	MRNEILIPSVVASNVYFLGPMGDHDPSDFMYQEINQIPFKQSAV
Ga0182113_10518572	3300015269	Miscanthus Phyllosphere	MKNEILIPSSVVPNAYYLGPMGDVDPLDFIKQETNQIPFRQSLVDLSSRNN
Ga0182113_10751782	3300015269	Miscanthus Phyllosphere	MRNEILIPSAIAPNVYFLGPMGYPDPSNFICQETNQIPFKQSIVG
Ga0182113_10870142	3300015269	Miscanthus Phyllosphere	EILIPSVVASNVYFLGPIGDPNPSNFIHQETNQIPFKQSIVDSSS*
Ga0182188_10178731	3300015274	Miscanthus Phyllosphere	MRNEILIPLATVPNAYFLGPMGDFDPSDFICQETNEIPFK*
Ga0182188_10212821	3300015274	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLGPMGDPDPSDFIRQETNQIPFKQYVVDLSSCN
Ga0182188_10401871	3300015274	Miscanthus Phyllosphere	MKNEILIPMSVVPKAYYLGPMGDADPLDFIKQETNQIPFRQSLVDLSS
Ga0182172_10115311	3300015275	Miscanthus Phyllosphere	MRNEILIPSTVAPNVYYLGHMGDPDPSDFISQETNRIPFKQSVVDLF
Ga0182172_10126171	3300015275	Miscanthus Phyllosphere	MRNKILIPSAAASNVYFLGPMGDPDPSDFIRQETNQIPFKQSVVDLSSWSTKTTLKN*
Ga0182172_10157782	3300015275	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLRPMGDPDPSDFINQETNQIPFKQSVVDLSS*
Ga0182172_10337821	3300015275	Miscanthus Phyllosphere	MRNKILIPSTVASNVYFLGPMGDPDPSSFIRQETNQIPF
Ga0182172_10339531	3300015275	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLGPMGDPDPSDFICQETNQIPFKRSIVDLSS*
Ga0182172_10369861	3300015275	Miscanthus Phyllosphere	MRNEILIPSAVASNIYFLGPMGDPDPSNFIRQETNQIPFKQSAIDLSS
Ga0182172_10693661	3300015275	Miscanthus Phyllosphere	MRNEILITSAVASNVYFLGPMGDLDPSDFIRQETNQIPFKQSAVDL
Ga0182172_10766641	3300015275	Miscanthus Phyllosphere	MKNEILIPSSVISNAYYLGPMGDTNPSDFINQETNEIPFRQSLVDLSSWNTKNPFRN*
Ga0182170_10180771	3300015276	Miscanthus Phyllosphere	MRNEILNPLAVVPNAYFLGPMGDSDPSDFIRQETNQIPFKQSVVDSSS*
Ga0182170_10610891	3300015276	Miscanthus Phyllosphere	MRNEILIPSAVIPNAYFLGPMGDPNPSDFIHQETNKIPFKQSAVDLSS*
Ga0182128_10177862	3300015277	Miscanthus Phyllosphere	MRNEILIPSTIASNVYFLGPMGDPYPYDFIRQETNQILFKQSTVDLFS*
Ga0182128_10366721	3300015277	Miscanthus Phyllosphere	MRNEILIPSAIASNIYFLGPMGDPDPSDFIRQETNQIPFK*
Ga0182128_10472072	3300015277	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYIGPMGDDNPSDFINQETNQIPFRQSLVDLSSWNIKNPFRN*
Ga0182128_10472161	3300015277	Miscanthus Phyllosphere	MRNKILIPSAVVPNTYYLGPMGDPDLSDFINQETN
Ga0182128_10615872	3300015277	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLEPMGDPNASDFINQETNLILFKQSVI
Ga0182128_10663191	3300015277	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPSDFIRQETNQIPFKQSAVDLSSWNTKTPFKNWPKMPKGW
Ga0182128_10664502	3300015277	Miscanthus Phyllosphere	NKILIPSTVTSNVYFLGPMGDPDSSDFIRQETNQIPFK*
Ga0182128_10735611	3300015277	Miscanthus Phyllosphere	IPSAVAPNVYFFRPVGDPDPSDYIHQEINRIPSNNL*
Ga0182174_10145031	3300015279	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLGPMCDPDPSDFINQETNQIPFKQSVIDLSS*
Ga0182174_10160401	3300015279	Miscanthus Phyllosphere	MRNKILIPSAVVPKAYYLGPMGDPDPSDFINQETNQISFKQSVIDLSS*
Ga0182174_10183281	3300015279	Miscanthus Phyllosphere	MKNEILIPSVVVPNAYFLGPMGDPDPSDFIYQETHHIPFKRSIVDLSSWNKTPF
Ga0182174_10428561	3300015279	Miscanthus Phyllosphere	MRNEILIPSAFAPNVYFLGPMGDPDPSNFIYQETNQIPFKQSVVDSSS
Ga0182174_10441842	3300015279	Miscanthus Phyllosphere	MRNEILIPSAIASNVYFLGPMGDPDPSDFIHQETN
Ga0182174_10670011	3300015279	Miscanthus Phyllosphere	MENEILIPLSVIPNAYYLGPMGDTNPSDFINQEINQIPFR*
Ga0182174_10673451	3300015279	Miscanthus Phyllosphere	MRNKILIPSAIAPNVYFLGPMSDPDPSDFIHQETNQIPFKQSVVDLSSWNTKTPFRN*
Ga0182174_10765111	3300015279	Miscanthus Phyllosphere	MRNEILISSAVAPNVYFLRPMGDPDPSDFISQETNRILFKQSAVDLSS*
Ga0182174_10804701	3300015279	Miscanthus Phyllosphere	MRNEILIPSAIASNVYFIGPMGDPNPSDFIHQENNQIPFKQSIVDLSYWNTKTLFRN*
Ga0182160_10238421	3300015281	Miscanthus Phyllosphere	MRNEILIPSAVSPNIYFLGPMGDPDPSDFIRQETNQISFKQSTVDLSSWN
Ga0182160_10251711	3300015281	Miscanthus Phyllosphere	MRNEILIPSAVAPSVYFLGPMGDPDPSDFIRQETNQI
Ga0182160_10298392	3300015281	Miscanthus Phyllosphere	MRNEILIALAVALNVYFLGPMGDSDPSDFIRQETNQIPFKQSVVDLSS*
Ga0182160_10511471	3300015281	Miscanthus Phyllosphere	MRNKILIPSAVASNVYFLGPMGDPDPFDFIHQETNQIPFK*
Ga0182160_10588112	3300015281	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLGPMGDLDPSDFIRQETNQIPFKQSIVDSSSWNKTPFK
Ga0182160_10745152	3300015281	Miscanthus Phyllosphere	MRNKILIPSAIVPNTYYLGPMGDPDPSDFINQETN*
Ga0182124_10086021	3300015282	Miscanthus Phyllosphere	MRNEILIPLAVAPNVYFLRPMGDPDPSNFICQETNRIPFKQSIVDLSS
Ga0182124_10133842	3300015282	Miscanthus Phyllosphere	MRNEILIPSAIAPNVYFLGPMGDPDPSDFICQETNQIPFK
Ga0182124_10177791	3300015282	Miscanthus Phyllosphere	MRNEILISSVVASNIYFLGPMGDPDPSDFIHQDTNQIPFEQSAVDLSSWNTMTPFRN*
Ga0182124_10256461	3300015282	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLGPMCDPDPSDFINQETNQIPFKQSVIDLSF*
Ga0182124_10333001	3300015282	Miscanthus Phyllosphere	MKKEILIPSAIVPNAYYLGPMGDPDPSDFINQETN*
Ga0182124_10516242	3300015282	Miscanthus Phyllosphere	IPSAIIPNVYYLGPMGDPDLSNFINQETNRIPFKQSVVDLSWNTKTPFRN*
Ga0182124_10546651	3300015282	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLRPMGDPDPSNFINKETNRIPFKQSVIDLSPPPKP*
Ga0182124_10579391	3300015282	Miscanthus Phyllosphere	ILIPSAIAPHVNFLGPMGDPDPSDFIHQETNLIPFKQSIVDLSSWNTKTPFKN*
Ga0182124_10696152	3300015282	Miscanthus Phyllosphere	MRNEILISSVVVPNVYYLGPMGNPNPSDFINQETNQITFKQSVVDLS
Ga0182156_10136411	3300015283	Miscanthus Phyllosphere	SAIAPNVYFLGPMGDPDLSDFIYQETNQIPFKQSIVGSSSWNAKTPFTNWPKMPRR*
Ga0182156_10138902	3300015283	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGSMGDPDSSDFIRQETNQIPFKQSAVDLSSWNTKTPFRNWSKMPKGWRD*
Ga0182156_10200401	3300015283	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLGPMGDLDPSDFINKETNQIPFKQSVIDLSSN*
Ga0182156_10267111	3300015283	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLEPMGDPDPSDFINQETNRIPFKQSIVDLSS*
Ga0182156_10317012	3300015283	Miscanthus Phyllosphere	MENEILIPSSLVPNAYYLGPMGDTNPLDFINQETNQIPFR*
Ga0182156_10419312	3300015283	Miscanthus Phyllosphere	MENKILIPSSVVPNAYYLGPMGDANPSDFINQETNKIPFRQSLVDLSSWNTKNPFRN*
Ga0182156_10431551	3300015283	Miscanthus Phyllosphere	MRNEILIPSVVVPDTYYLGPMGDPNPSDFINQEINRISFKQSVIDLSF*
Ga0182156_10534981	3300015283	Miscanthus Phyllosphere	MKNEILVPSAVAPNVYFLRPMGDPDPSDFIHQETNQIPFKQSVVDLSSWNTKTPFKN*
Ga0182186_10374642	3300015285	Miscanthus Phyllosphere	MRNEILIPSAIVPNVYFLGPMCDPDPSDFIHQETNQIPFKQSIVDSSSWNK
Ga0182186_10377451	3300015285	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLGPMGDPNPSDFICQETHQIPFKRSAVDLS
Ga0182186_10596111	3300015285	Miscanthus Phyllosphere	MIPSAIIPNAYFLGPMGDPDPSDFIRQETNQIPFKQSMVDLSTWNTKTS
Ga0182186_10635151	3300015285	Miscanthus Phyllosphere	EILIPSVVVPNAYFLGPMGDPDPSDFIRKETNQIPFK*
Ga0182186_10840162	3300015285	Miscanthus Phyllosphere	MRNEILIPSVVVLNVYFLGPMGDPDPSDFIRQETNQIPFKQSAVDLSS*
Ga0182186_10840183	3300015285	Miscanthus Phyllosphere	VVVPSAYYLRPMGNPDPSNFINQETNRIPFKQFVIDLWNIKTPFSKLTQYA*
Ga0182176_10299161	3300015286	Miscanthus Phyllosphere	MRNEILIPSAAVPNAYFLRPMGDSDPSNFIRQETNQIPFKQSIVDSSS*
Ga0182176_10346133	3300015286	Miscanthus Phyllosphere	VYFLGPMGNPDPSDFIYQETNQISFKQSVVDSSS*
Ga0182176_10678871	3300015286	Miscanthus Phyllosphere	MRNEILIPLVVAPNVYFLGPMGDLDPSDFICQETNQIPFK
Ga0182176_10693611	3300015286	Miscanthus Phyllosphere	MRNEILIPLVVVLNTYYLGPMGDPDLSDFINQETNRIPFKQSVIDLSS*
Ga0182176_10805951	3300015286	Miscanthus Phyllosphere	MRNEILIPLAVVPNVYFLGPMGDPDPSDFINQETNQIPFKQSVVDSSS*
Ga0182171_10293302	3300015287	Miscanthus Phyllosphere	MRNEILIPSASAPNVYFLGPMGDLDPSDFICQETNQIPFKQSVVDSSSK
Ga0182171_10331681	3300015287	Miscanthus Phyllosphere	MRNEILIPSVAVPNAYFLGPMGDSDPSDFIRQETNQIPFKQSVVDSSS*
Ga0182171_10337882	3300015287	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYFLGPMGDPDPSDFIHQETNQIPFKQSVVDSSS*
Ga0182171_10468721	3300015287	Miscanthus Phyllosphere	MRNKILIPSAVVPNAYYLGPMGDPDPSDFINQETNQIPFKQSIVDLSSWNTKTPFRN*
Ga0182171_10555231	3300015287	Miscanthus Phyllosphere	MRNKILIPSAVAPNIYFLGPMGDLDPSDFIRQETNQIPFKQSAVDLSSWNTKTLFGY*
Ga0182171_10798201	3300015287	Miscanthus Phyllosphere	SAVVPNTYYLGPMGDPNPSDFINQETNRISFKQSVIDLSSS*
Ga0182171_10830051	3300015287	Miscanthus Phyllosphere	NAYFLGPVGDSDPSDFIHQETNQIPFKQSTVDLSS*
Ga0182173_10043083	3300015288	Miscanthus Phyllosphere	MENEILIPSSVIPNAYYLGPMGDTNPLDFINQETNQIPFR*
Ga0182173_10058362	3300015288	Miscanthus Phyllosphere	MGNKILIPSAVVPNTYYLGPMDDPDPSDFINQETNQIPFKQSVIDLSS*
Ga0182173_10110592	3300015288	Miscanthus Phyllosphere	MENEILIPSSIVPNAYYLGPMGDANPSDFTNQETNQIPFKQSLVDLSS*
Ga0182173_10336232	3300015288	Miscanthus Phyllosphere	MRNEILIPVAVASNIYFLGPMGDLDPSDFICQETNQIPFK
Ga0182173_10737981	3300015288	Miscanthus Phyllosphere	MRNEILIPSASAPNVYFLGPMGDPDPFDFIYQETNQIPFK
Ga0182173_10739871	3300015288	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGSMGDPDSSDFIRQETNQIPFKQSAVDLSSWNTKTPFRNW
Ga0182138_10186512	3300015289	Miscanthus Phyllosphere	MRNEILIPSAIAPNVYFLGPMGDPDPSDFIRQETNKIPFKQSVVDSSSWNTKTPFRN*
Ga0182138_10267881	3300015289	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLGPMGDPDPSNFIHQETSQIPFKQSVVDLSSWNTKTP
Ga0182138_10315173	3300015289	Miscanthus Phyllosphere	MRNEFLIPSAIVPNTYYLGSMGDPDPSNFINQETNQIPFKQSVIDLSSS*
Ga0182138_10538441	3300015289	Miscanthus Phyllosphere	MDNEILIPLPVVPNTYYLGPMGDANPSDFINQKTNQIPF
Ga0182138_10774892	3300015289	Miscanthus Phyllosphere	MRNEILIPSVVASNIYFLGPMGDPDPFNFIYQETNQISFKQSVVDLSSWKTKTPFRN
Ga0182138_10865131	3300015289	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYLGPMGDANPLDFINQETNQIPFRQSLVDLSS*
Ga0182125_10218002	3300015291	Miscanthus Phyllosphere	EMRNEILIPSAVVPNVYFLGPMGDPDLSDFICQETN*
Ga0182125_10369261	3300015291	Miscanthus Phyllosphere	MRNKILIPSVVASNVYFLGPMGDPDPSDFIHQETNQIPFKQSAVICPLGIPKL
Ga0182125_10459352	3300015291	Miscanthus Phyllosphere	MKNEFLIPSSVIPNAYYLGPMGDTNPSDFINQETNQIPFR*
Ga0182125_10602242	3300015291	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLGPMGDPDLSDFINQETNRIPFKQSVIDLSS*
Ga0182125_10670022	3300015291	Miscanthus Phyllosphere	LEFILSGFKEMRNEILIPSAVVPNVYFLGPMGDPDPSDFIRQETNQIPYKQSVVDLSS*
Ga0182125_10701001	3300015291	Miscanthus Phyllosphere	MRNEILIPSVVAPNVYFLGPMSDPDPSDFIHQETNQIPFKQSVVD
Ga0182125_10723802	3300015291	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYFLGPMGDPDPSDFIRQETNQIPFKQSVVDLSS*
Ga0182141_10337033	3300015292	Miscanthus Phyllosphere	AYYLGPMGDANPWDFANQETNQIPFRQSLVDLSS*
Ga0182141_10597761	3300015292	Miscanthus Phyllosphere	MRNEILIPLAIASNIYFLGPMGDPDPSDFIRHEINQIPFKQS
Ga0182141_10600101	3300015292	Miscanthus Phyllosphere	MRSEILIPSAVILNAYFLGPMGDPDPADFIRQETNQIPFKQSAMDLSSWNTKTPFRN
Ga0182141_10730201	3300015292	Miscanthus Phyllosphere	MRNEILIPSAVSPYIYFHGPMGDPDPSDFIRQEINQIPFKQSAVDLSSWN
Ga0182126_10416981	3300015294	Miscanthus Phyllosphere	SAAIHNAYFLGPMGDSDPSDFIHQETIQIPIKQSTVDSSS*
Ga0182126_10440871	3300015294	Miscanthus Phyllosphere	MRNEILIPSVVSPNIYFLGPMGDPDPSDFICQETNQIPFKQSVVDLSSWNTKTLFRNW
Ga0182126_10578681	3300015294	Miscanthus Phyllosphere	SVYFLGPMGDPDPSDFIHQETNQIPFKQSVVDMSSWNTKTPFRN*
Ga0182175_10483941	3300015295	Miscanthus Phyllosphere	MRNEILIPLAVVPNTYYLGPMGDPDLSDFINQETNRIPFKQSVIDL
Ga0182175_10587561	3300015295	Miscanthus Phyllosphere	NAYFLVPMGDSDPSDFMRQETNQIPFKQSIADSSSWNKTSFRN*
Ga0182175_10892771	3300015295	Miscanthus Phyllosphere	SAVASNIYFLGPMGDPDPSDFIHQETNQIPFKQSIVDLSSWNTKTLIRN*
Ga0182175_10976021	3300015295	Miscanthus Phyllosphere	PNVCFLGPMGDPNPSDFIHPETNQIPFKQSIVDLSS*
Ga0182157_10295161	3300015296	Miscanthus Phyllosphere	MRNEVLIPSTVVPNTYYLGPMGDPNPSDSINQETNQIPFKQSVIDLSS*
Ga0182157_10331951	3300015296	Miscanthus Phyllosphere	MRNEVLIPSVVASNVYFLGPMGDSDPSDFIHQVTNQIPFKQFV
Ga0182157_10360311	3300015296	Miscanthus Phyllosphere	MKNEILIPSSVIPNVYYLGPMGDTNPLDFINQETNQIPFKQSLVDLSSW
Ga0182157_10490162	3300015296	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYLGPMGDTNPLDFINQETNQIPFKQSLVDLSS*
Ga0182157_10581791	3300015296	Miscanthus Phyllosphere	ILISSTVVPNVYYLGPMGDPDPSDFISKKTNRIPFKQSVVDLSS*
Ga0182157_10588061	3300015296	Miscanthus Phyllosphere	MRNEILIPSATIPNVYFLGPMGDPDPSDFIRQETNQIPFKQSV
Ga0182157_10655672	3300015296	Miscanthus Phyllosphere	AYFLGQMGDPDPSNFICQETHQISFKRSIVDLSSWNKTPFRN*
Ga0182157_10905271	3300015296	Miscanthus Phyllosphere	LIPLAIASNVYYLGPMGDLDPSNFISQETNRIPFKQFVVNLSSWTP
Ga0182157_11020071	3300015296	Miscanthus Phyllosphere	MRNEILIPPDVASNVYFLGPMGDPDPSDSIRHETNQIPFKQSVVDSSS
Ga0182106_10110091	3300015298	Miscanthus Phyllosphere	MENEILISSVVASNVYFLGPMGDLDPSDFIHQETNQILFK*
Ga0182106_10152111	3300015298	Miscanthus Phyllosphere	MRNKILIPSATVPNAYYLGPMGYPDPSNFIKQETNRIAFKQSIVDLSSWNTKTLFRNWPK
Ga0182106_10336611	3300015298	Miscanthus Phyllosphere	LTSSASAPNVYFLGPMGDPDPSNFLCQETSQIPFKQSIVDSSSWNTKTPF
Ga0182106_10435412	3300015298	Miscanthus Phyllosphere	MRNEILISSAAVPNAYFLGPMGDSDPSDFIRQETNQIPFK
Ga0182107_10598781	3300015299	Miscanthus Phyllosphere	MRNEILTPSAIVPNTYYLGPMGDPDPSDFINQETN*
Ga0182108_10245991	3300015300	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPFDFIRQETNQIPFK*
Ga0182108_10292001	3300015300	Miscanthus Phyllosphere	SQEMRNKILIPSAVASNIYFLGPMGDPDPSNFIRQETNQIPFK*
Ga0182108_10393232	3300015300	Miscanthus Phyllosphere	MRNKILIPSAVVPNTYYLGPMGDPDPSDFINQETN*
Ga0182108_10398711	3300015300	Miscanthus Phyllosphere	MRNEILISSAVVPNAYYLEPMGDPDPSDFITQKTNRIPYKQSINRFVYLEHQN
Ga0182108_10498071	3300015300	Miscanthus Phyllosphere	NEILIPLYVISNSYYLGPMGDTNRSDFINQETNEIPFR*
Ga0182108_10710751	3300015300	Miscanthus Phyllosphere	MRNKILIPSAVASNVYFLGPMGDPDLSDFICQETNQIPFKQSAVDLSSWNTKTPFRNWPKMPMGW
Ga0182108_10893541	3300015300	Miscanthus Phyllosphere	MRNEILIPSAVTPNVYFLRPMGDPDPSNFVCQETNQIPFKQSAVDFSSWNSKTPSRNWPKMPKEW
Ga0182108_11012181	3300015300	Miscanthus Phyllosphere	MRNKILIPSAVISNTYFLGPMGDPDPSDFIRQETN
Ga0182143_10183611	3300015302	Miscanthus Phyllosphere	MRNEILIPSVVVPNAYFLRPMGDSDPSDFIRQETNQIPFKQSIVDSSS*
Ga0182143_10232301	3300015302	Miscanthus Phyllosphere	MRNKILIPSAIASNVYFLGSMGDPDPSDFIRQETNQIIFKQSVVDLSCWNTKTPFRN*
Ga0182143_10425022	3300015302	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDLDPSDFICQETNQIPFKQSTV
Ga0182143_10437162	3300015302	Miscanthus Phyllosphere	MRNKILIPSAIVSNTYYLRPMGNPNPSDFINQEINRIPFKQSVIDLSS*
Ga0182143_10689851	3300015302	Miscanthus Phyllosphere	MRNKIFIPSTIAPNVYFLGPMSDPDPSYFIYQETNQIPFKQSIVDSSSWNTKTPFRNWPKMP
Ga0182143_10728741	3300015302	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGPMGDPDPSDFIHQETN
Ga0182143_10756181	3300015302	Miscanthus Phyllosphere	VRNEILIPSVVAPNVYFLGPMSDPDPSDFIHQETNQIPFKQS
Ga0182143_11043301	3300015302	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPNPSDFIRKETNQIPFKQSA
Ga0182123_10046223	3300015303	Miscanthus Phyllosphere	SAIVPNTYYLGPMGDPDPSDFINQETNRIPFKQSVIELSS*
Ga0182123_10399201	3300015303	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLGPMGDPDLSNFINQETNQIPFKLYVI
Ga0182123_10455821	3300015303	Miscanthus Phyllosphere	MRNEILIPSAVIPNVYFLGPMGDPDPSDFIRQETNQIPFK
Ga0182123_10639921	3300015303	Miscanthus Phyllosphere	EMRNEILIPSAVAPNVYFLGPMGDNDPSDFIYQETNKIPFKQSVVDLSS*
Ga0182123_10917951	3300015303	Miscanthus Phyllosphere	MKNKILIPSSVVPNAYYLGPMGDTNPSNFINQETNLIPFKQSVVDLSSWN
Ga0182123_10949951	3300015303	Miscanthus Phyllosphere	MRNEILIPSAIVPDACYLGPMGDPDPFDFINQETNRIPFKRSIIDL
Ga0182123_10995961	3300015303	Miscanthus Phyllosphere	MRNKILISSVVAPNVYFLGPMGDPDPSDFIHQETKEIPFKQSIVDLSS*
Ga0182112_10859891	3300015304	Miscanthus Phyllosphere	MRNKILISSAIASNVYFLGPMGDPNPYNFICQETNQIPFKQ
Ga0182112_10868061	3300015304	Miscanthus Phyllosphere	MRNEILISSASAPNVYFLGPMGDPDPSEFICQETNQISFKQSVVDSSF*
Ga0182112_10933542	3300015304	Miscanthus Phyllosphere	MRNEILIPLAVASNVYFLGPMGDLDPSNFIRQETNQIPFKQSVVDSS
Ga0182158_10344431	3300015305	Miscanthus Phyllosphere	LIPSAVTSNVYFLGPMGDPDLSDFIRQETNQIPFKQSTVDLSSWNTKTPFRNWPKMPKGW
Ga0182158_10383951	3300015305	Miscanthus Phyllosphere	MRNEILIPSAAVPNAYFLGPMGHSDPSDFICQETNQIPFKQSVVDSSS*
Ga0182158_10389301	3300015305	Miscanthus Phyllosphere	MENEILIPSSIVPNAYYLGPMGDANPLDFINQETNQIPF
Ga0182158_10421163	3300015305	Miscanthus Phyllosphere	VSNTYYLGSMGDPDPSDFINQETNQIPFKQSVIDLSS*
Ga0182158_10502111	3300015305	Miscanthus Phyllosphere	MRNEILISSAVIPNAHFLGPMGDPDPSDFIHQKSNQIPFKQSAVDLSSW
Ga0182158_10502891	3300015305	Miscanthus Phyllosphere	MKNKILIPSAVAPNIYFLGPMGDLDPSDFIHQETNQIPFKQS
Ga0182158_10518541	3300015305	Miscanthus Phyllosphere	MRNEILIPSAIAPNVYYLGPMGDPDPSDFISQETNQIPFKQF
Ga0182158_10576741	3300015305	Miscanthus Phyllosphere	MRNETLIPSAVIPNAYYLGHMGDPDPSDFINQETN*
Ga0182158_10584752	3300015305	Miscanthus Phyllosphere	MRNKILIPSAVVPNAYYLGSMGDPDPSNFINQETNQISFKQS
Ga0182158_10593531	3300015305	Miscanthus Phyllosphere	MRNKILIPSVVVPNAYYLGPMGDPDPSNFINQETSRIPFKQSIVDLSSWNTKTPFRN*
Ga0182158_10653621	3300015305	Miscanthus Phyllosphere	MRNEILIPSAVASNVHFLVPMGDSDPSDFICHETNQILFKQSVVD
Ga0182158_10861411	3300015305	Miscanthus Phyllosphere	MRNEILIPLVVVPNVYFLGPMGDPNPSDFIHQETNQIPFKQFAVDS
Ga0182158_11060751	3300015305	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPSDFIHQETNQIPFEQSAVDLSSWNTMTPFRN*
Ga0182144_10546541	3300015307	Miscanthus Phyllosphere	MRNEILIPSPAVPNVYFLGPMGDSDPSDFICQETKPIPFKQFVVDLSS*
Ga0182144_10636632	3300015307	Miscanthus Phyllosphere	MRNEILIPLAVASIVYFLGPMGDPNPSDFIHQETNQFPFKQFVVDSFS*
Ga0182144_10674701	3300015307	Miscanthus Phyllosphere	MRNEILIPSAAIPNVYFLGPMGDSDPSDFIRQETNQIPFKQSVVDSSSWNKTTFKN
Ga0182142_10064481	3300015308	Miscanthus Phyllosphere	MRNEILIPSAIVPNAYYLGPMGDPDLSDFINQETNRIPFK*
Ga0182142_10193092	3300015308	Miscanthus Phyllosphere	EILIPSAVVPNAYYLGPMCDTDPSDFINQETNWIPFKQPVADSSS*
Ga0182142_10303502	3300015308	Miscanthus Phyllosphere	MRNEILIASAVAPIVYFLGPMGDPDPSDFIRQETNQISFKQSAVDLSSWNTKTLFRN*
Ga0182142_10388851	3300015308	Miscanthus Phyllosphere	MRNEILIPSVVAPNVYFLGPMGDPDPFDFIHQETNQIPFKQSVVDLS
Ga0182142_10484801	3300015308	Miscanthus Phyllosphere	MRNKILIPSAVVPKAYYLRPMGDPNPSNFINQETNRI
Ga0182142_10757511	3300015308	Miscanthus Phyllosphere	MRNEILIPSATTSNVYFLGPMGDPDPSDFIHQETNQIPFKQSIVDSSSWSTKT
Ga0182142_10989471	3300015308	Miscanthus Phyllosphere	RNEILIPSAAIPNVYFLGPMGDLDPFDFIRQETNQIPFKQSVVDSSSRNKTPFRN*
Ga0182140_10144542	3300015314	Miscanthus Phyllosphere	MRNEILIPLAIVPNVYFLRPMGDPDPYDFIRQEINQIPFKQSAVDSSS*
Ga0182140_10335631	3300015314	Miscanthus Phyllosphere	MRNKILIPSTVAPNVYFLGPMGDPHLSDFIRQETNQISFKQ
Ga0182140_10409821	3300015314	Miscanthus Phyllosphere	DFQEMRNKILIPSAVASNAFFLGLMGDPDPSDFIRRETN*
Ga0182140_10444481	3300015314	Miscanthus Phyllosphere	MRNEILIPSAAIPNVYFLGPMGDLDPFDFIRQETNQIPFKQSVVDSS
Ga0182140_10481822	3300015314	Miscanthus Phyllosphere	EILIPSAVVPNAYYLGSMCDTDPSDFINQETNWIPFKQPVADSSS*
Ga0182140_10575542	3300015314	Miscanthus Phyllosphere	MRNEILIPSDVAPNVYYLGPMGEPDRSNFISQETNQI
Ga0182140_10744601	3300015314	Miscanthus Phyllosphere	MGNEILILSTVIPNTYYLGPMGDPDLSDFINQETNRIPFKQSVIDLSS*
Ga0182140_10850231	3300015314	Miscanthus Phyllosphere	MRNKILIPSTVASNVYFLGPMGDPNPFDFIRQETNQI
Ga0182140_11175122	3300015314	Miscanthus Phyllosphere	VPNAYYLGPMSDPDPSNFINQETNQILFKQSVVDLSSWNTKTLFRN*
Ga0182127_10487841	3300015321	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLGPMGDPDPSDFICQETNEIPFK*
Ga0182127_10580511	3300015321	Miscanthus Phyllosphere	MENKILIPSSIVPNAYYLGPMGDFDPSDFIKQETNQIPFRQ
Ga0182127_10775911	3300015321	Miscanthus Phyllosphere	MRNEILIPSVVASNIYFLGPMVDPNPSDFICQETNQIPFKQSVVDLSS
Ga0182127_10801512	3300015321	Miscanthus Phyllosphere	MRNEILIPSPAVPNVYFLGPMGDPDPSDFICQETNQIPFKQFVVDSSS*
Ga0182127_11045071	3300015321	Miscanthus Phyllosphere	MRNEILIPLAVVPNTYYLGPMGDPDSSDFINQETN*
Ga0182127_11071242	3300015321	Miscanthus Phyllosphere	MRNEILIPSAVAPNIYFLGPMGDPDPADFIRQETNQIPFKQSTVDLSS*
Ga0182110_10165353	3300015322	Miscanthus Phyllosphere	PNAYFLGPMGDSDPSDFIRQETNQIPFKQSVVDSSS*
Ga0182110_10275733	3300015322	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLGPMGHLDPSDFICQETHQIPFKRFIVDLSSWNKTPFRNWPKA
Ga0182110_10405871	3300015322	Miscanthus Phyllosphere	MRNEFLIPSAIIPNAYYLGPMDDHDPSDFINQETNRIPFKQSVIDLSS*
Ga0182110_10593151	3300015322	Miscanthus Phyllosphere	MRSEFLIPSVVAPNVYFLGPMGDPDLSDFIHQETNQISFKQSIVDSPS
Ga0182110_11062781	3300015322	Miscanthus Phyllosphere	MRNEILIPSTVTSNVYFLGPMGDPDPSDFIRQETNQIPFKQSAVDLSSW
Ga0182129_10075853	3300015323	Miscanthus Phyllosphere	MENKILIPSSVVPNAYYLGPMGDVNPSDFINQETNQIPFRQSLVDLSSWNTKNLFKN*
Ga0182129_10224802	3300015323	Miscanthus Phyllosphere	MENEILIPSSIVPNAYYHGPMGDANPSDFINQETSQISFRQSLVDLSS*
Ga0182129_10232341	3300015323	Miscanthus Phyllosphere	MGNEILIPSSVIPNAYYLGPMGDTNPLDFINQETNQIPFR*
Ga0182129_10238511	3300015323	Miscanthus Phyllosphere	MENEILIPSSVVPNTYYPGPKGDVDPSDFIKQETNQIPFRQSLV
Ga0182129_10618151	3300015323	Miscanthus Phyllosphere	MRNEILIPSAVAPNIYFIGPMEDPDPSDFIRQETNQIPFKQSTVDLSS*
Ga0182129_10632611	3300015323	Miscanthus Phyllosphere	MRNEILIPSAIVPNTYYLGPMGDPNPSDFINQETNRIPFK*
Ga0182129_10860451	3300015323	Miscanthus Phyllosphere	MRNKILIPSAIVPNVYFLGPMGDPDPSNFIRQETNHIPFKQSAVDSSSWNKTTFKN*
Ga0182129_10865921	3300015323	Miscanthus Phyllosphere	MRNEILIPLAVASNVYFLGPMGDSDPSNFIHQETN
Ga0182129_10918331	3300015323	Miscanthus Phyllosphere	MRNEILIPSAIAPNVYFLGPMCDPDPSDFIHQETNRIPSKQSVVDLSS*
Ga0182129_11159481	3300015323	Miscanthus Phyllosphere	MRNEILIPSAVIPNVYFLGPMGDPDPSDFIRQETKQIPFKQFVVDSSS*
Ga0182129_11176462	3300015323	Miscanthus Phyllosphere	LIPSAIVPNAYYLGPLGDPDPYDFINQETNQIPFKQYVVDLSS*
Ga0182187_10156992	3300015341	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLEPMGDPNPSDFINQETNRIPFKQSVIDLSS*
Ga0182187_10481291	3300015341	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPNPFDFIRQETNQIPFK*
Ga0182187_10612891	3300015341	Miscanthus Phyllosphere	MRNEILIPSAVVPNVSYLGPMGHPDPSNFISQETSQIPFKQ
Ga0182187_10742832	3300015341	Miscanthus Phyllosphere	MENKILIPSSIVPNAYYLGPMGDADPSDFIKQETNQIPFSSLW*
Ga0182187_10870452	3300015341	Miscanthus Phyllosphere	MRSEILIPSAVASNVYFLGPMGDPDPSDFIRQETNQ
Ga0182187_11289791	3300015341	Miscanthus Phyllosphere	MKNKIMIPSSIVLNAYYLGPMGDANPSDFINQKTNQIPFR
Ga0182187_11437252	3300015341	Miscanthus Phyllosphere	MRNEILIPSAAVPNAYYLGPMCDPDPSDFINQETNQIPFKQSVIDLSS*
Ga0182187_11778321	3300015341	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLRPMGDPDPSDFIHQETNKIPFKQSVVDSSSYNKTPFKN*
Ga0182187_11870932	3300015341	Miscanthus Phyllosphere	MRNEILIPSTVASNVYFLGPMGDSDPFDFIHQKTNQIPFKQSIVD
Ga0182109_11054321	3300015342	Miscanthus Phyllosphere	NEILIPSAAAPNAYFLGPMGDSDPSDFIRQETNQIPFKQSVVDSSS*
Ga0182109_11168622	3300015342	Miscanthus Phyllosphere	MGNKILIPSAVASNVYFLGPMGDPDPSDFIHQETNQIPFKQSAVDLSSWNTKTPFRNWPKMPNG*
Ga0182109_11238091	3300015342	Miscanthus Phyllosphere	MENEILIPSSVIPNAYYLGPMGDADLLDFINQETNQIPFRQSLVDLSSWNTKNP
Ga0182109_11443681	3300015342	Miscanthus Phyllosphere	EILIPSAIAPNVYFLGPMGDPDPSNFIHQEANQIPFKQSVVDSSFWNAKTPFRN*
Ga0182109_11506741	3300015342	Miscanthus Phyllosphere	RNEILIPSAVVPNAYFLRPMGDYDPSDFICQETNQIPFK*
Ga0182109_11575001	3300015342	Miscanthus Phyllosphere	MRNKILIPSAVTPNVYFLGSMGDPDPSDFIRQETNQIPFKQSA
Ga0182109_11616571	3300015342	Miscanthus Phyllosphere	LIPSVVAPNIYFLGPMGDLDSSDFIRQETNQIPLKQ
Ga0182109_11749591	3300015342	Miscanthus Phyllosphere	MRNEILIPLAVVPNAYFLGPMGDPDPSDFIRQETNQIPFKQSVVDSSS
Ga0182109_12016141	3300015342	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYLGPMGDADPSDFLIQETNQIPFSQSLVDLFSWNTKNPFRNWPKMPKG*
Ga0182109_12071351	3300015342	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYFLGPMGDYDPFDFIHQETNQIPFKQSVVNSSS
Ga0182155_10401112	3300015343	Miscanthus Phyllosphere	MENEILIPFSVVPNAYYLGRMGNTNPLDFINQETNQIPFW*
Ga0182155_11208891	3300015343	Miscanthus Phyllosphere	LIPSAVAPNVYFLGPMGDPDSSDYIHQETNRIPFKQSVVDLSSWNTKT
Ga0182155_11379882	3300015343	Miscanthus Phyllosphere	MRNEILIPSTVIPNAYFLGPMGDPDPSDFIHQETNKIPFKQSAVDLSSWNTKTPFRN*
Ga0182155_11735841	3300015343	Miscanthus Phyllosphere	MRNKILISSASAPNVYFHGPMCDPDPSDFICQETNQIP
Ga0182155_11812071	3300015343	Miscanthus Phyllosphere	MKNKIMIPSAVVPNAYFLGPMGDPDPSDFICQETNQIPFKR
Ga0182155_12010551	3300015343	Miscanthus Phyllosphere	MRNEILIPSTIVPNTYYLGPMGDPNPSDFINQETN*
Ga0182155_12035701	3300015343	Miscanthus Phyllosphere	MIPSAVISNAYFLGPMGDSDPSDFIRQETNQIPFKQSVVDLSSWSTKTTLKN*
Ga0182155_12187381	3300015343	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPSDFIYQETNQIPFKQSAVDLSSWN
Ga0182189_11062131	3300015344	Miscanthus Phyllosphere	MLIPLVVVPNAYYLRPMGDPNLSNFINQETSRIPFKQSVVDLSSWNTKTPF
Ga0182189_11349091	3300015344	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPFDFIHQETNQIPFKQSV
Ga0182189_11567241	3300015344	Miscanthus Phyllosphere	IPSTVASNVYFLGPMGDSDPFDFIHQKTNQIPFKQSIVDSSS*
Ga0182189_11657111	3300015344	Miscanthus Phyllosphere	MTNEILIPSAVAPNVYFLGPMGDLDPSDFIRQETNQIPFKQSVVDLSSWNTKTPFRN*
Ga0182111_10438692	3300015345	Miscanthus Phyllosphere	MGNEFLIPSAIVPNAYYLGPMGDPDLSDFINQETNRIPFK*
Ga0182111_10501801	3300015345	Miscanthus Phyllosphere	MRNEILIPSAIVPNAHYLGPMGDPNPSNFINQETNRIPFKQSIIDLSS*
Ga0182111_10679221	3300015345	Miscanthus Phyllosphere	NEILIPSVVASNVYFLGPMGDLDPSDFIHQETNQILFKQSVVDSSS*
Ga0182111_10742402	3300015345	Miscanthus Phyllosphere	MKNEIMIPSVVVPNAYFLGPMGDPDPSDFIYQETH
Ga0182111_11170431	3300015345	Miscanthus Phyllosphere	MRNKILIPSAVVPKAYYLRPMGDPNPSNFINQETNRIPFKQSIVDLSS
Ga0182111_11502741	3300015345	Miscanthus Phyllosphere	MRNKILIPPAVVPNAYNLGPMDDPNPSDFINQETNRIPFKQSVIDL
Ga0182111_11825821	3300015345	Miscanthus Phyllosphere	MRNEILIPSAVASNIYFLGPMSDPDPSDFICQETNQIPFKQSAMDLSS
Ga0182111_11840582	3300015345	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYFLGPMGDPDPYDFIYQETN
Ga0182111_12106511	3300015345	Miscanthus Phyllosphere	NEILIPSVVSPNIYFLGPMGDSDPSDFIRQETNQISFKQSVVDLSF*
Ga0182111_12133562	3300015345	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLGPMGDLDQSDFINQETNRIPFK*
Ga0182111_12148582	3300015345	Miscanthus Phyllosphere	MMNEILISSAVVPNAYFLGPMGDPNPSDFICQETNQIPFK*
Ga0182111_12227002	3300015345	Miscanthus Phyllosphere	NEILIPSAVAPNVYFLGPMGDPDPSNFIHQETNQILFKQSIVDLSS*
Ga0182111_12373892	3300015345	Miscanthus Phyllosphere	VYFLGPMGDPDPSDFIHQETNQIPFKQSIVDLSSWNTKTPFRN*
Ga0182111_12414971	3300015345	Miscanthus Phyllosphere	MRYEILIPLAAVPNVYFLGPMGDPDPSDFIHQETNQIPFKQSIVDSSSWSTKTPFKN*
Ga0182111_12429701	3300015345	Miscanthus Phyllosphere	MRNKILIASAVVPNVYFLGTMGDPDPSNFIHQETNQIPFKQSIVDSSFWNKT
Ga0182139_10555271	3300015346	Miscanthus Phyllosphere	MRNDILIPSAVVPNAYFLGPMGDSDPSNFIRQETNQIPFKQSVVDSSSWNKTSFRNW
Ga0182139_10593501	3300015346	Miscanthus Phyllosphere	LIPSAIAPNVYYLRPMGDPDPSDFISQETNRIPFK
Ga0182139_10874732	3300015346	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLGPMGDPDPSDFICQETNQIPFKRS
Ga0182139_10962041	3300015346	Miscanthus Phyllosphere	MRNDILIPSAVAPNVYFHGPMGDPNLSDFIRQETNQIPFKQSVVDLSS*
Ga0182139_10973821	3300015346	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLRPMGDPDPYDFIRQEINQIPFKQSAVDSSS*
Ga0182139_11438031	3300015346	Miscanthus Phyllosphere	MRNEILIPSASAPNVYFLGPTGDPDPPNFICQETNQIPFKQSIVDL
Ga0182139_11695331	3300015346	Miscanthus Phyllosphere	MRNEILITSAIAPNIYFLGPMGDPDPSDFIHQETNQIPFKQSAVDLSSWNTK
Ga0182139_11750841	3300015346	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPADFIRQETNQIPFKQSAMDLSSWNTKTPFRNW
Ga0182139_11828451	3300015346	Miscanthus Phyllosphere	MRNEILITSAVAPNVYFLGPMGDSDPSDFIHQETNQIAF
Ga0182139_11874641	3300015346	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPSDFMRQETNQIPFKLSVVDLSSWNTKTP
Ga0182139_11889661	3300015346	Miscanthus Phyllosphere	MRNKILIPSAVTPNVYFLGPMGDPDPSDFVRQETNQIPFKQS
Ga0182139_12238972	3300015346	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLRPMGDPDPSDFIHQETNQIPFKQ
Ga0182139_12448042	3300015346	Miscanthus Phyllosphere	MRNEILIPSTVASNTYFLGPMGDPDPSDFIHQETNQIPFKQ
Ga0182177_10965392	3300015347	Miscanthus Phyllosphere	MRNGILITSAVVPNTYYLGPMGDPDPSDFINQETN*
Ga0182177_11038921	3300015347	Miscanthus Phyllosphere	MRNKILIPSVIVPNAYYPGPMGDPNPSDFINQETNRIPFKQSVIDLSSN*
Ga0182177_11282902	3300015347	Miscanthus Phyllosphere	MRNEILITSTIVPNVYFLGPMGDPDPSDFIHQETNQIPFKQYVVDSSSWNKTP
Ga0182177_11444172	3300015347	Miscanthus Phyllosphere	MRNKILISSAAASNIYFLGPMGNPDPSDFIRQETNQI
Ga0182177_11525652	3300015347	Miscanthus Phyllosphere	MWNEILISSVVVPNAYYLRPMGDPDPSDFINQETNRIPYKQSVVDLSS*
Ga0182177_11756241	3300015347	Miscanthus Phyllosphere	MRNEILIPSAIVPNVYYLGPTGDPEPSDFTSQETNK
Ga0182177_11838172	3300015347	Miscanthus Phyllosphere	MRNEILIPSAAIPNAYFLGPMGDSDPSDFIHQETNQIPFKQSIVDSSS*
Ga0182177_11852761	3300015347	Miscanthus Phyllosphere	MRNEVLIPPAVISNAYFLGPMGDSDLFDFIHQEINQILFKRSV
Ga0182177_12114281	3300015347	Miscanthus Phyllosphere	MMNEIMIPSAVSPNIYFLGPMGDPDPSDFIRQETNQIPFKHSAVDLSSWNTKTLFKN*
Ga0182177_12174761	3300015347	Miscanthus Phyllosphere	LIPSAVAPNVYFHGHMGDPDPSDFIYQETNQIPFKQSIVDSSSWSTKTPFRN*
Ga0182177_12233881	3300015347	Miscanthus Phyllosphere	MRNKILIPSAVIPNAYFLKPMGDPDPSDFMRQETNQIPFKLSVVDLSSWNTKTPFRNWPK
Ga0182177_12326241	3300015347	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLGPMGDPNSSDFINQETNRIPFKQFVVD
Ga0182177_12374491	3300015347	Miscanthus Phyllosphere	MGNKILIPSAVVPNTYYLGPMDDPDPSNFINQETNRIPFKQSVIDLSS*
Ga0182177_12384082	3300015347	Miscanthus Phyllosphere	PNVYYLGPMGDPDPSDFIRQETNQIPFKQSVVDLSS*
Ga0182161_11393981	3300015351	Miscanthus Phyllosphere	NEILIPSVVASNIYFLGPMGDPSPSDFINQETNQIPFKQPAVDLSS*
Ga0182161_11588991	3300015351	Miscanthus Phyllosphere	EMRNKILIPLAVVPNTYYLGPMGDPDSSNFINQETN*
Ga0182161_11928381	3300015351	Miscanthus Phyllosphere	VRNEILIPSASAPNVYFLGPMGDPDPSDFIYQETNQSPSNN
Ga0182161_12350771	3300015351	Miscanthus Phyllosphere	MRNEILIT*VVASNVYFLEPMGDPDPSDFIYQETNQIPFKQSA
Ga0182161_12534871	3300015351	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLRPMGDPDPYDFIRQEINQIPFKQSAVDSS
Ga0182161_12682951	3300015351	Miscanthus Phyllosphere	MRNEILIPSAVATNIYFLGPMGNPDPSDFIRQETNQIPFK
Ga0182159_10014781	3300015355	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYLGPMCDTDPSDFINQETNWIPFKQPVADSSS*
Ga0182159_10986162	3300015355	Miscanthus Phyllosphere	MRNEILIPSAVIPNVYFLGPMGDPDPSDFIRQETNQIPFKQSLVDSSS*
Ga0182159_11290111	3300015355	Miscanthus Phyllosphere	MRNEILIPSAIAPNVYFLGPMGDPDPSNFIHQETNQIPFK
Ga0182159_11640021	3300015355	Miscanthus Phyllosphere	MTNEILIPSVVAPNVYYPGPMGDLDTSDFITQETNQISFKQ
Ga0182159_11728522	3300015355	Miscanthus Phyllosphere	MRNEILIPSAVSPNIYFLGPMGDSDPSDFIRQETNQIPFKHSAMDLSS*
Ga0182159_11746072	3300015355	Miscanthus Phyllosphere	MRNAILIPSAIVPNAYYLGPMSDLDPFDFINQETNRIPFKQSIVDLS
Ga0182159_12008081	3300015355	Miscanthus Phyllosphere	MRNEILIPLAIAPDVYFLRPMGDPDPSDFIRQETNQISIKQSVVDLSSWNTKTLFRNWPK
Ga0182159_12525682	3300015355	Miscanthus Phyllosphere	MRNEILIASAVAPNVYFLGPMGDPDPSDFIRQETNQIPFKQCVVDLSS*
Ga0182159_12631121	3300015355	Miscanthus Phyllosphere	MRNKILIPSAVTSNVYFLGPMGDPDPSDFIHQENQPN
Ga0182159_12635371	3300015355	Miscanthus Phyllosphere	MRKEILIPSAIVPNAYYLRPMGDPDPSDFINQETNRISFKQSIV
Ga0182159_12688611	3300015355	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGSMGDPDSSDFIRQETNQIPFKQSAVDLSSWNTKTP
Ga0182159_12707651	3300015355	Miscanthus Phyllosphere	MSNEILIPSAIIPNVYFLGPMGDPDPSDFIHQETNQIPFKQSVVD
Ga0182159_12980311	3300015355	Miscanthus Phyllosphere	MRNEILIPSAIVPNVYFLGPMGDPDPSDFIHLETN
Ga0182159_13063072	3300015355	Miscanthus Phyllosphere	MRNKILIPSAVVPNAYYLGPMGDPDPSDFINQETNR
Ga0182159_13131501	3300015355	Miscanthus Phyllosphere	MENKILIPSSIVPNAYYLGPMGDADPSDFIKQETNQ
Ga0182145_10806321	3300015361	Miscanthus Phyllosphere	MRHKILIPSAVVPNAYYLGPMGDPDPYNFNNQETNQIPFKQSIIDLPSWNTKTPFRN*
Ga0182145_11126511	3300015361	Miscanthus Phyllosphere	MMNKILIPSASAPNVYFLGPMGDPDPSDFIRQETNQIPFKQSVV
Ga0182145_11433872	3300015361	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYFLGPMGDPDPSDFIRQETNQIPFK*
Ga0182145_11877781	3300015361	Miscanthus Phyllosphere	MRNEILIPSAVVPNAYYFGPMGDLDPFDFINQETNRFPFKQSVV
Ga0182145_11903981	3300015361	Miscanthus Phyllosphere	MRNKILIPSAVASNIYFFGPMGDPDPSDFICQETNQILFKQSAVDLSSWNTKTP
Ga0182203_10306901	3300017404	Miscanthus Phyllosphere	MRNKILIPSAFVRNAYYLGPMGNPDPSDFINQETNQIPFKQSIVVFLEQQNSL
Ga0182203_11027681	3300017404	Miscanthus Phyllosphere	MRNGILISSAVVPNAYYLEPMGDPDPSDFITQETNXIPFKQSVIDLSTWNTKI
Ga0182203_11207021	3300017404	Miscanthus Phyllosphere	MRNKILIPSAVTSSVYFLGPMGDPDPSDFIHQETNQIPFKQSVVDLSSWNTKTLFRNWPKMP
Ga0182203_11452752	3300017404	Miscanthus Phyllosphere	MRNEILIPSAIVPNAYYLGPMCDPDPSDFINQETNQIPFKQSVIDLSS
Ga0182203_11572492	3300017404	Miscanthus Phyllosphere	MKNEILIPSSVIPNVYYLGPMGDTNPSDFINQETNQIPFKQSLVDLSSW
Ga0182203_11595501	3300017404	Miscanthus Phyllosphere	MRNDILIPSTVTPNVYFLGPMGDPDPSDFVRQETNQIPFKQSVVDLSSWNTKTPF
Ga0182220_10111601	3300017407	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYLLRPMGDPDPSNFIRQETNQIPFKQSVVDLSS
Ga0182220_10357541	3300017407	Miscanthus Phyllosphere	MRNEILIPSAIVPNVYYLGPTGDPEPSDFTSQETFKIPFKQSVVDL
Ga0182220_10397921	3300017407	Miscanthus Phyllosphere	MRNEVLISSAVVSNAYFLGPMGDPDPSDFIHQETNQIPFK
Ga0182204_10042232	3300017409	Miscanthus Phyllosphere	EILIPSPAVPNVYFLGPMGDPDPSDFIRQETNQIPFKQSVVDSSSSNKTPFRN
Ga0182204_10147781	3300017409	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYFLGPMGDPDPSDFIHQETNQIPFKQSIVDSSS
Ga0182204_10171161	3300017409	Miscanthus Phyllosphere	MRNKILIPSAVVSNAYYLGAMGDLDSSDFINQEINRIPFKQSIVDLSS
Ga0182204_10375111	3300017409	Miscanthus Phyllosphere	MRNEILIPLAIVPNVYFLRPMGDPDPSDFIHQETNQIPFKRSVV
Ga0182204_10489531	3300017409	Miscanthus Phyllosphere	MRNEILIPSAVAPNIYFLGPMGDPDPSDFIRQETNQISFKQSAVDLSSWNTNSLQKLAKD
Ga0182204_10632141	3300017409	Miscanthus Phyllosphere	MRNKILIPSAVTSNVYFLGPMGDLDPSDFIHQETNQIPFKQSAVDLSSWNTKTPFRKLAQNA
Ga0182204_10749701	3300017409	Miscanthus Phyllosphere	MRNEILIPSTVASNVYFLGPMGDPDPSDFIHQETNQIPFKQSAVDLSSWNTKTLFRNWPK
Ga0182204_11035551	3300017409	Miscanthus Phyllosphere	MKDEILIPSAVIPNAYFLGSMGDPNSSDFICQETNQIPFKRSVVDSSSCNKT
Ga0182204_11212591	3300017409	Miscanthus Phyllosphere	IPSAIVPNAYYLGPLGDPDPYDFINQETDQIPFKQYVVDLSS
Ga0182207_10373041	3300017410	Miscanthus Phyllosphere	MKNEILIPSAVVPNAHFLGPMGDPDPSDFICQETHQIPFKRSVVD
Ga0182207_10500661	3300017410	Miscanthus Phyllosphere	MRNEILILSAVASNIYFLGPMGDPDPSDFIHQETNQIPFKQSIVDLASWNTKTLFKNWPKMP
Ga0182207_11066401	3300017410	Miscanthus Phyllosphere	NEILIPSDVVSNVYYLGPMGNPDPSNFIRQETKRIPFKQSIVDLSS
Ga0182207_11098521	3300017410	Miscanthus Phyllosphere	MKNEILISSASAPNVYFLGPMGDPDPSNFICQETNQIPFK
Ga0182207_11304381	3300017410	Miscanthus Phyllosphere	MRNEILIPSVVASNIYFLGPMGDPDPSDFIRQETNQIP
Ga0182207_11350791	3300017410	Miscanthus Phyllosphere	MRNEILIPSIVVPNAYYLGPMGDPNPSDFINQETSRIPFKQSVVDLSSWNTKTPF
Ga0182208_10052812	3300017411	Miscanthus Phyllosphere	MIPLSVVPNTYYLGPMGDADPSDFLIQETNQIPFSQSLVDLFSWNTKNPFRNWPKMPKG
Ga0182208_10268001	3300017411	Miscanthus Phyllosphere	LIPSAVTSNVYFLRPMGDPDPSDFLHQETNQIPFKWSVVDL
Ga0182208_10316532	3300017411	Miscanthus Phyllosphere	MENEILIPSSIVPNAYYLGPMRDADPLDFTKQESNQIPFKQSLVDLSSWNTKNP
Ga0182208_10736271	3300017411	Miscanthus Phyllosphere	MRNKILIPLAVAPNVYYLGPMGDPDPSDFINQETN
Ga0182208_10774582	3300017411	Miscanthus Phyllosphere	MRNKFLIPSVVVPNAYYLGPMGEPNPSDFINQETNQIPFKQYVVDLSFW
Ga0182208_10826622	3300017411	Miscanthus Phyllosphere	MRNEILIPSAIVPNAYYLGPLGDPDPYDFINQETNQIPFKQYVVDLSS
Ga0182208_10955331	3300017411	Miscanthus Phyllosphere	MRNEILISSAVVPNTYYLGPMGDPDPSDFINQETN
Ga0182208_11202761	3300017411	Miscanthus Phyllosphere	MRNEILIPSAVAPNIYFLGPMGASYFIRQETNQIPFKQSAVDLSSWNTKTLFRNWPKM
Ga0182222_10393212	3300017413	Miscanthus Phyllosphere	LIPSAVAPNVYFLGPMGDPDPSNFICQETNQIPFKQSVVGSSSWNTKTPFRNWPKMPR
Ga0182222_10461951	3300017413	Miscanthus Phyllosphere	MWNEILISLASAPNVYFLGPMGDPDPSDFICQETNQIPFKQSVVDSSS
Ga0182222_10492671	3300017413	Miscanthus Phyllosphere	MRNEILIPSAVASNIYFLGPMGDPDPSDFIHQETNQIPFK
Ga0182222_10601262	3300017413	Miscanthus Phyllosphere	MRNKIFIPSASAPNVYFLGPMGDPDPSDFICQETNQIPFKQSVVDSSSWN
Ga0182222_10621921	3300017413	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLRAMGDPDPSDFINQETNQIPFKQSVIDSYSS
Ga0182222_10703761	3300017413	Miscanthus Phyllosphere	MKNEILIPSAVASNVYFLGPMGDPDPSDFIYQETNQIPFKQFAVDLSSWNTKTLFR
Ga0182222_10772971	3300017413	Miscanthus Phyllosphere	MRNKIFISSAIVPNTYYFGPMGDPNPSDFINQETNRI
Ga0182222_10783901	3300017413	Miscanthus Phyllosphere	PNVYFLGPMGDPDPSDFIHHETNQIPFKQSAVDLSS
Ga0182222_10900541	3300017413	Miscanthus Phyllosphere	PNVYFLRPMGDPDPSDFICQETNQIPLKQSVVDSSF
Ga0182202_10094942	3300017415	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYLLGPIGDPDPSDFIHQETDQIPFKQSVLDLSS
Ga0182202_10134192	3300017415	Miscanthus Phyllosphere	MRNEILIPSAIVPNAYYLRPMSDPDPFDFISQETNRIPFKQSVVDLSS
Ga0182202_10977092	3300017415	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLRAMGDPNPSDFIYQETHQISFKRSIV
Ga0182202_10997142	3300017415	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDPDPSNFIHQETNQIPFKQ
Ga0182202_11220171	3300017415	Miscanthus Phyllosphere	MRNEILIPSAAIPNAYFLGPMGDSDPSDFICQETNQIPFKQSVVDSSS
Ga0182202_11262252	3300017415	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYLGPMGDTNPLNFINQETNQIPSRQSLVDLSPWNTKNPFRNWP
Ga0182230_10628392	3300017417	Miscanthus Phyllosphere	MRNEILIPSAVAPNVYFLGPMGDPNPSDFIHQETNRIPFK
Ga0182230_11144352	3300017417	Miscanthus Phyllosphere	PNAYYLGPMGDPDPSDFINQETNQIPFKQSVVDLSSLNTKTLFRN
Ga0182230_11176721	3300017417	Miscanthus Phyllosphere	SNVYFLGPMGDPDPSDFIHQETNRIPLKQSVVDLSS
Ga0182228_10354531	3300017420	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGSMGDPDSSDFIRQETNQIPFKQ
Ga0182228_10612842	3300017420	Miscanthus Phyllosphere	MRNEILIPSAVTSDVYFLGPMGDPDSSDFIRQETNQIPFK
Ga0182228_10800482	3300017420	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYLGPMGDTNPLDFINQETNQIHFRQSLVYLSS
Ga0182228_11053431	3300017420	Miscanthus Phyllosphere	MRNEILIPSAVVLNAYYLGPMGDPNPSDFINQEINRIPFKQSIVDLSSWKTKT
Ga0182228_11060272	3300017420	Miscanthus Phyllosphere	MENKILIPSSVVPNAYYLGPMGDANPLDFINQETNQIPFRQSLVDLSS
Ga0182219_10575882	3300017424	Miscanthus Phyllosphere	MRNKILIPSAVVPKAYYLGPMGDPDPSDFINQETNQISFKQSVIDLSS
Ga0182219_10625892	3300017424	Miscanthus Phyllosphere	MRNEILIPSAAVPNAFFLGPMGDSDPSDFIRQETNQIPFK
Ga0182219_10775791	3300017424	Miscanthus Phyllosphere	MRNEILIPSAIASNVYFIGPMGDLNPSDFIHQEINQIPFKQSIVDLSS
Ga0182219_10805911	3300017424	Miscanthus Phyllosphere	NEILIPSAVVPNIYYLGPMGDPDLSDFIRQKPTKSPSNNL
Ga0182219_10965511	3300017424	Miscanthus Phyllosphere	MRNEILTPSAVVPNACYLGPMGNPDPSDFINQETNRIPFK
Ga0182219_11053271	3300017424	Miscanthus Phyllosphere	MRNEILIPLAIVPNVYFLGPMGDLDPSDFIFQETNQIPFKQSVVDSSSWNKT
Ga0182219_11199611	3300017424	Miscanthus Phyllosphere	MRNEILIPSAVASNIYFLGPMGDPDPSDFIRQETNQIPFKHYVVDSSS
Ga0182219_11337062	3300017424	Miscanthus Phyllosphere	MRNKILIPSAAIPNVYFLGPMGDLDPFDFIRQETNQIPFK
Ga0182224_10747301	3300017425	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDLDLSDFIHQETNQIPFKQSVVGLPS
Ga0182224_10935311	3300017425	Miscanthus Phyllosphere	MRNEIWIPSAVVANAYYLGPMGDSDPSNFINKETNRISFKQSVIDLSF
Ga0182224_10981001	3300017425	Miscanthus Phyllosphere	MRNEILIPSIVVPNAYYLRLMGDPDPSDFINQETNQIPFKQSIVDLSS
Ga0182224_11018801	3300017425	Miscanthus Phyllosphere	MIPSAVAPNVYFLGPMGDLDPSDFIRQETNQIPFKQSVVDSPS
Ga0182224_11255692	3300017425	Miscanthus Phyllosphere	MRNEILIPSVVVPNAYFLGPMGDSDPSDFIRQETNQI
Ga0182190_10233642	3300017427	Miscanthus Phyllosphere	MRNEILIPSAVAPNIYFLGPMGNPDPSDFIRQEINQIPFKQSTVDLSSWNTKTLFRNWPKMPKG
Ga0182190_10294472	3300017427	Miscanthus Phyllosphere	MRNETLIPSAVVPNAYFLGHMGDPDPSDFIHQETNQIPFKQSAVDSSS
Ga0182190_10529511	3300017427	Miscanthus Phyllosphere	MKNEILIPSAIVPNAYYLEPMGDPDPSDFINQETNXIPFKQSVVDLSS
Ga0182190_10802711	3300017427	Miscanthus Phyllosphere	MKDEILIPSAVIPNAYFLGSMGDPNSSDFICQETNQIPFKRSIVDS
Ga0182190_10890502	3300017427	Miscanthus Phyllosphere	MRNKILIPSVVVPSAYYLRPMGNPDPSNFINQETN
Ga0182190_10978461	3300017427	Miscanthus Phyllosphere	EIRNEILIPSTVASNVYFLGPMGDPDPSNFIRQETNQIPFKQSVVDLSS
Ga0182190_11033391	3300017427	Miscanthus Phyllosphere	MRNDILIPSAVASNVYYLGPMGDPNPSDFINQETNR
Ga0182190_11131592	3300017427	Miscanthus Phyllosphere	MKNEILVPSAVAPNVYFLGPMGDPDPSDFIYQEINQIPFKQYVVDSTSWNTKTPFRN
Ga0182190_11283691	3300017427	Miscanthus Phyllosphere	MRNEILIPSVIAPNVYFLGPMGDSDPSDFIYQETNQISLKQSAVDSSSWSTKTPFRN
Ga0182190_11297121	3300017427	Miscanthus Phyllosphere	MRNEILIPSAIVPNVYFLRPIGDLDPSDFICQETNQIP
Ga0182190_11377602	3300017427	Miscanthus Phyllosphere	LIPLVVAPNVYFLGPMGDLDPSDFICQETNQIPFKQYVVGLSSWNTKTPFRNWPKM
Ga0182190_11549751	3300017427	Miscanthus Phyllosphere	MRKEILIPSAIVPNAYYLRPMGDPDPSDFINQETNRIS
Ga0182192_10643901	3300017430	Miscanthus Phyllosphere	MRKEILIPSAIVPNTYYLGPMGDLDPSDFINQETN
Ga0182192_10645381	3300017430	Miscanthus Phyllosphere	MRNEILIPSTIVPNTYYLGPMGDPNPSDFINQEINRIPFKQSIIDLSS
Ga0182192_10797831	3300017430	Miscanthus Phyllosphere	MRNEILIPSAAASNVYFLGPTGDPDPSNFIHQETNQFPFKQPAVDLSSWNTKT
Ga0182192_11035541	3300017430	Miscanthus Phyllosphere	MRNKILIPSAIASNIYFLGPMGDPDRSDFIHQEANQIPFKQSAVDLSSWNTK
Ga0182192_11259041	3300017430	Miscanthus Phyllosphere	MENEILIPSSVIPNAYYLGLMGDTNHSDFINQETNQIPFRQSLVGLSS
Ga0182192_11358581	3300017430	Miscanthus Phyllosphere	MRNKILISSAIVSNAYYLGPMGDPDPSDFITQETNQIPFKQSIIDLPT
Ga0182192_11522021	3300017430	Miscanthus Phyllosphere	SAIVPSVYFLGPMGDPDPSDFIHQETNQIPFKQSVVDSSS
Ga0182206_10450951	3300017433	Miscanthus Phyllosphere	MRNEILIPSAVASNIYFLGPMGDLDPYDFIRQETNQILFKQSAVVLSSWNTKTLFRNWPKMPK
Ga0182206_11060131	3300017433	Miscanthus Phyllosphere	LISSAVTPNVYFLRPMGDPDPSDFIHQETNQIPFKKSVVDLSSWNTKTPFRNWPKI
Ga0182209_10391062	3300017436	Miscanthus Phyllosphere	MRNGILIPSSVAPNVYFFGPMGDPDPSDFIRQETNQIPFKQSMVDLSTWN
Ga0182209_10586811	3300017436	Miscanthus Phyllosphere	MRNEILILSAVAPNVYFLGPVGDPDPSDFVYQETNQISFKQSVVDLSF
Ga0182209_11307901	3300017436	Miscanthus Phyllosphere	MENEILIPSSVIPNAYYLRPMGDTNPSDFINQETNQIPFK
Ga0182191_10469181	3300017438	Miscanthus Phyllosphere	MSNEILIPSVVAPNIYFLGPMGDPDPSDFIRQETNQIPFKQSIVDSSS
Ga0182191_10694811	3300017438	Miscanthus Phyllosphere	MENEILIPSFIVPNAYYLGPMGDADPLDFIKQETNQIPFRQSLVDLSSWNTKNPFRN
Ga0182191_10767181	3300017438	Miscanthus Phyllosphere	MKNEILIPSTVVPNAYFLRPMGDPDPSDFICQETHQIPFKRSVVDLSSWNKTP
Ga0182191_11044082	3300017438	Miscanthus Phyllosphere	MGNEFLIPSAIVPNAYYLGPMGDPDLSDFINQETNR
Ga0182191_11126251	3300017438	Miscanthus Phyllosphere	MMNKILIPSASAPNVYFLGPMGDPDPSDFIYQETN
Ga0182191_11359641	3300017438	Miscanthus Phyllosphere	MRNEILIPSAAIPNVYFLGPMGDLDPFDFIRQETNQIP
Ga0182191_11464052	3300017438	Miscanthus Phyllosphere	MRNEILIPSAIVPNTYYLGPMGDPNPSDFINQEINRIPFKQSIIDLSS
Ga0182191_11733261	3300017438	Miscanthus Phyllosphere	IPSSVAPNIYFLGPMGDPDPSDFIRQETNRIPFKQSVVDLSSWNTKTPFRN
Ga0182191_11786131	3300017438	Miscanthus Phyllosphere	MLIPSVVVPNAYYLGPIGNPDPSDFINQQTNQIPFKQSVVDLSS
Ga0182221_10647831	3300017442	Miscanthus Phyllosphere	MRNQILIPSAVVPNVYYLRPMGDPNPSDFISQETNQIPFKQSIVDLSSWNTKT
Ga0182221_10862431	3300017442	Miscanthus Phyllosphere	MRNEILIPSAAIPNVYFLGTMGDPDPSDFIRQETNQIPFKQSVVDSSSWNKTPFRNWPKT
Ga0182221_10992171	3300017442	Miscanthus Phyllosphere	MRNEILIPSVVIPNAYFLGPMGDPDPSDFIRQETNQIPFKQS
Ga0182221_11118271	3300017442	Miscanthus Phyllosphere	MRNEILIPSAVVPNVYFLRPMGDPDPFDFICQETNQIP
Ga0182221_11281383	3300017442	Miscanthus Phyllosphere	MRNKILIPSAVLPNAYYLGPMGDPDPSDFINQETN
Ga0182193_10897902	3300017443	Miscanthus Phyllosphere	MRNKILIPSAVVPNTYYLGPKGDPDPSDFINQETNQIPFKQSI
Ga0182193_10978141	3300017443	Miscanthus Phyllosphere	MENKILIPSSVVPNAYYLGPMGDANPLDFINQETNQIPFR
Ga0182193_11302101	3300017443	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGPMGDPDPSDFIHQETNQIPFKRSTVDLSSWNTKTLFRNW
Ga0182193_11487051	3300017443	Miscanthus Phyllosphere	MENEILIPSFIVPNAYYLGPMGDADPLDFIKQETNQIPFRQSSVDLSS
Ga0182193_11533451	3300017443	Miscanthus Phyllosphere	MRNEVLIPSAVVSNVYFHGPMGDSDPSDFIRQETNQIPFKQSAVDLSSWTIKTSFKNWPK
Ga0182193_11578401	3300017443	Miscanthus Phyllosphere	MRNKILIPSAVVPNTYYLGPMDDPDPSDFINQETNQIPFKQSVIDAYSS
Ga0182193_11839191	3300017443	Miscanthus Phyllosphere	ILIPSAVVPNAYYLGPMCDPDPSDFINQETNQIPFKQSVIDLSS
Ga0182233_10558341	3300017680	Miscanthus Phyllosphere	MRNEILIPSTIASNIYFLGPMGDPDPSDFIYQETNQIPFKQSVVDLSS
Ga0182233_10766891	3300017680	Miscanthus Phyllosphere	MRNEILIPSAITSNVYFLGPIGDPDPSDFIHQETNQI
Ga0182229_10784191	3300017682	Miscanthus Phyllosphere	MRNEILIPSAVVPNTYYLGPMGDPDPSDFIKQETNRIPFKQYVVDLSY
Ga0182218_10376511	3300017683	Miscanthus Phyllosphere	MKNEILIPSAVVPNAYFLGPMGDPDPSDFIYQETNQ
Ga0182218_10568641	3300017683	Miscanthus Phyllosphere	MRDEILIPSDVVPNIYFLGPMGDPDPSDFIRQETNQTPFKQYI
Ga0182218_10590161	3300017683	Miscanthus Phyllosphere	MRNKILIPSAVASNVYFLGPMGDPDPSDFIYQETSQIPFKQSVVD
Ga0182218_10670501	3300017683	Miscanthus Phyllosphere	LIPSAIVPNTYYLGPMGDPDLSEFINQETNQIPFKQSVIDLSS
Ga0182218_10772492	3300017683	Miscanthus Phyllosphere	MRNKILISSVVVPNAYYLKPMGDPDPSDFIIQETNQIPFKQSVIDLST
Ga0182218_10793321	3300017683	Miscanthus Phyllosphere	MRNEILIPSASAPNVYFLGPMGDPNPFDFIXQETNQIPFKQFIVDSSSWSTKT
Ga0182218_11014961	3300017683	Miscanthus Phyllosphere	MRNEILIPLAVTSNVYFLGPMGDPDPFDFIRQETNQIPFKRFVVDLSSWNIKT
Ga0182218_11113802	3300017683	Miscanthus Phyllosphere	AVAPNVYFLGPMDDPDPSDFICQETNQILFKQSVVDSSS
Ga0182218_11165851	3300017683	Miscanthus Phyllosphere	MRNEILIPSVVVPNAYYLVPIGDPNPSDFINQETNRIPFKQSVIDLSS
Ga0182218_11475121	3300017683	Miscanthus Phyllosphere	MRNKILILSVVVPNAYYLGSMGDPDPSDFINQETNRIPFKQSVI
Ga0182225_10289571	3300017684	Miscanthus Phyllosphere	MRNEILIPTVVASSIYFLGPMGDPDPSDFICQGTNQI
Ga0182225_10291441	3300017684	Miscanthus Phyllosphere	MRNEILIPSAAVPNAYFLRPMGDSDPSDFIRQETNQIPFKQSVVDSSS
Ga0182225_10373481	3300017684	Miscanthus Phyllosphere	MRNEILIPSAVASNVYFLGPMGDLDPSDFICQETNQIPFKQ
Ga0182225_10497431	3300017684	Miscanthus Phyllosphere	MRNEILIPSAVTSDAYFLGPMGDFDPSDFIHQKTN
Ga0182225_10536472	3300017684	Miscanthus Phyllosphere	EILIPSVVASNIYFLGPMGDPDPSDFIRQETNQIPFKQSTVDLSS
Ga0182225_10628652	3300017684	Miscanthus Phyllosphere	MKNEILIPSAVVPNDYFLGPMDDPDPSDFICQETN
Ga0182225_10768852	3300017684	Miscanthus Phyllosphere	MENEILNHSSVVPNAYYLRPMGDTNPLDFINQETNQIPFK
Ga0182225_10841581	3300017684	Miscanthus Phyllosphere	MRDEILISSAVAPNIYFLGPMGDPDPSDFICQETNQIPF
Ga0182225_11013421	3300017684	Miscanthus Phyllosphere	MRNEILIPSAVAPNIYFLGTMGDPNPSDFIRQETN
Ga0182225_11064541	3300017684	Miscanthus Phyllosphere	MRNEIWISLAVVANAYYLGPMGDPDPSNFINQETNRIPFKQSVIDLSS
Ga0182225_11225111	3300017684	Miscanthus Phyllosphere	MENEILIPSFVVPNAYYLGPMGDANPLDFISQETNRITFRQSLADLSSWNTKSP
Ga0182225_11375541	3300017684	Miscanthus Phyllosphere	MKNEILIPSSVIPNVYYLGPMGDTNPLDFINQETNQIPFKQSLVDLSS
Ga0182227_10984941	3300017685	Miscanthus Phyllosphere	MRNKILIPSAVVPNTYYLGPMGDPDLSDFINQEIN
Ga0182205_10611951	3300017686	Miscanthus Phyllosphere	MRNEILIPLAIVPNVYFLGPMGDPDPSDFICQETNQIP
Ga0182205_11076682	3300017686	Miscanthus Phyllosphere	MRNEILIPSAAASNVYFLGPTGDPDPSNFIHQETNQIPFK
Ga0182205_11175781	3300017686	Miscanthus Phyllosphere	MRNKILIPSVVVPNTYYLGPMGDSDPYNFINQETN
Ga0182231_10304622	3300017689	Miscanthus Phyllosphere	MRNKIMIPSAVVPNVYFLKPMGDPDPSDFVRQETNQIPFKQSVVDSSS
Ga0182231_10522042	3300017689	Miscanthus Phyllosphere	MRNEILIPSAIVPNTYYLGPMGDPDPSDFINQETN
Ga0182231_10974691	3300017689	Miscanthus Phyllosphere	MRNKILISLAIVPNTYYLGPMGDPNPSDSINQETNQ
Ga0182223_10407923	3300017690	Miscanthus Phyllosphere	MRNEILIPLAVVPNAYYLGPMGDPDPSDFINQETNXIPFKQSIVNL
Ga0182223_10639431	3300017690	Miscanthus Phyllosphere	MENEILIPSSVVPNAYYLGPMGDANPLDFINQETNQIPFRQSLVDLSS
Ga0182223_10750421	3300017690	Miscanthus Phyllosphere	MRNDILILSAVAPNVYFLGPMGDPDPSNFVHQETNQIPFKQSVVDSSS
Ga0182223_11140471	3300017690	Miscanthus Phyllosphere	MRNEILIPVAVASNIYFLGPMGDLDPSDFICQETNQIPFKQSAVDL
Ga0182223_11144181	3300017690	Miscanthus Phyllosphere	EILIPSAAIPNVYFLGPMGDPDPSDFICQETNQIPFKQSVVDSSS
Ga0182223_11223791	3300017690	Miscanthus Phyllosphere	EILIPSAVAPNVYYLGPMGDPDRSNFISQETNQIPFKQSVVDLSSWNTKTPFRN
Ga0207642_108818601	3300025899	Miscanthus Rhizosphere	MRNDILIPSAVVPNAYYFGPVGDPDPSDFINKETNQSPSNNL
Ga0207643_108993951	3300025908	Miscanthus Rhizosphere	AIVPNAYYLGPMGDPDPSNFFNQETNRIPFKQSIVDLSSWNTKTNFRN
Ga0207709_113849551	3300025935	Miscanthus Rhizosphere	MRNKILIPSAVAPNVYFLGPMGDLDPSDFIRQETNQIPFKQSV
Ga0207689_105490371	3300025942	Miscanthus Rhizosphere	SAVASNVYFLGPMGDSDPYDFIRQETNQIPFNQSAVDLSS
Ga0207648_122152162	3300026089	Miscanthus Rhizosphere	MENEILIPSSVVPNAYYIGPMGDDNPSDFINQETNQIPFR