| Basic Information | |
|---|---|
| Family ID | F003431 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 487 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MMTKGIIAVAAAFMFALTVGILTAESGNDRASNPTIRTLALQY |
| Number of Associated Samples | 223 |
| Number of Associated Scaffolds | 487 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.81 % |
| % of genes near scaffold ends (potentially truncated) | 38.81 % |
| % of genes from short scaffolds (< 2000 bps) | 91.79 % |
| Associated GOLD sequencing projects | 199 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.388 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (18.480 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.094 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.503 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 487 Family Scaffolds |
|---|---|---|
| PF07045 | DUF1330 | 4.93 |
| PF04392 | ABC_sub_bind | 1.64 |
| PF05443 | ROS_MUCR | 1.03 |
| PF07883 | Cupin_2 | 1.03 |
| PF01068 | DNA_ligase_A_M | 1.03 |
| PF00043 | GST_C | 0.82 |
| PF13358 | DDE_3 | 0.41 |
| PF08734 | GYD | 0.41 |
| PF07813 | LTXXQ | 0.41 |
| PF10108 | DNA_pol_B_exo2 | 0.41 |
| PF01381 | HTH_3 | 0.41 |
| PF00589 | Phage_integrase | 0.41 |
| PF05199 | GMC_oxred_C | 0.41 |
| PF13565 | HTH_32 | 0.41 |
| PF02798 | GST_N | 0.21 |
| PF13185 | GAF_2 | 0.21 |
| PF09821 | AAA_assoc_C | 0.21 |
| PF08706 | D5_N | 0.21 |
| PF13467 | RHH_4 | 0.21 |
| PF00313 | CSD | 0.21 |
| PF13289 | SIR2_2 | 0.21 |
| PF07676 | PD40 | 0.21 |
| PF10335 | DUF294_C | 0.21 |
| PF03972 | MmgE_PrpD | 0.21 |
| PF13340 | DUF4096 | 0.21 |
| PF13240 | zinc_ribbon_2 | 0.21 |
| PF01391 | Collagen | 0.21 |
| PF03733 | YccF | 0.21 |
| PF02899 | Phage_int_SAM_1 | 0.21 |
| PF07040 | DUF1326 | 0.21 |
| PF13924 | Lipocalin_5 | 0.21 |
| PF00126 | HTH_1 | 0.21 |
| PF12625 | Arabinose_bd | 0.21 |
| PF13481 | AAA_25 | 0.21 |
| PF03401 | TctC | 0.21 |
| PF00162 | PGK | 0.21 |
| PF00034 | Cytochrom_C | 0.21 |
| PF00583 | Acetyltransf_1 | 0.21 |
| PF13336 | AcetylCoA_hyd_C | 0.21 |
| PF13439 | Glyco_transf_4 | 0.21 |
| PF05977 | MFS_3 | 0.21 |
| PF13517 | FG-GAP_3 | 0.21 |
| PF00174 | Oxidored_molyb | 0.21 |
| PF14659 | Phage_int_SAM_3 | 0.21 |
| PF13430 | DUF4112 | 0.21 |
| PF13701 | DDE_Tnp_1_4 | 0.21 |
| PF01609 | DDE_Tnp_1 | 0.21 |
| PF13333 | rve_2 | 0.21 |
| PF08327 | AHSA1 | 0.21 |
| PF00872 | Transposase_mut | 0.21 |
| COG ID | Name | Functional Category | % Frequency in 487 Family Scaffolds |
|---|---|---|---|
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 4.93 |
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.64 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 1.03 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.03 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 1.03 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.82 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.41 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.41 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.21 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.21 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.21 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.21 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.21 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.21 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.21 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.21 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 0.21 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.21 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.21 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.21 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.21 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.21 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.21 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.39 % |
| All Organisms | root | All Organisms | 46.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17342963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1982 | Open in IMG/M |
| 2088090014|GPIPI_17438662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB12 | 2086 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig152879 | Not Available | 525 | Open in IMG/M |
| 2170459013|GO6OHWN01EJ89P | Not Available | 508 | Open in IMG/M |
| 2170459024|GZRSKLJ01BYZD6 | Not Available | 520 | Open in IMG/M |
| 3300000156|NODE_c0547848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1050852 | Not Available | 604 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10054927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1028 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10070948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris | 882 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10114602 | Not Available | 659 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1008428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1370 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10022647 | Not Available | 1500 | Open in IMG/M |
| 3300000955|JGI1027J12803_101931392 | Not Available | 536 | Open in IMG/M |
| 3300000955|JGI1027J12803_102030372 | Not Available | 628 | Open in IMG/M |
| 3300000956|JGI10216J12902_108878765 | Not Available | 541 | Open in IMG/M |
| 3300002915|JGI25387J43893_1011973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1191 | Open in IMG/M |
| 3300004268|Ga0066398_10104166 | Not Available | 662 | Open in IMG/M |
| 3300004479|Ga0062595_100747700 | Not Available | 795 | Open in IMG/M |
| 3300004633|Ga0066395_10068567 | Not Available | 1626 | Open in IMG/M |
| 3300004633|Ga0066395_10072496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1590 | Open in IMG/M |
| 3300004633|Ga0066395_10536978 | Not Available | 678 | Open in IMG/M |
| 3300005160|Ga0066820_1009252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300005167|Ga0066672_10139770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1512 | Open in IMG/M |
| 3300005172|Ga0066683_10140569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1479 | Open in IMG/M |
| 3300005174|Ga0066680_10496838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300005177|Ga0066690_10416413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300005181|Ga0066678_10673661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300005184|Ga0066671_10730684 | Not Available | 638 | Open in IMG/M |
| 3300005332|Ga0066388_100362395 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300005332|Ga0066388_100483042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1877 | Open in IMG/M |
| 3300005332|Ga0066388_100536839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1801 | Open in IMG/M |
| 3300005332|Ga0066388_100618334 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300005332|Ga0066388_100650048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1669 | Open in IMG/M |
| 3300005332|Ga0066388_100827744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1514 | Open in IMG/M |
| 3300005332|Ga0066388_100833218 | Not Available | 1510 | Open in IMG/M |
| 3300005332|Ga0066388_101031823 | Not Available | 1382 | Open in IMG/M |
| 3300005332|Ga0066388_101073867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
| 3300005332|Ga0066388_101260210 | Not Available | 1270 | Open in IMG/M |
| 3300005332|Ga0066388_101528893 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005332|Ga0066388_101565310 | Not Available | 1157 | Open in IMG/M |
| 3300005332|Ga0066388_101622938 | Not Available | 1139 | Open in IMG/M |
| 3300005332|Ga0066388_101639170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1134 | Open in IMG/M |
| 3300005332|Ga0066388_101663086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1127 | Open in IMG/M |
| 3300005332|Ga0066388_101736100 | Not Available | 1106 | Open in IMG/M |
| 3300005332|Ga0066388_102002085 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005332|Ga0066388_102005657 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005332|Ga0066388_102035273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1031 | Open in IMG/M |
| 3300005332|Ga0066388_102150223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1005 | Open in IMG/M |
| 3300005332|Ga0066388_102315416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300005332|Ga0066388_102555142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300005332|Ga0066388_102844151 | Not Available | 884 | Open in IMG/M |
| 3300005332|Ga0066388_103241809 | Not Available | 831 | Open in IMG/M |
| 3300005332|Ga0066388_103603129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300005332|Ga0066388_103622297 | Not Available | 788 | Open in IMG/M |
| 3300005332|Ga0066388_103623287 | Not Available | 788 | Open in IMG/M |
| 3300005332|Ga0066388_103863609 | Not Available | 764 | Open in IMG/M |
| 3300005332|Ga0066388_104506041 | Not Available | 709 | Open in IMG/M |
| 3300005332|Ga0066388_104572405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300005332|Ga0066388_104719694 | Not Available | 693 | Open in IMG/M |
| 3300005332|Ga0066388_104830349 | Not Available | 685 | Open in IMG/M |
| 3300005332|Ga0066388_105277057 | Not Available | 655 | Open in IMG/M |
| 3300005332|Ga0066388_105391000 | Not Available | 648 | Open in IMG/M |
| 3300005332|Ga0066388_105405436 | Not Available | 647 | Open in IMG/M |
| 3300005332|Ga0066388_105607702 | Not Available | 635 | Open in IMG/M |
| 3300005332|Ga0066388_106726326 | Not Available | 579 | Open in IMG/M |
| 3300005332|Ga0066388_106787822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300005332|Ga0066388_107421312 | Not Available | 550 | Open in IMG/M |
| 3300005332|Ga0066388_107541039 | Not Available | 546 | Open in IMG/M |
| 3300005332|Ga0066388_107700598 | Not Available | 540 | Open in IMG/M |
| 3300005332|Ga0066388_107761773 | Not Available | 537 | Open in IMG/M |
| 3300005332|Ga0066388_108700117 | Not Available | 504 | Open in IMG/M |
| 3300005339|Ga0070660_101846520 | Not Available | 515 | Open in IMG/M |
| 3300005355|Ga0070671_101818522 | Not Available | 541 | Open in IMG/M |
| 3300005356|Ga0070674_100766834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 830 | Open in IMG/M |
| 3300005363|Ga0008090_10109660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1640 | Open in IMG/M |
| 3300005434|Ga0070709_10041576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2833 | Open in IMG/M |
| 3300005434|Ga0070709_10657993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 812 | Open in IMG/M |
| 3300005435|Ga0070714_100367639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1353 | Open in IMG/M |
| 3300005435|Ga0070714_101195897 | Not Available | 741 | Open in IMG/M |
| 3300005435|Ga0070714_101666380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300005435|Ga0070714_101908012 | Not Available | 580 | Open in IMG/M |
| 3300005436|Ga0070713_101868254 | Not Available | 583 | Open in IMG/M |
| 3300005437|Ga0070710_10368738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 955 | Open in IMG/M |
| 3300005444|Ga0070694_100578850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 902 | Open in IMG/M |
| 3300005467|Ga0070706_100232381 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300005467|Ga0070706_101705920 | Not Available | 573 | Open in IMG/M |
| 3300005468|Ga0070707_102105163 | Not Available | 532 | Open in IMG/M |
| 3300005518|Ga0070699_100031180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4602 | Open in IMG/M |
| 3300005518|Ga0070699_100156380 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300005536|Ga0070697_100274060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1447 | Open in IMG/M |
| 3300005546|Ga0070696_100573304 | Not Available | 907 | Open in IMG/M |
| 3300005546|Ga0070696_101468775 | Not Available | 583 | Open in IMG/M |
| 3300005553|Ga0066695_10323714 | Not Available | 969 | Open in IMG/M |
| 3300005554|Ga0066661_10736339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300005556|Ga0066707_10164830 | Not Available | 1413 | Open in IMG/M |
| 3300005561|Ga0066699_10583425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300005713|Ga0066905_100067891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2279 | Open in IMG/M |
| 3300005713|Ga0066905_100110291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1892 | Open in IMG/M |
| 3300005713|Ga0066905_100349962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1180 | Open in IMG/M |
| 3300005713|Ga0066905_100454042 | Not Available | 1054 | Open in IMG/M |
| 3300005713|Ga0066905_100458011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1050 | Open in IMG/M |
| 3300005713|Ga0066905_100719427 | Not Available | 859 | Open in IMG/M |
| 3300005713|Ga0066905_101179962 | Not Available | 683 | Open in IMG/M |
| 3300005713|Ga0066905_101211165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300005713|Ga0066905_101335410 | Not Available | 646 | Open in IMG/M |
| 3300005713|Ga0066905_101413057 | Not Available | 630 | Open in IMG/M |
| 3300005713|Ga0066905_101610079 | Not Available | 594 | Open in IMG/M |
| 3300005713|Ga0066905_101733165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300005713|Ga0066905_101796291 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005713|Ga0066905_102058944 | Not Available | 530 | Open in IMG/M |
| 3300005713|Ga0066905_102315421 | Not Available | 502 | Open in IMG/M |
| 3300005764|Ga0066903_100092812 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
| 3300005764|Ga0066903_100299352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2543 | Open in IMG/M |
| 3300005764|Ga0066903_100632199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1865 | Open in IMG/M |
| 3300005764|Ga0066903_100723776 | Not Available | 1760 | Open in IMG/M |
| 3300005764|Ga0066903_101537558 | Not Available | 1258 | Open in IMG/M |
| 3300005764|Ga0066903_101766189 | Not Available | 1180 | Open in IMG/M |
| 3300005764|Ga0066903_101815245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1165 | Open in IMG/M |
| 3300005764|Ga0066903_102144203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1077 | Open in IMG/M |
| 3300005764|Ga0066903_102183156 | Not Available | 1067 | Open in IMG/M |
| 3300005764|Ga0066903_102853613 | Not Available | 937 | Open in IMG/M |
| 3300005764|Ga0066903_103667040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300005764|Ga0066903_103692916 | Not Available | 823 | Open in IMG/M |
| 3300005764|Ga0066903_103710795 | Not Available | 821 | Open in IMG/M |
| 3300005764|Ga0066903_104755651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 722 | Open in IMG/M |
| 3300005764|Ga0066903_104830546 | Not Available | 716 | Open in IMG/M |
| 3300005764|Ga0066903_104843657 | Not Available | 715 | Open in IMG/M |
| 3300005764|Ga0066903_104947320 | Not Available | 707 | Open in IMG/M |
| 3300005764|Ga0066903_106378319 | Not Available | 615 | Open in IMG/M |
| 3300005764|Ga0066903_106943417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300005764|Ga0066903_107078614 | Not Available | 581 | Open in IMG/M |
| 3300005764|Ga0066903_107440843 | Not Available | 565 | Open in IMG/M |
| 3300005764|Ga0066903_107698831 | Not Available | 554 | Open in IMG/M |
| 3300005764|Ga0066903_108692770 | Not Available | 516 | Open in IMG/M |
| 3300005764|Ga0066903_108835714 | Not Available | 511 | Open in IMG/M |
| 3300005764|Ga0066903_109033064 | Not Available | 504 | Open in IMG/M |
| 3300005983|Ga0081540_1134937 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1001 | Open in IMG/M |
| 3300005983|Ga0081540_1234394 | Not Available | 646 | Open in IMG/M |
| 3300006038|Ga0075365_10678306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 728 | Open in IMG/M |
| 3300006046|Ga0066652_100226814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1622 | Open in IMG/M |
| 3300006046|Ga0066652_101232170 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006172|Ga0075018_10616161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 579 | Open in IMG/M |
| 3300006173|Ga0070716_101077832 | Not Available | 639 | Open in IMG/M |
| 3300006173|Ga0070716_101432347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300006175|Ga0070712_100129010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1914 | Open in IMG/M |
| 3300006175|Ga0070712_100509729 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium | 1009 | Open in IMG/M |
| 3300006175|Ga0070712_100558748 | Not Available | 965 | Open in IMG/M |
| 3300006175|Ga0070712_100685760 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300006175|Ga0070712_100911056 | Not Available | 758 | Open in IMG/M |
| 3300006175|Ga0070712_101415804 | Not Available | 607 | Open in IMG/M |
| 3300006794|Ga0066658_10337418 | Not Available | 805 | Open in IMG/M |
| 3300006796|Ga0066665_11038816 | Not Available | 626 | Open in IMG/M |
| 3300006797|Ga0066659_10352985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina → Thiocapsa marina 5811 | 1141 | Open in IMG/M |
| 3300006797|Ga0066659_10914409 | Not Available | 733 | Open in IMG/M |
| 3300006800|Ga0066660_11157919 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006806|Ga0079220_10323133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
| 3300006852|Ga0075433_11590814 | Not Available | 564 | Open in IMG/M |
| 3300006854|Ga0075425_101058751 | Not Available | 924 | Open in IMG/M |
| 3300006903|Ga0075426_10792163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300006904|Ga0075424_101022666 | Not Available | 881 | Open in IMG/M |
| 3300006914|Ga0075436_101018573 | Not Available | 622 | Open in IMG/M |
| 3300006935|Ga0081246_1162196 | Not Available | 589 | Open in IMG/M |
| 3300007076|Ga0075435_100861392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300007255|Ga0099791_10532151 | Not Available | 572 | Open in IMG/M |
| 3300007258|Ga0099793_10448871 | Not Available | 637 | Open in IMG/M |
| 3300009012|Ga0066710_104531079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 519 | Open in IMG/M |
| 3300009089|Ga0099828_10300282 | Not Available | 1444 | Open in IMG/M |
| 3300009090|Ga0099827_10330399 | Not Available | 1294 | Open in IMG/M |
| 3300009090|Ga0099827_11598462 | Not Available | 568 | Open in IMG/M |
| 3300009094|Ga0111539_12297857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300009137|Ga0066709_100213566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2547 | Open in IMG/M |
| 3300009143|Ga0099792_10959708 | Not Available | 569 | Open in IMG/M |
| 3300009147|Ga0114129_10395233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1823 | Open in IMG/M |
| 3300009147|Ga0114129_12764321 | Not Available | 584 | Open in IMG/M |
| 3300009156|Ga0111538_12084860 | Not Available | 713 | Open in IMG/M |
| 3300009176|Ga0105242_12632328 | Not Available | 552 | Open in IMG/M |
| 3300009792|Ga0126374_10006836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4169 | Open in IMG/M |
| 3300009792|Ga0126374_10275733 | Not Available | 1113 | Open in IMG/M |
| 3300009792|Ga0126374_10533518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 853 | Open in IMG/M |
| 3300009792|Ga0126374_10556038 | Not Available | 838 | Open in IMG/M |
| 3300009792|Ga0126374_10744648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300009792|Ga0126374_10828453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 710 | Open in IMG/M |
| 3300009792|Ga0126374_10888708 | Not Available | 689 | Open in IMG/M |
| 3300009792|Ga0126374_10995465 | Not Available | 657 | Open in IMG/M |
| 3300009792|Ga0126374_11081582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum gryphiswaldense → Magnetospirillum gryphiswaldense MSR-1 | 635 | Open in IMG/M |
| 3300010043|Ga0126380_10046389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2317 | Open in IMG/M |
| 3300010043|Ga0126380_10224780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1278 | Open in IMG/M |
| 3300010043|Ga0126380_10239436 | Not Available | 1247 | Open in IMG/M |
| 3300010043|Ga0126380_10420464 | Not Available | 1000 | Open in IMG/M |
| 3300010043|Ga0126380_10546579 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300010043|Ga0126380_10564965 | Not Available | 888 | Open in IMG/M |
| 3300010043|Ga0126380_11375450 | Not Available | 619 | Open in IMG/M |
| 3300010046|Ga0126384_10204674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1565 | Open in IMG/M |
| 3300010046|Ga0126384_10246589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
| 3300010046|Ga0126384_10788061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300010046|Ga0126384_11044218 | Not Available | 746 | Open in IMG/M |
| 3300010046|Ga0126384_11229905 | Not Available | 692 | Open in IMG/M |
| 3300010046|Ga0126384_11373869 | Not Available | 658 | Open in IMG/M |
| 3300010046|Ga0126384_11862289 | Not Available | 572 | Open in IMG/M |
| 3300010046|Ga0126384_12129789 | Not Available | 539 | Open in IMG/M |
| 3300010047|Ga0126382_10160918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1550 | Open in IMG/M |
| 3300010047|Ga0126382_10559156 | Not Available | 933 | Open in IMG/M |
| 3300010047|Ga0126382_10907370 | Not Available | 763 | Open in IMG/M |
| 3300010047|Ga0126382_10991287 | Not Available | 735 | Open in IMG/M |
| 3300010047|Ga0126382_11134656 | Not Available | 695 | Open in IMG/M |
| 3300010047|Ga0126382_11691660 | Not Available | 590 | Open in IMG/M |
| 3300010047|Ga0126382_12147951 | Not Available | 536 | Open in IMG/M |
| 3300010048|Ga0126373_10475643 | Not Available | 1288 | Open in IMG/M |
| 3300010048|Ga0126373_11693545 | Not Available | 696 | Open in IMG/M |
| 3300010048|Ga0126373_12298818 | Not Available | 600 | Open in IMG/M |
| 3300010048|Ga0126373_12376015 | Not Available | 590 | Open in IMG/M |
| 3300010335|Ga0134063_10757444 | Not Available | 506 | Open in IMG/M |
| 3300010358|Ga0126370_10078531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2210 | Open in IMG/M |
| 3300010358|Ga0126370_10275733 | Not Available | 1319 | Open in IMG/M |
| 3300010358|Ga0126370_10514658 | Not Available | 1014 | Open in IMG/M |
| 3300010358|Ga0126370_10810390 | Not Available | 836 | Open in IMG/M |
| 3300010358|Ga0126370_11083252 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 737 | Open in IMG/M |
| 3300010358|Ga0126370_11790647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300010359|Ga0126376_10017788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4582 | Open in IMG/M |
| 3300010359|Ga0126376_10546157 | Not Available | 1083 | Open in IMG/M |
| 3300010359|Ga0126376_11363512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300010359|Ga0126376_11625857 | Not Available | 679 | Open in IMG/M |
| 3300010359|Ga0126376_13215977 | Not Available | 505 | Open in IMG/M |
| 3300010359|Ga0126376_13273687 | Not Available | 501 | Open in IMG/M |
| 3300010360|Ga0126372_10282409 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300010360|Ga0126372_11470657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300010360|Ga0126372_13315364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300010361|Ga0126378_10402049 | Not Available | 1482 | Open in IMG/M |
| 3300010361|Ga0126378_10828973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1034 | Open in IMG/M |
| 3300010361|Ga0126378_12793413 | Not Available | 558 | Open in IMG/M |
| 3300010362|Ga0126377_10680195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1080 | Open in IMG/M |
| 3300010362|Ga0126377_11381568 | Not Available | 777 | Open in IMG/M |
| 3300010362|Ga0126377_12728397 | Not Available | 569 | Open in IMG/M |
| 3300010366|Ga0126379_10497982 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300010366|Ga0126379_11182241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 871 | Open in IMG/M |
| 3300010366|Ga0126379_11749940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300010366|Ga0126379_12160474 | Not Available | 658 | Open in IMG/M |
| 3300010371|Ga0134125_10430062 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300010375|Ga0105239_11174441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 884 | Open in IMG/M |
| 3300010376|Ga0126381_100137219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3192 | Open in IMG/M |
| 3300010376|Ga0126381_101041694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1181 | Open in IMG/M |
| 3300010376|Ga0126381_101216254 | Not Available | 1089 | Open in IMG/M |
| 3300010376|Ga0126381_104209534 | Not Available | 558 | Open in IMG/M |
| 3300010398|Ga0126383_10113315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2453 | Open in IMG/M |
| 3300010398|Ga0126383_10508307 | Not Available | 1265 | Open in IMG/M |
| 3300010398|Ga0126383_10591841 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300010398|Ga0126383_12555670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300010398|Ga0126383_12932397 | Not Available | 557 | Open in IMG/M |
| 3300010403|Ga0134123_11581956 | Not Available | 703 | Open in IMG/M |
| 3300010863|Ga0124850_1129565 | Not Available | 623 | Open in IMG/M |
| 3300010868|Ga0124844_1189295 | Not Available | 758 | Open in IMG/M |
| 3300012198|Ga0137364_10280855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1234 | Open in IMG/M |
| 3300012198|Ga0137364_10610790 | Not Available | 822 | Open in IMG/M |
| 3300012199|Ga0137383_11353122 | Not Available | 505 | Open in IMG/M |
| 3300012200|Ga0137382_10782810 | Not Available | 686 | Open in IMG/M |
| 3300012201|Ga0137365_10099059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2194 | Open in IMG/M |
| 3300012201|Ga0137365_10388756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300012201|Ga0137365_10606705 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012202|Ga0137363_11107356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300012202|Ga0137363_11426887 | Not Available | 582 | Open in IMG/M |
| 3300012205|Ga0137362_10238132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1571 | Open in IMG/M |
| 3300012206|Ga0137380_11696921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300012208|Ga0137376_11360150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300012211|Ga0137377_10420181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300012211|Ga0137377_10430907 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300012211|Ga0137377_11208917 | Not Available | 686 | Open in IMG/M |
| 3300012349|Ga0137387_11315607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 505 | Open in IMG/M |
| 3300012350|Ga0137372_10785254 | Not Available | 684 | Open in IMG/M |
| 3300012356|Ga0137371_10572811 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300012359|Ga0137385_10505751 | Not Available | 1022 | Open in IMG/M |
| 3300012361|Ga0137360_10208238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
| 3300012361|Ga0137360_10595148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 946 | Open in IMG/M |
| 3300012363|Ga0137390_10189628 | Not Available | 2042 | Open in IMG/M |
| 3300012582|Ga0137358_10300410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1090 | Open in IMG/M |
| 3300012582|Ga0137358_10500504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300012582|Ga0137358_10975110 | Not Available | 550 | Open in IMG/M |
| 3300012917|Ga0137395_10946919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300012922|Ga0137394_10644197 | Not Available | 894 | Open in IMG/M |
| 3300012923|Ga0137359_10459446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1126 | Open in IMG/M |
| 3300012923|Ga0137359_10752119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
| 3300012923|Ga0137359_11298785 | Not Available | 616 | Open in IMG/M |
| 3300012923|Ga0137359_11503568 | Not Available | 561 | Open in IMG/M |
| 3300012929|Ga0137404_10948597 | Not Available | 786 | Open in IMG/M |
| 3300012930|Ga0137407_10900660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 837 | Open in IMG/M |
| 3300012948|Ga0126375_10726011 | Not Available | 777 | Open in IMG/M |
| 3300012951|Ga0164300_10945564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300012951|Ga0164300_10971753 | Not Available | 543 | Open in IMG/M |
| 3300012957|Ga0164303_10688725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300012957|Ga0164303_10744346 | Not Available | 667 | Open in IMG/M |
| 3300012958|Ga0164299_10455383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 838 | Open in IMG/M |
| 3300012960|Ga0164301_10041441 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300012961|Ga0164302_10377896 | Not Available | 958 | Open in IMG/M |
| 3300012961|Ga0164302_10490095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300012971|Ga0126369_10046882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3669 | Open in IMG/M |
| 3300012971|Ga0126369_10120423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2416 | Open in IMG/M |
| 3300012984|Ga0164309_10670058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300012985|Ga0164308_10946172 | Not Available | 762 | Open in IMG/M |
| 3300012987|Ga0164307_10505326 | Not Available | 914 | Open in IMG/M |
| 3300012987|Ga0164307_10832964 | Not Available | 736 | Open in IMG/M |
| 3300012989|Ga0164305_10805834 | Not Available | 779 | Open in IMG/M |
| 3300012989|Ga0164305_11326541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300015371|Ga0132258_12909778 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300015371|Ga0132258_13181939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1133 | Open in IMG/M |
| 3300015374|Ga0132255_103312843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300016270|Ga0182036_10890967 | Not Available | 729 | Open in IMG/M |
| 3300016270|Ga0182036_11183669 | Not Available | 635 | Open in IMG/M |
| 3300016270|Ga0182036_11546115 | Not Available | 558 | Open in IMG/M |
| 3300016270|Ga0182036_11570977 | Not Available | 553 | Open in IMG/M |
| 3300016270|Ga0182036_11618846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300016294|Ga0182041_10448172 | Not Available | 1109 | Open in IMG/M |
| 3300016294|Ga0182041_11227975 | Not Available | 684 | Open in IMG/M |
| 3300016319|Ga0182033_10279492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1369 | Open in IMG/M |
| 3300016319|Ga0182033_10839445 | Not Available | 811 | Open in IMG/M |
| 3300016319|Ga0182033_11018655 | Not Available | 737 | Open in IMG/M |
| 3300016319|Ga0182033_11309258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
| 3300016319|Ga0182033_11627757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300016319|Ga0182033_11925373 | Not Available | 538 | Open in IMG/M |
| 3300016341|Ga0182035_11886308 | Not Available | 542 | Open in IMG/M |
| 3300016357|Ga0182032_10640861 | Not Available | 887 | Open in IMG/M |
| 3300016357|Ga0182032_10855670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300016371|Ga0182034_11546627 | Not Available | 582 | Open in IMG/M |
| 3300016371|Ga0182034_11591146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300016371|Ga0182034_12049729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300016387|Ga0182040_11982312 | Not Available | 500 | Open in IMG/M |
| 3300016404|Ga0182037_10665330 | Not Available | 889 | Open in IMG/M |
| 3300016404|Ga0182037_10854001 | Not Available | 787 | Open in IMG/M |
| 3300016422|Ga0182039_10614901 | Not Available | 951 | Open in IMG/M |
| 3300016422|Ga0182039_11873920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli | 550 | Open in IMG/M |
| 3300016445|Ga0182038_11204953 | Not Available | 675 | Open in IMG/M |
| 3300018431|Ga0066655_11249256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300018433|Ga0066667_10576439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 936 | Open in IMG/M |
| 3300018468|Ga0066662_10414441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300018482|Ga0066669_11413113 | Not Available | 631 | Open in IMG/M |
| 3300020579|Ga0210407_10528831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 921 | Open in IMG/M |
| 3300020579|Ga0210407_10615288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 846 | Open in IMG/M |
| 3300021168|Ga0210406_10119496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2229 | Open in IMG/M |
| 3300021168|Ga0210406_10381093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300021168|Ga0210406_10892142 | Not Available | 669 | Open in IMG/M |
| 3300021170|Ga0210400_10542115 | Not Available | 960 | Open in IMG/M |
| 3300021178|Ga0210408_10032291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4138 | Open in IMG/M |
| 3300021377|Ga0213874_10102220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 954 | Open in IMG/M |
| 3300021401|Ga0210393_11024885 | Not Available | 668 | Open in IMG/M |
| 3300021405|Ga0210387_11591996 | Not Available | 556 | Open in IMG/M |
| 3300021475|Ga0210392_10210920 | Not Available | 1360 | Open in IMG/M |
| 3300021478|Ga0210402_10054680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3496 | Open in IMG/M |
| 3300021560|Ga0126371_10093318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2982 | Open in IMG/M |
| 3300021560|Ga0126371_10202217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 2082 | Open in IMG/M |
| 3300021560|Ga0126371_10217764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2012 | Open in IMG/M |
| 3300021560|Ga0126371_10218449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2009 | Open in IMG/M |
| 3300021560|Ga0126371_10847214 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300021560|Ga0126371_10880181 | Not Available | 1040 | Open in IMG/M |
| 3300021560|Ga0126371_10970160 | Not Available | 992 | Open in IMG/M |
| 3300021560|Ga0126371_11199916 | Not Available | 895 | Open in IMG/M |
| 3300021560|Ga0126371_11876760 | Not Available | 719 | Open in IMG/M |
| 3300021560|Ga0126371_11880787 | Not Available | 718 | Open in IMG/M |
| 3300021560|Ga0126371_12454915 | Not Available | 631 | Open in IMG/M |
| 3300021560|Ga0126371_12552261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300021560|Ga0126371_13826014 | Not Available | 507 | Open in IMG/M |
| 3300022511|Ga0242651_1038369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300022530|Ga0242658_1080427 | Not Available | 748 | Open in IMG/M |
| 3300022531|Ga0242660_1181302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300022531|Ga0242660_1248202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300022533|Ga0242662_10135521 | Not Available | 733 | Open in IMG/M |
| 3300022533|Ga0242662_10200935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300025905|Ga0207685_10010509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2738 | Open in IMG/M |
| 3300025906|Ga0207699_11167598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300025910|Ga0207684_10335842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1301 | Open in IMG/M |
| 3300025910|Ga0207684_10567167 | Not Available | 971 | Open in IMG/M |
| 3300025910|Ga0207684_11372982 | Not Available | 579 | Open in IMG/M |
| 3300025915|Ga0207693_10136038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1932 | Open in IMG/M |
| 3300025915|Ga0207693_10595878 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300025915|Ga0207693_10620997 | Not Available | 841 | Open in IMG/M |
| 3300025915|Ga0207693_11149199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300025916|Ga0207663_10550065 | Not Available | 902 | Open in IMG/M |
| 3300025929|Ga0207664_10931640 | Not Available | 779 | Open in IMG/M |
| 3300025939|Ga0207665_10250982 | Not Available | 1307 | Open in IMG/M |
| 3300025939|Ga0207665_10256111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1295 | Open in IMG/M |
| 3300025939|Ga0207665_10751684 | Not Available | 769 | Open in IMG/M |
| 3300026295|Ga0209234_1039500 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300026295|Ga0209234_1189197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Pontibacter → Pontibacter silvestris | 711 | Open in IMG/M |
| 3300026312|Ga0209153_1073721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300026327|Ga0209266_1249264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300026507|Ga0257165_1054088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300026551|Ga0209648_10565771 | Not Available | 632 | Open in IMG/M |
| 3300026552|Ga0209577_10491075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
| 3300027061|Ga0209729_1051893 | Not Available | 523 | Open in IMG/M |
| 3300027502|Ga0209622_1033382 | Not Available | 920 | Open in IMG/M |
| 3300027654|Ga0209799_1025403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1305 | Open in IMG/M |
| 3300027882|Ga0209590_10092017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1795 | Open in IMG/M |
| 3300028047|Ga0209526_10045456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3089 | Open in IMG/M |
| 3300031543|Ga0318516_10008325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4898 | Open in IMG/M |
| 3300031543|Ga0318516_10118163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1509 | Open in IMG/M |
| 3300031543|Ga0318516_10217991 | Not Available | 1103 | Open in IMG/M |
| 3300031543|Ga0318516_10410941 | Not Available | 779 | Open in IMG/M |
| 3300031543|Ga0318516_10567992 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031543|Ga0318516_10574811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
| 3300031543|Ga0318516_10870869 | Not Available | 507 | Open in IMG/M |
| 3300031545|Ga0318541_10031897 | Not Available | 2617 | Open in IMG/M |
| 3300031545|Ga0318541_10049223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2158 | Open in IMG/M |
| 3300031545|Ga0318541_10284807 | Not Available | 920 | Open in IMG/M |
| 3300031545|Ga0318541_10287141 | Not Available | 916 | Open in IMG/M |
| 3300031545|Ga0318541_10812616 | Not Available | 521 | Open in IMG/M |
| 3300031546|Ga0318538_10069279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris | 1768 | Open in IMG/M |
| 3300031546|Ga0318538_10117873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300031546|Ga0318538_10131239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1314 | Open in IMG/M |
| 3300031549|Ga0318571_10347192 | Not Available | 568 | Open in IMG/M |
| 3300031561|Ga0318528_10078252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1711 | Open in IMG/M |
| 3300031561|Ga0318528_10407986 | Not Available | 729 | Open in IMG/M |
| 3300031564|Ga0318573_10119163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1368 | Open in IMG/M |
| 3300031573|Ga0310915_10508856 | Not Available | 855 | Open in IMG/M |
| 3300031573|Ga0310915_10575477 | Not Available | 799 | Open in IMG/M |
| 3300031668|Ga0318542_10448115 | Not Available | 669 | Open in IMG/M |
| 3300031719|Ga0306917_11041465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300031719|Ga0306917_11521553 | Not Available | 514 | Open in IMG/M |
| 3300031720|Ga0307469_11849881 | Not Available | 584 | Open in IMG/M |
| 3300031720|Ga0307469_11920377 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031723|Ga0318493_10675439 | Not Available | 578 | Open in IMG/M |
| 3300031744|Ga0306918_10994880 | Not Available | 652 | Open in IMG/M |
| 3300031744|Ga0306918_11264044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
| 3300031744|Ga0306918_11489441 | Not Available | 517 | Open in IMG/M |
| 3300031748|Ga0318492_10235211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300031763|Ga0318537_10100591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300031768|Ga0318509_10111509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1483 | Open in IMG/M |
| 3300031770|Ga0318521_10047511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2200 | Open in IMG/M |
| 3300031771|Ga0318546_11278500 | Not Available | 515 | Open in IMG/M |
| 3300031778|Ga0318498_10542556 | Not Available | 510 | Open in IMG/M |
| 3300031779|Ga0318566_10294022 | Not Available | 804 | Open in IMG/M |
| 3300031805|Ga0318497_10861094 | Not Available | 508 | Open in IMG/M |
| 3300031819|Ga0318568_10057007 | Not Available | 2268 | Open in IMG/M |
| 3300031833|Ga0310917_10736139 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031859|Ga0318527_10052383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1593 | Open in IMG/M |
| 3300031860|Ga0318495_10393259 | Not Available | 611 | Open in IMG/M |
| 3300031879|Ga0306919_10410583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1039 | Open in IMG/M |
| 3300031879|Ga0306919_10825779 | Not Available | 712 | Open in IMG/M |
| 3300031890|Ga0306925_10222279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2036 | Open in IMG/M |
| 3300031890|Ga0306925_10268930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1836 | Open in IMG/M |
| 3300031890|Ga0306925_10457938 | Not Available | 1362 | Open in IMG/M |
| 3300031890|Ga0306925_10489192 | Not Available | 1311 | Open in IMG/M |
| 3300031890|Ga0306925_10950275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 880 | Open in IMG/M |
| 3300031890|Ga0306925_11304040 | Not Available | 721 | Open in IMG/M |
| 3300031890|Ga0306925_11375841 | Not Available | 697 | Open in IMG/M |
| 3300031896|Ga0318551_10006124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4883 | Open in IMG/M |
| 3300031910|Ga0306923_10728232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1102 | Open in IMG/M |
| 3300031910|Ga0306923_11438369 | Not Available | 724 | Open in IMG/M |
| 3300031910|Ga0306923_11537121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300031910|Ga0306923_11694324 | Not Available | 653 | Open in IMG/M |
| 3300031910|Ga0306923_11723518 | Not Available | 646 | Open in IMG/M |
| 3300031910|Ga0306923_11886340 | Not Available | 611 | Open in IMG/M |
| 3300031910|Ga0306923_12395707 | Not Available | 523 | Open in IMG/M |
| 3300031912|Ga0306921_10676183 | Not Available | 1188 | Open in IMG/M |
| 3300031941|Ga0310912_10852269 | Not Available | 702 | Open in IMG/M |
| 3300031941|Ga0310912_11354188 | Not Available | 538 | Open in IMG/M |
| 3300031942|Ga0310916_11070329 | Not Available | 671 | Open in IMG/M |
| 3300031942|Ga0310916_11750473 | Not Available | 501 | Open in IMG/M |
| 3300031946|Ga0310910_10389853 | Not Available | 1103 | Open in IMG/M |
| 3300031947|Ga0310909_10057816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3003 | Open in IMG/M |
| 3300031947|Ga0310909_11415429 | Not Available | 556 | Open in IMG/M |
| 3300031947|Ga0310909_11550300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300031954|Ga0306926_12374499 | Not Available | 585 | Open in IMG/M |
| 3300031954|Ga0306926_12506874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 565 | Open in IMG/M |
| 3300031959|Ga0318530_10222287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300031981|Ga0318531_10353288 | Not Available | 664 | Open in IMG/M |
| 3300032001|Ga0306922_11723229 | Not Available | 619 | Open in IMG/M |
| 3300032009|Ga0318563_10097913 | Not Available | 1548 | Open in IMG/M |
| 3300032025|Ga0318507_10132113 | Not Available | 1059 | Open in IMG/M |
| 3300032035|Ga0310911_10484936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300032039|Ga0318559_10279938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300032042|Ga0318545_10383873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300032054|Ga0318570_10432163 | Not Available | 601 | Open in IMG/M |
| 3300032054|Ga0318570_10440510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300032060|Ga0318505_10028914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2241 | Open in IMG/M |
| 3300032063|Ga0318504_10620770 | Not Available | 520 | Open in IMG/M |
| 3300032065|Ga0318513_10094015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1396 | Open in IMG/M |
| 3300032076|Ga0306924_11880130 | Not Available | 621 | Open in IMG/M |
| 3300032076|Ga0306924_12060510 | Not Available | 586 | Open in IMG/M |
| 3300032094|Ga0318540_10223750 | Not Available | 908 | Open in IMG/M |
| 3300032094|Ga0318540_10485607 | Not Available | 596 | Open in IMG/M |
| 3300032094|Ga0318540_10564535 | Not Available | 548 | Open in IMG/M |
| 3300032174|Ga0307470_10391790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 979 | Open in IMG/M |
| 3300032180|Ga0307471_103187249 | Not Available | 581 | Open in IMG/M |
| 3300032205|Ga0307472_100495851 | Not Available | 1051 | Open in IMG/M |
| 3300032205|Ga0307472_101761624 | Not Available | 614 | Open in IMG/M |
| 3300032261|Ga0306920_100253850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2623 | Open in IMG/M |
| 3300032261|Ga0306920_101922870 | Not Available | 831 | Open in IMG/M |
| 3300032261|Ga0306920_103212640 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300032261|Ga0306920_103382755 | Not Available | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 18.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 17.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.23% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.41% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.41% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.41% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.21% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.21% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.21% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.21% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.21% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.21% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.21% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.21% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.62% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.62% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006935 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022511 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02797740 | 2088090014 | Soil | MRTKSIIIFAAAFMFALTVGILTAESVNDRASNPPIPTLALQY |
| GPIPI_02750750 | 2088090014 | Soil | MMTKNIIIVAAMFMFALTVGILTANLAESGNDRASAPTISTLALQY |
| KansclcFeb2_14711850 | 2124908045 | Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRAS |
| N57_00186390 | 2170459013 | Grass Soil | MITRAIIAVAAAFLFALTVGILTADLAESGNDRASGPTHGTLALQY |
| FD1_02302940 | 2170459024 | Grass Soil | MGMQIDLEAQGAFMITRAVIAVAAAFLFALTVGILTANLAESGNDRASGPTIG |
| NODE_05478483 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTKVIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLV |
| AP72_2010_repI_A01DRAFT_10508523 | 3300000579 | Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLXLQY* |
| AF_2010_repII_A1DRAFT_100549273 | 3300000597 | Forest Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRARPRGQNH* |
| AF_2010_repII_A1DRAFT_100709484 | 3300000597 | Forest Soil | AAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| AF_2010_repII_A1DRAFT_101146021 | 3300000597 | Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQ |
| AP72_2010_repI_A10DRAFT_10084282 | 3300000651 | Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRATNPTIGTLALQY* |
| AF_2010_repII_A001DRAFT_100226475 | 3300000793 | Forest Soil | MLTKGIIIATAAFMFALTVGILTAQSGNDRASNPTMRTLALQY* |
| JGI1027J12803_1019313921 | 3300000955 | Soil | MMTKAIIITAAAFVFALTVGILTAESGNDRASSPTIRTLVL |
| JGI1027J12803_1020303722 | 3300000955 | Soil | AMFMFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| JGI10216J12902_1033577271 | 3300000956 | Soil | MLSKDIIVAVAITFAVTFAILTAKIAESGNEKASNPTITTLPLQY* |
| JGI10216J12902_1088787652 | 3300000956 | Soil | MMTKGIIAVAAAFFFALTVGILTADSGNDRASNPTIRTLAL |
| JGI25387J43893_10119732 | 3300002915 | Grasslands Soil | MMTKGIIIAAAAFMFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0066398_101041661 | 3300004268 | Tropical Forest Soil | IAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQY* |
| Ga0062595_1007477002 | 3300004479 | Soil | MMTINTIIFVAAFVFALTVGILTAESVNDRGTSPTIPTLALQY* |
| Ga0066395_100685672 | 3300004633 | Tropical Forest Soil | MMTKGIIIVAAALVFALTVGTLTAESGNDRASNPTIRTLALQY* |
| Ga0066395_100724962 | 3300004633 | Tropical Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQY* |
| Ga0066395_105369781 | 3300004633 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066820_10092521 | 3300005160 | Soil | MMTKGIIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0066672_101397702 | 3300005167 | Soil | MMTKGIIITAAAFMFALTLGILTAQSGNDRASSPTIRTLALQY* |
| Ga0066683_101405691 | 3300005172 | Soil | IVAVAITFAVTFAILTAKIAESGNDNASNPTISTLPLQY* |
| Ga0066680_104968382 | 3300005174 | Soil | MTKGIIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0066690_104164132 | 3300005177 | Soil | MMTKGIIIAAAAFMFALTVGILTANLAESGNDRGASGPTIGTLALQY* |
| Ga0066678_106736611 | 3300005181 | Soil | MMTKGIIIAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066671_107306841 | 3300005184 | Soil | MMTKNIIVVAAMFMFALTVGILTANLAESGNDRASGPTIGALALQY* |
| Ga0066388_1003623953 | 3300005332 | Tropical Forest Soil | MMTKGIIIAAAAFMFALTVGILTAHSGNDRASNPTIRTLALQY* |
| Ga0066388_1004830423 | 3300005332 | Tropical Forest Soil | MMAKGIIAVAAAFMFALTVGILTAQSSNDRASNPTLRTLALQY* |
| Ga0066388_1005368392 | 3300005332 | Tropical Forest Soil | MMTKVIITVALAFLFALTVGIVTANMAESGNDRASNPTIPTLALQ |
| Ga0066388_1006183343 | 3300005332 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTIGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066388_1006500484 | 3300005332 | Tropical Forest Soil | MGAFMIARAIIAVAAAFLFALTVGILTANLAESGNDRATGPTIGTLASQY* |
| Ga0066388_1008277441 | 3300005332 | Tropical Forest Soil | MMTKGIIAVALAFMFALTVGILTAESSNDRGSAHTIRTLPLQY* |
| Ga0066388_1008332183 | 3300005332 | Tropical Forest Soil | MMTKNIIVVAAMFVFALTVGILTANLAESGNDRASGPTIATLTLQY* |
| Ga0066388_1010318233 | 3300005332 | Tropical Forest Soil | MRTKSIIIFVAAFMFALTVGILTAESVNDRASNPTIPTLALQY* |
| Ga0066388_1010738673 | 3300005332 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGMLTANMAESGNDKASNPTIRTLALQY* |
| Ga0066388_1012602103 | 3300005332 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLVLQY* |
| Ga0066388_1015288932 | 3300005332 | Tropical Forest Soil | MMTKGIIITAAAFMFALTVGILTAESGNDRASSPTIRTLVLQY* |
| Ga0066388_1015653102 | 3300005332 | Tropical Forest Soil | MMTKGIIAIAAAFLFALTVGILTADSSNDRASNPTIPTLALQY* |
| Ga0066388_1016229382 | 3300005332 | Tropical Forest Soil | MTKGIIAAAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066388_1016391701 | 3300005332 | Tropical Forest Soil | MITRAIIAVAAAFLFALTVGILTANLAESGNDRASAPTIHAL |
| Ga0066388_1016630863 | 3300005332 | Tropical Forest Soil | MMIKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066388_1017361002 | 3300005332 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILTAESGNDRASNPTIRTLALQY* |
| Ga0066388_1020020851 | 3300005332 | Tropical Forest Soil | MITRTIIAVAAAFIFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0066388_1020056572 | 3300005332 | Tropical Forest Soil | MRTKSIIIFAAAFVFALTVGILTAESVNDRASNPTFPTLALQY* |
| Ga0066388_1020352733 | 3300005332 | Tropical Forest Soil | MRTNNIIVVAAMFLFALTVGILSANLAESGNDMASAPTIGTLAVQY* |
| Ga0066388_1021502232 | 3300005332 | Tropical Forest Soil | MMTKGKSLSPPRFLFALTVGILTAESGNDRASVPTIRTLALQY* |
| Ga0066388_1023154161 | 3300005332 | Tropical Forest Soil | MMTKTIIIVAAAFMVALTVGILTAESANDRASSPTIPTLALQY* |
| Ga0066388_1025551423 | 3300005332 | Tropical Forest Soil | MMTKVIITVALAFLFALTVGVLTAESVNDRASSPTIPTLA |
| Ga0066388_1028441511 | 3300005332 | Tropical Forest Soil | GASMMTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0066388_1032418092 | 3300005332 | Tropical Forest Soil | MITRAIIAVAAAFLFALTVGILTANLAESGNDRASAPTIHALALQY* |
| Ga0066388_1036031291 | 3300005332 | Tropical Forest Soil | MTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066388_1036222972 | 3300005332 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILTAESGNDRASNPTVRTLPLQY* |
| Ga0066388_1036232871 | 3300005332 | Tropical Forest Soil | MMTKGIIAVTAAFMLALTGGILTANMAESGNDRASNPTIRTLVLQY* |
| Ga0066388_1038636091 | 3300005332 | Tropical Forest Soil | MQGDLEAKGASMMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066388_1045060411 | 3300005332 | Tropical Forest Soil | MMTKGIIAVTAAFMFALTVGILTAKMAESGNDRASNPTIRTL |
| Ga0066388_1045724052 | 3300005332 | Tropical Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAQSGNDRASNPTIRTLALQY* |
| Ga0066388_1047196942 | 3300005332 | Tropical Forest Soil | MTTKGIIAIAAAFLFALTVGVLTAESGNDRASNPTIRTLALQY* |
| Ga0066388_1048303492 | 3300005332 | Tropical Forest Soil | MRTKSIIIFVAAFMFALTVGILTAESVNDRASSPTIPTLALQY* |
| Ga0066388_1052770571 | 3300005332 | Tropical Forest Soil | MITKGMIVVAVAFMFALTVGILTAESGNDRASSPTIRTLALQY* |
| Ga0066388_1053910002 | 3300005332 | Tropical Forest Soil | MTKGIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLALQY* |
| Ga0066388_1054054362 | 3300005332 | Tropical Forest Soil | MMTKGIIAIAAAFMFALTVGILTTNLAESGNDRASGPTIRTLALQY* |
| Ga0066388_1056077022 | 3300005332 | Tropical Forest Soil | MTTKGIIAIAAAFLFALTVGILTAESGNDRASNPTIRTLALQY* |
| Ga0066388_1067263262 | 3300005332 | Tropical Forest Soil | MMTKGIIAIAAAFTFALTVGILTANMAESGNDRASGPTIRTLALQY* |
| Ga0066388_1067878221 | 3300005332 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY* |
| Ga0066388_1074213121 | 3300005332 | Tropical Forest Soil | MMTKGIIAAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066388_1075410392 | 3300005332 | Tropical Forest Soil | MMTKNIIGVAAAFLLALTVGMLTAKMAESGNDKASNPTIRTLPLQY* |
| Ga0066388_1077005982 | 3300005332 | Tropical Forest Soil | LNKLLWIQGVLEAQGASMMTKGIIAAAAAFMFALTVGILTANLAESGNDQASAPTVRTLALQY* |
| Ga0066388_1077617731 | 3300005332 | Tropical Forest Soil | MQGDLEAQGAFMMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066388_1087001171 | 3300005332 | Tropical Forest Soil | MMTKGIIAAAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0070660_1018465201 | 3300005339 | Corn Rhizosphere | MITRAIIAVAAAFLFALTVGILTANLAESGNDRATGPTIGTLALQY* |
| Ga0070671_1018185222 | 3300005355 | Switchgrass Rhizosphere | MITRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0070674_1007668342 | 3300005356 | Miscanthus Rhizosphere | MMTRAVIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0008090_101096604 | 3300005363 | Tropical Rainforest Soil | MMTKNIIVVAAMFMFALTVGILTANLAESGNDRASAPTIHTLALQY* |
| Ga0070709_100415764 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTRATIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0070709_106579932 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKSIIIFAAAFMFALTVGILTAESVNDRASNPPIPTLALQY* |
| Ga0070714_1003676392 | 3300005435 | Agricultural Soil | MITRAIIAVAAAFLFALTVGILTADLAVSDNDRASGPTHGTLALQY* |
| Ga0070714_1011958971 | 3300005435 | Agricultural Soil | AVAAAFLFALTVGILTADLAVSGNDRASGPTHGALALQY* |
| Ga0070714_1016663802 | 3300005435 | Agricultural Soil | MRTKSIIIFAAAFMFALTVGILTAESVNDRGTSPTIPTLALQY* |
| Ga0070714_1019080121 | 3300005435 | Agricultural Soil | MMTKAIIITAAAFVFALTVGILTAESGNDRASSPTIRTLVLQY* |
| Ga0070713_1018682541 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0070710_103687382 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKSIIIFAAAFMFALTVGILTAESVNDRASNPTIPTLALQY* |
| Ga0070694_1005788502 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTINTIIFVAAFVFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0070706_1002323813 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKGIIIAAAAFMFALTVGILTAETSNDRASNPTIRTLALQY* |
| Ga0070706_1017059202 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0070707_1021051631 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0070699_1000311806 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLTKGIIVVAAFAFATTFGILTAKMAESGNDKASNPTISTLPLRY* |
| Ga0070699_1001563804 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGDLESGGPSMMTKDLIVAAAITFAVTFAILTAKIAESGNDNASNPIIRTLPLQY* |
| Ga0070697_1002740602 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRGIIITAAAFIFALTVGILTAESSNDRASSPTIRTLALQY* |
| Ga0070696_1005733042 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKAIIITAAAFVFALTVGILTAESVNDRGTSPTIPTLALQY* |
| Ga0070696_1014687751 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKGIIITAAAFMFALTLGILTAQSGNDRASNPTIRTLALQY* |
| Ga0066695_103237142 | 3300005553 | Soil | MMTKDIIVAAAVTFAVTFGILAAKIAESSNDKASNPTVHTLPLQY* |
| Ga0066661_107363392 | 3300005554 | Soil | AAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066707_101648303 | 3300005556 | Soil | MMTKGIIAVAAAFMFALTVGMLTANMAESGNDRASNPTIRTLALQY* |
| Ga0066699_105834251 | 3300005561 | Soil | GASMMTKGIIIAAAAFMFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0066905_1000678913 | 3300005713 | Tropical Forest Soil | MMTKVIITVALAFLFALTVGIVTANMAESGNDRASNPTIPTLALQY* |
| Ga0066905_1001102914 | 3300005713 | Tropical Forest Soil | MTTRGIIIAAAAFMFALTVGILTADSGNDRASNPTIRTLALQY* |
| Ga0066905_1003499621 | 3300005713 | Tropical Forest Soil | LGASMMTTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTVWALPLQF* |
| Ga0066905_1004540423 | 3300005713 | Tropical Forest Soil | MMTKSTIAVAAAFMFALTVGILTAKIAESGNDRAGNPTIRTLALQY* |
| Ga0066905_1004580113 | 3300005713 | Tropical Forest Soil | MMTKGIIVAAAAFVFALTVGILTANLAESGNDRASGPTIRTLVLQY* |
| Ga0066905_1007194271 | 3300005713 | Tropical Forest Soil | MMIKGIIAVAAAFLFALTVGILTAESGNDRASNPTIRTFALQY* |
| Ga0066905_1011799622 | 3300005713 | Tropical Forest Soil | MMTKGIIVAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066905_1012111652 | 3300005713 | Tropical Forest Soil | MMTKGIIAVTAAFMLALTVGILTANMAESGNDRASNPTIRTLVLQY* |
| Ga0066905_1013354101 | 3300005713 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0066905_1014130571 | 3300005713 | Tropical Forest Soil | IAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLVLQY* |
| Ga0066905_1016100791 | 3300005713 | Tropical Forest Soil | TKGIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLVLQY* |
| Ga0066905_1017331651 | 3300005713 | Tropical Forest Soil | MMTKGIITVALAFLFALTVGILTAESVNDRASSPTI |
| Ga0066905_1017962913 | 3300005713 | Tropical Forest Soil | GASMMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066905_1020589441 | 3300005713 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLAFQY* |
| Ga0066905_1023154211 | 3300005713 | Tropical Forest Soil | AAFMFALTVGILTAKIAESGNDRASNPTIRTLALQY* |
| Ga0066903_1000928121 | 3300005764 | Tropical Forest Soil | MMTKNIIVVVAMFMFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0066903_1002993523 | 3300005764 | Tropical Forest Soil | MMTKGIIAAAAAFMFALTVGILTAKIAESGNDRASNPTIRTLALQY* |
| Ga0066903_1006321996 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLVLQY* |
| Ga0066903_1007237762 | 3300005764 | Tropical Forest Soil | MMTKNIIVVTAMFMFALTVGILTANLAESDNDRASAPTIGTLALQY* |
| Ga0066903_1015375581 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLTLQY* |
| Ga0066903_1017661892 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRALALQY* |
| Ga0066903_1018152451 | 3300005764 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTTNLAESGNDRASGPTIRTLALQY* |
| Ga0066903_1021442032 | 3300005764 | Tropical Forest Soil | MMTKNIIVVAAMFTFALTVGIMSANLAESGNDMASAPTIHTLALQY* |
| Ga0066903_1021831562 | 3300005764 | Tropical Forest Soil | MMTKNVIVVATMFVFALTVGILTANLAESDNDRASGPTIHTLALQY* |
| Ga0066903_1028536131 | 3300005764 | Tropical Forest Soil | MMTNGIIAVAAAFLFALTVGILTAESGNDRASNPTVRTLALQY* |
| Ga0066903_1036670402 | 3300005764 | Tropical Forest Soil | GIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066903_1036929162 | 3300005764 | Tropical Forest Soil | MVTKNIIAVVAAFLFALTVGMLTANMAESGNDKASNPTIHTLALQY* |
| Ga0066903_1037107952 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILAAQSSNDRASNPTIRTLALQY* |
| Ga0066903_1047556513 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASTPTIRTLALQY* |
| Ga0066903_1048305462 | 3300005764 | Tropical Forest Soil | MMTKNVIVVAAMFVFALTVGILTANLAESDNDRASGPTIHTLALQY* |
| Ga0066903_1048436572 | 3300005764 | Tropical Forest Soil | MMTKGITAVAAAFMFALTVGILTAQSGNDRASNPTIPTLALQY* |
| Ga0066903_1049473202 | 3300005764 | Tropical Forest Soil | LNKLLGMQGDLEAKGASMMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0066903_1063783192 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAESGNDRASSPT |
| Ga0066903_1069434172 | 3300005764 | Tropical Forest Soil | MMTKGIIAVTAAFLLALTVGILTANMAESGNDRASNPTIRTLVLQY* |
| Ga0066903_1070786142 | 3300005764 | Tropical Forest Soil | MMTKGIIAIAAAFTFALTVGILTANMAASGNDRASGPTIRTLALQY* |
| Ga0066903_1074408433 | 3300005764 | Tropical Forest Soil | MMTKTIIIVAAAFMVALTVGILTAESANDNASSTTIPTLALQY* |
| Ga0066903_1076988311 | 3300005764 | Tropical Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLALQY* |
| Ga0066903_1086927702 | 3300005764 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAQSGNDRASNPTILTLALQY* |
| Ga0066903_1088357142 | 3300005764 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAQSGNDRASGPTIRTLALQY* |
| Ga0066903_1090330641 | 3300005764 | Tropical Forest Soil | MITRTIIAVAATFLFALTVGILTANLAESGNDRASAPTIRTLALQY* |
| Ga0081540_11349373 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MMTTNTIIFVAAFVFALTVGILTAESVNDRASSPTIPTLALQY* |
| Ga0081540_12343941 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MMTKGIIAVVAAFLFALTVGMLTAESGNDKASNPTIHTLALQ |
| Ga0075365_106783061 | 3300006038 | Populus Endosphere | MMTKNIIVVAAMFLFALTVGILTANLAESDNDRASGPTIHTLALQY* |
| Ga0066652_1002268142 | 3300006046 | Soil | MMTKNIIVVAAMFMFALMVGILTANLAESGNDRASGPTIVALALQY* |
| Ga0066652_1012321702 | 3300006046 | Soil | AFMFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0075018_106161612 | 3300006172 | Watersheds | SMMTKDLIVAAAITFAVTFAILTAKIAESSNDNASNPIIRTLPLQY* |
| Ga0070716_1010778322 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTINTIIFVAAFVFALTVGILTAESVNDRASNPPIPTLALQY* |
| Ga0070716_1014323471 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFLFALTVGILTADLAVSGNDRASGRTHGTLALQY* |
| Ga0070712_1001290107 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIG |
| Ga0070712_1005097293 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTTNTIVFVAAFVFALTVGILTAESVNDRGTSPTIPTLALQY* |
| Ga0070712_1005587481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVTKGIIVAVAITFAVTSAILTAKIAESGNDNSSNPTISTLPAAILR* |
| Ga0070712_1006857601 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MITRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGT |
| Ga0070712_1009110563 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKNIIIVAAMFLFALTVGVLTADSSNDRATSPTIPTLALQY* |
| Ga0070712_1014158041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKNIIIVAAAFLFALTVGILTADSSNDRATSPTIPTLALQY* |
| Ga0066658_103374181 | 3300006794 | Soil | MMTKGIIITAAAFMFALTLGILTAQSGNDRASSPTIRTLA |
| Ga0066665_110388161 | 3300006796 | Soil | IVAAAVTFAVTFGILAAKIAESSNDKASNPTVHTLPLQY* |
| Ga0066659_103529852 | 3300006797 | Soil | MMTKDIIVAAAITFAVAFAILTAKIAESGNDNASNPNASAAILR* |
| Ga0066659_109144092 | 3300006797 | Soil | MLTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0066660_111579192 | 3300006800 | Soil | MMTKGIIAVAAAFLFALTVGILTANLAESGNDRATGPTIGTLALQY* |
| Ga0079220_103231332 | 3300006806 | Agricultural Soil | MMTRNIIIVAAMFMFALTVGILSANLAESGNDRASGPPIGTLALQY* |
| Ga0075433_115908141 | 3300006852 | Populus Rhizosphere | MITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPPHGTLALQY* |
| Ga0075425_1010587513 | 3300006854 | Populus Rhizosphere | MITRAIITVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0075426_107921631 | 3300006903 | Populus Rhizosphere | FMFALTVGILTANLAESGNDRASAPTISTLAVQY* |
| Ga0075424_1010226661 | 3300006904 | Populus Rhizosphere | MQSDLEAQGAFMITRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0075436_1010185732 | 3300006914 | Populus Rhizosphere | MMIKNIIIVAAMFTFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0081246_11621961 | 3300006935 | Tropical Rainforest Soil | MMTKGIIVAAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQY* |
| Ga0075435_1008613922 | 3300007076 | Populus Rhizosphere | MMTKGIIAAAAAFMFALTVGILSASLAESGNDRASGPTIRTLALQY* |
| Ga0099791_105321511 | 3300007255 | Vadose Zone Soil | MMTKGIIVAAAFAFAATFGILTAKMAESGNDKASNPTISTLPVRY* |
| Ga0099793_104488711 | 3300007258 | Vadose Zone Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRAKNPTIRTLALQY* |
| Ga0066710_1045310792 | 3300009012 | Grasslands Soil | MMTKGIIVVAAFAFAATFGILTAKIAESGNDKASSPTIRTLLLQY |
| Ga0099828_103002822 | 3300009089 | Vadose Zone Soil | MMTKGIIIAAAAFMFALTVGILTAQSGNDRASSPTIRTLALQY* |
| Ga0099827_103303992 | 3300009090 | Vadose Zone Soil | MMTKGIIITAAAFMFASTLGILTAQSGNDRASSPTIRTLALQY* |
| Ga0099827_115984621 | 3300009090 | Vadose Zone Soil | MDVEAQGASMMTKGIIIAAAAFTFALTVGILTAQSGNDRASN |
| Ga0111539_122978572 | 3300009094 | Populus Rhizosphere | MMIKNIFIVAAMFTFALTVGILTANLAESGNDRASAPTISTLAVQY* |
| Ga0066709_1002135662 | 3300009137 | Grasslands Soil | MMTKAIIITAAAFMFALTLGILTAQSGNDRASSPTIRTLALQY* |
| Ga0099792_109597081 | 3300009143 | Vadose Zone Soil | IAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0114129_103952333 | 3300009147 | Populus Rhizosphere | MMTKGIIITAAAFMFALTLGILTAQSGNDRASSPTIRTLVLQY* |
| Ga0114129_127643212 | 3300009147 | Populus Rhizosphere | MMTKCIIITAAAFMFALTVGILTAESVNDRASNPTIPTLALQY |
| Ga0111538_120848601 | 3300009156 | Populus Rhizosphere | MQSDLEAQGAFMITRAIITVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0105242_126323281 | 3300009176 | Miscanthus Rhizosphere | VQVEIEAQGAFMITRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0126374_100068362 | 3300009792 | Tropical Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQ* |
| Ga0126374_102757333 | 3300009792 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0126374_105335181 | 3300009792 | Tropical Forest Soil | MTTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIPTLALQY* |
| Ga0126374_105560383 | 3300009792 | Tropical Forest Soil | IITVALAFLFALTVGIVTANMAESGNDRASNPTIPTLALQW* |
| Ga0126374_107446482 | 3300009792 | Tropical Forest Soil | MMTKNVIVVAAMFVFALTVGILTANLAESGNDRASAPTIHTLALQY* |
| Ga0126374_108284531 | 3300009792 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0126374_108887081 | 3300009792 | Tropical Forest Soil | MMTKGIIIVAAAFVFALTVGILTAESGNDRASNPTIRTLAL |
| Ga0126374_109954652 | 3300009792 | Tropical Forest Soil | AVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0126374_110815822 | 3300009792 | Tropical Forest Soil | MMTKGIIVAAAAFVFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0126380_100463893 | 3300010043 | Tropical Forest Soil | MMTKGIIAAAAAFMFALTVGILTAKMAESGNDRAS |
| Ga0126380_102247803 | 3300010043 | Tropical Forest Soil | MTTKGIIAIAAAAFLFALTVGILTAESGNDRANSTTGGTLPLQY* |
| Ga0126380_102394364 | 3300010043 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTISTLALQY* |
| Ga0126380_104204643 | 3300010043 | Tropical Forest Soil | MMTKGIITVALAFLFALTVGILTAESVNDRASSPTIPTLALQY* |
| Ga0126380_105465791 | 3300010043 | Tropical Forest Soil | AAAFLFALTVGILTAESGNDRASNPTIRTLALQY* |
| Ga0126380_105649652 | 3300010043 | Tropical Forest Soil | MTKGIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQY* |
| Ga0126380_113754502 | 3300010043 | Tropical Forest Soil | MMTKVIITVALAFLFALTVGVLTAESVNDRASSPTI |
| Ga0126384_102046742 | 3300010046 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGIVTANLAESGNDRASGPTIRTLALQY* |
| Ga0126384_102465893 | 3300010046 | Tropical Forest Soil | MTTRGIIITAAAFMFALTVGILTAESGNDRASSPTIRTLALQY* |
| Ga0126384_107880612 | 3300010046 | Tropical Forest Soil | MMTKGIIIAAAAFMFALTVGMLTAQSGNDRASSPTIRTLVLQY* |
| Ga0126384_110442182 | 3300010046 | Tropical Forest Soil | MMTKNIIAVVAAFLFALTVGMLTANMAESGNDKASNPTIHTLALQY* |
| Ga0126384_112299052 | 3300010046 | Tropical Forest Soil | MMTKGIIAVAAAFLFALAVGILTAQSSNDRASNPTIRTLALQY* |
| Ga0126384_113738692 | 3300010046 | Tropical Forest Soil | MMTKNIIVVAAMFMFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0126384_118622891 | 3300010046 | Tropical Forest Soil | MMTKGIIIAAAAFMFALTVGILTTESGNDRASNPTIRTLALQY* |
| Ga0126384_121297891 | 3300010046 | Tropical Forest Soil | MLTKGIIIATAAFMFALTVGILTARSGNDRASNPTMRTLALQY* |
| Ga0126382_101609183 | 3300010047 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPT |
| Ga0126382_105591563 | 3300010047 | Tropical Forest Soil | MMTKGIIIAAAAFMFALTVGILTADSGNDRASNPTIRTLALQY* |
| Ga0126382_109073701 | 3300010047 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLVLQY* |
| Ga0126382_109912872 | 3300010047 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAESGNDRASNPTIRTLALQY* |
| Ga0126382_111346562 | 3300010047 | Tropical Forest Soil | RSLGASMMTKSTIAVAAAFMFALTVGILTAKIAESGNDRAGNPTIRTLALQY* |
| Ga0126382_116916601 | 3300010047 | Tropical Forest Soil | MMTKSTIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLALQY* |
| Ga0126382_121479512 | 3300010047 | Tropical Forest Soil | AFLFALTVGIVTANMAESGNDRASNPTIPTLALQY* |
| Ga0126373_104756431 | 3300010048 | Tropical Forest Soil | MMTKGIIVAAAAFVFALTVGILTANLAESGNDRASGPTIRTL |
| Ga0126373_116935452 | 3300010048 | Tropical Forest Soil | MMSKGIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLTLQY* |
| Ga0126373_122988181 | 3300010048 | Tropical Forest Soil | MQGGVEAQGVSMMTKGIIAAAAAFMFAVTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0126373_123760152 | 3300010048 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAQSGNDRASGP |
| Ga0134063_107574441 | 3300010335 | Grasslands Soil | MMTKGIIINAAAFTVALTLGILTAQSGNDRASSPTIRTL |
| Ga0126370_100785312 | 3300010358 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAQSGNDRASSPTVRTLALQY* |
| Ga0126370_102757332 | 3300010358 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILAAKMAESGNDRASNPTIRTLALQY* |
| Ga0126370_105146583 | 3300010358 | Tropical Forest Soil | IIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0126370_108103901 | 3300010358 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILSAKMAESGNDRASNPTIRTLALQY* |
| Ga0126370_110832521 | 3300010358 | Tropical Forest Soil | IIAVAAAFMFALTVGILTAKMAESGNDRASNPTIPTLALQY* |
| Ga0126370_117906472 | 3300010358 | Tropical Forest Soil | MTKNIIVVAAMFMFALTVGILTANLAESGNDRASAPTIHSLALQY* |
| Ga0126376_100177881 | 3300010359 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0126376_105461571 | 3300010359 | Tropical Forest Soil | MMTKGVIAVATAFLFALTIGILIAESGNDRASNPTVRTLPLQY* |
| Ga0126376_113635122 | 3300010359 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRASG |
| Ga0126376_116258571 | 3300010359 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGYDRASNPTIRTLALQY* |
| Ga0126376_132159771 | 3300010359 | Tropical Forest Soil | FMFALTVGILTAKMAESGNDRASNPTIPTLALQY* |
| Ga0126376_132736872 | 3300010359 | Tropical Forest Soil | PLWVQADVEDLGASMMTKVIITVALAFLFALTVGIVTANMAESGNDRASNPTIPTLALQY |
| Ga0126372_102824091 | 3300010360 | Tropical Forest Soil | AFLFALTVGILTANLAESGNDRASAPTIHALALQY* |
| Ga0126372_114706572 | 3300010360 | Tropical Forest Soil | MMAKGIIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY* |
| Ga0126372_133153641 | 3300010360 | Tropical Forest Soil | AFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0126378_104020491 | 3300010361 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRAS |
| Ga0126378_108289731 | 3300010361 | Tropical Forest Soil | MQGDLEAKGASMMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLA |
| Ga0126378_127934131 | 3300010361 | Tropical Forest Soil | MMTKNIIVVAAMFMFALTVGILTANLAESDNDRASGPTIHTLALQY* |
| Ga0126377_106801952 | 3300010362 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIPTLALQY* |
| Ga0126377_113815682 | 3300010362 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY* |
| Ga0126377_127283971 | 3300010362 | Tropical Forest Soil | GAFMMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0126379_104979822 | 3300010366 | Tropical Forest Soil | LNKQLWGQGDQEAQGAFMMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0126379_111822411 | 3300010366 | Tropical Forest Soil | SMMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIPTLALQY* |
| Ga0126379_117499401 | 3300010366 | Tropical Forest Soil | AAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0126379_121604741 | 3300010366 | Tropical Forest Soil | VAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0134125_104300622 | 3300010371 | Terrestrial Soil | MMTRATIAVAAAFLFALTVGILTADLAVSDNDRASGPTHGTLALQY* |
| Ga0105239_111744412 | 3300010375 | Corn Rhizosphere | MRTKSIIIFAAAFMFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0126381_1001372192 | 3300010376 | Tropical Forest Soil | MMTKNTIVVAAMFMFALTVGILTANLAESGNDRASAPTIHTLALQY* |
| Ga0126381_1010416943 | 3300010376 | Tropical Forest Soil | IAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0126381_1012162542 | 3300010376 | Tropical Forest Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNERASNPTIRTLALQY* |
| Ga0126381_1042095341 | 3300010376 | Tropical Forest Soil | MMTKNIIVVTAMFMFGLTAGILTANRAESGNDRSSGPTIHTLA |
| Ga0126383_101133152 | 3300010398 | Tropical Forest Soil | MMTKNTIVVAAMFMFALTVGILTANLAESGNDRASAPTIHTLVLQY* |
| Ga0126383_105083072 | 3300010398 | Tropical Forest Soil | MMTKNIIAVVAAFLFTLTVGMLTANMAESGNDKASNPTIHTLALQY* |
| Ga0126383_105918412 | 3300010398 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLAL |
| Ga0126383_125556701 | 3300010398 | Tropical Forest Soil | AKGASMMTKGIIIAAAAFMFALTVGILTTESGNDRASNPTIRTLALQY* |
| Ga0126383_129323972 | 3300010398 | Tropical Forest Soil | AAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0134123_115819561 | 3300010403 | Terrestrial Soil | MELEAYGASMRTKSIIIFAAAFMFALTVGILTAESVNDRASNPPIPTLALQY* |
| Ga0124850_11295651 | 3300010863 | Tropical Forest Soil | KPRGASMMTKGIIAVAAAFMFALTIGILTAKMAESGNDRASNPTIRTLALQY* |
| Ga0124844_11892951 | 3300010868 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGMLTANMAESGNDKASNPTIRTLAVQY* |
| Ga0137364_102808551 | 3300012198 | Vadose Zone Soil | MMTKGIIIAAAAFMFALTVGILTAESGNDRASSPTIRTLVLQY* |
| Ga0137364_106107902 | 3300012198 | Vadose Zone Soil | MMTKNIIVIAAMFMFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0137383_113531221 | 3300012199 | Vadose Zone Soil | MMTKDLIVAAAITFAVTFAILTAKIAESGNDNASNPIIRTLPLQY* |
| Ga0137382_107828101 | 3300012200 | Vadose Zone Soil | MTKGIIVAAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0137365_100990591 | 3300012201 | Vadose Zone Soil | MMIKGIIIAATAFMFALTVGILTAETSNDRASNPTIRTLALQY* |
| Ga0137365_103887561 | 3300012201 | Vadose Zone Soil | GIIIAATAFMFALTVGILTAETSNDRASNPTIRTLALQY* |
| Ga0137365_106067052 | 3300012201 | Vadose Zone Soil | MMTKDISVAVAITFAVLFAILAAKMAESGNDRASNPTISTLPLQY* |
| Ga0137363_111073562 | 3300012202 | Vadose Zone Soil | MMTKHIIAAAAAFMFALTVGILTANLAESGNDRASGPAIRTLALQY* |
| Ga0137363_114268871 | 3300012202 | Vadose Zone Soil | MMTKGIIVTAAAFMFALTVGILTAQSGNDGASNPTIRTLALQY* |
| Ga0137362_102381321 | 3300012205 | Vadose Zone Soil | MMTKGIIVTAAAFMFALTGGILTAQSGNDRASSPTIRTLALQY* |
| Ga0137380_116969212 | 3300012206 | Vadose Zone Soil | GIIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0137376_113601501 | 3300012208 | Vadose Zone Soil | KGIIIAAAAFMFALTVGILTAESGNDMASSPTIRTLVLQY* |
| Ga0137377_104201813 | 3300012211 | Vadose Zone Soil | IIAVAAAFMFALTVGILTAESGSDRARNPTIRTLALQY* |
| Ga0137377_104309072 | 3300012211 | Vadose Zone Soil | IIAAAAFMFALTVGILTAETSNDRASNPTIRTLALQY* |
| Ga0137377_112089172 | 3300012211 | Vadose Zone Soil | MMTKGIIVVAAFAFAATFGILTAKIAESGNDKASSPTIHTLLMQY* |
| Ga0137387_113156072 | 3300012349 | Vadose Zone Soil | MMTKDLIVAAAITFAVTFAILTAKIAESGNDNASNPIIRTL |
| Ga0137372_107852542 | 3300012350 | Vadose Zone Soil | MMTKDLIVAVAITFAVTFAILTAKIAESGNDNASNPTISTLPLQY* |
| Ga0137371_105728111 | 3300012356 | Vadose Zone Soil | MMTKDLVVAVAITFAVTFAILTAKIAESGNDNASNPTISTLPLQY* |
| Ga0137385_105057512 | 3300012359 | Vadose Zone Soil | MMTKAIIITAAAFVFALTVGILTAESGNDRASSPTIRTLALQY* |
| Ga0137360_102082383 | 3300012361 | Vadose Zone Soil | MDVEAQGASMMTKGIIIAAAAFMFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0137360_105951482 | 3300012361 | Vadose Zone Soil | MMTKGIIVTAAAFMFALTVGILTAESGNDRASSPTVRTLALQY* |
| Ga0137390_101896283 | 3300012363 | Vadose Zone Soil | MMTKGIIITAAAFMFALTVGILTAESGNDRASSPTIRTLVSQY* |
| Ga0137358_103004102 | 3300012582 | Vadose Zone Soil | MITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGTLALQY* |
| Ga0137358_105005041 | 3300012582 | Vadose Zone Soil | MMTKGIIVTAAAFMFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0137358_109751102 | 3300012582 | Vadose Zone Soil | MMTKGIIITAAAFMFALTLGILTTQSGNDRASSPTIRTLALQY* |
| Ga0137395_109469191 | 3300012917 | Vadose Zone Soil | MMTKGIIITAAAFMFALTVGILTAQSGNDRASSPTIRTLVLQY* |
| Ga0137394_106441972 | 3300012922 | Vadose Zone Soil | MMTKGIIVVAAFAFAATFGILTAKIAESGNDKASNPTISTLPVRY* |
| Ga0137359_104594461 | 3300012923 | Vadose Zone Soil | MTKAIIIAAAAFMFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0137359_107521191 | 3300012923 | Vadose Zone Soil | MMTKDLIVAAPITFAVTFAILTAKIAESGNDNASNPIIRTLPLQY* |
| Ga0137359_112987852 | 3300012923 | Vadose Zone Soil | MMTKGIIVVAVAFMFALTVGILTAESGNDRASSPTIRTLALQY* |
| Ga0137359_115035681 | 3300012923 | Vadose Zone Soil | MMTKGIIIAAAAFMFALTVGILTANLAESGNDRASGPTIRT |
| Ga0137404_109485972 | 3300012929 | Vadose Zone Soil | MMTKGIIVVAAFAFAATFGILTAKMAESGNDKASNPTISTLPLRY* |
| Ga0137407_109006602 | 3300012930 | Vadose Zone Soil | MMTKGIIVVAAFAFAATFGILTAKIAESGNDKASNPTISTLPLRY* |
| Ga0126375_107260112 | 3300012948 | Tropical Forest Soil | MTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY* |
| Ga0164300_109455641 | 3300012951 | Soil | MMTKGIIITAAAFMFALTVGMLTAESGNDRASSPTIRTLALQY* |
| Ga0164300_109717531 | 3300012951 | Soil | MRTKSIIIFAVAFMFALTVGVLTAESVNDRASSPTIPTLALQY* |
| Ga0164303_106887251 | 3300012957 | Soil | MMTKNIIIVAAMFMFALTVGILTANLAESGNDRASAPTISTLALQY* |
| Ga0164303_107443461 | 3300012957 | Soil | MITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGALALQY* |
| Ga0164299_104553831 | 3300012958 | Soil | MMTKGIIVTAAVFMFALTVGILTAQSGNDRASNPTIRTLALQY* |
| Ga0164301_100414412 | 3300012960 | Soil | MELEAYGASMRTKSIIIFAAAFMFALTVGILTAESVNDRASNPTIPTLALQY* |
| Ga0164302_103778961 | 3300012961 | Soil | MIIRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0164302_104900951 | 3300012961 | Soil | MMTRAVIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGTLALQY* |
| Ga0126369_100468822 | 3300012971 | Tropical Forest Soil | MMTKNIIVVAAMFMFALTVGILTANLAESGNDRASGPTIHTLVLQY* |
| Ga0126369_101204233 | 3300012971 | Tropical Forest Soil | MMTKGIIIVAAALVFALTVGILTAESGNDRASNPTIRTLALQY* |
| Ga0164309_106700581 | 3300012984 | Soil | MMTKNIIVVVAMFLFALTVGILTADLAVSGNDRASGPTHGALALQY* |
| Ga0164308_109461722 | 3300012985 | Soil | MMTINTIIFVAAFVFALMVGILTAESVNDRGTNPTIPTLALQY* |
| Ga0164307_105053263 | 3300012987 | Soil | MMTRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY* |
| Ga0164307_108329641 | 3300012987 | Soil | KSIIIFAVAFMFALTVGVLTAESVNDRASSPTIPTLALQY* |
| Ga0164305_108058341 | 3300012989 | Soil | MMTINTIIFVAAFVFALTVGILTAESVNDRGTNPTIPTLALQY* |
| Ga0164305_113265412 | 3300012989 | Soil | MMTKGIIITAAAFMFALTVGILTAESGNDRASSPTIRTLALQY* |
| Ga0132258_129097781 | 3300015371 | Arabidopsis Rhizosphere | MTTRNIIIVVAMFMFALTVGILSANLAESGNDRASGPTIGTLALQY* |
| Ga0132258_131819392 | 3300015371 | Arabidopsis Rhizosphere | MMTKNIVVVVAMFLFALTVGILTANLAESGNDRTSSPTIGTLALQY* |
| Ga0132255_1033128431 | 3300015374 | Arabidopsis Rhizosphere | MMTKNIVVVVAMFLFALTVGILTANLAESGNDRTSSPTIGTLALQ |
| Ga0182036_108909672 | 3300016270 | Soil | MMTKGIIAAAAAFMFALTVGMLTAESGNDRASNPTI |
| Ga0182036_111836692 | 3300016270 | Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTL |
| Ga0182036_115461151 | 3300016270 | Soil | AAFMFALTVGILTAKMAESGNDRASTPTIRTLALQY |
| Ga0182036_115709771 | 3300016270 | Soil | AAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY |
| Ga0182036_116188461 | 3300016270 | Soil | KGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0182041_104481721 | 3300016294 | Soil | MMTKGIIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0182041_112279752 | 3300016294 | Soil | MMTKGIIAVAAAFLFALTVGILTADGGNDRASNPTVRTLPLQC |
| Ga0182033_102794921 | 3300016319 | Soil | GASMMTKSIIAVAAAFMFALTVGILTAKIAQSGNDRASNPTIRTLALQY |
| Ga0182033_108394451 | 3300016319 | Soil | AAAFMFALTVGILTANLAQSGNDRASGPTIRTLALQY |
| Ga0182033_110186551 | 3300016319 | Soil | IIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0182033_113092582 | 3300016319 | Soil | AVVAAFLFALTVGMLTANMAESGNDKASNPTIHTLALQY |
| Ga0182033_116277571 | 3300016319 | Soil | MMTKGIIAVGAAFLFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0182033_119253731 | 3300016319 | Soil | KGIIAVTAAFMFALTVGILTAKMAESGNDRASTPTIRTLALQY |
| Ga0182035_118863081 | 3300016341 | Soil | MTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0182032_106408611 | 3300016357 | Soil | MMTKGIIAVAAAFLFALTVGILTADGGNDRASNPTVRTLPLQY |
| Ga0182032_108556701 | 3300016357 | Soil | MMTKGIIIAAAAFMFALTVGMLTAESGNDRASSPTIRTLALQY |
| Ga0182034_115466272 | 3300016371 | Soil | IIAVAAAFLFALTVGILTAESGNDRASNPTVRTLPLQY |
| Ga0182034_115911461 | 3300016371 | Soil | MTKGIIAVAAAFMFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0182034_120497291 | 3300016371 | Soil | IAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0182040_119823121 | 3300016387 | Soil | MMTKSIIAVAAAFMFAWTVGIRTAKIAESGNDRASNPTIRTLALQY |
| Ga0182037_106653301 | 3300016404 | Soil | MMTKGIIAVAAAFMFALTVGILTAKIAQSGNDRASNPTIRTLALQY |
| Ga0182037_108540011 | 3300016404 | Soil | MTTKGIIVAAAAFMFALTVGILTANLAESGNDKASAPTVRTLALQY |
| Ga0182039_106149011 | 3300016422 | Soil | MMTKGIIAVAAAFLFALTVGILTAESGNDRASNPTVRTLPLQY |
| Ga0182039_118739202 | 3300016422 | Soil | MMTKNIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQ |
| Ga0182038_112049531 | 3300016445 | Soil | MMTKGIIAVAAAFLFALTVGILTADGGNDRASNPTV |
| Ga0066655_112492561 | 3300018431 | Grasslands Soil | MMTKAIIITAAAFVFALTVGILTAESGNDRASSPTIRTLVLQY |
| Ga0066667_105764391 | 3300018433 | Grasslands Soil | MMTKGIIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0066662_104144413 | 3300018468 | Grasslands Soil | MMTKGIIITAAAFMFALTLGILTAQSGNDRASSPTIRTLALQY |
| Ga0066669_114131131 | 3300018482 | Grasslands Soil | MMTKNIIVIAAMFMFALTVGILTANLAESGNDRASGPTIGALALQY |
| Ga0210407_105288313 | 3300020579 | Soil | NIIIVAAMFMFALTVGILTANLAESGNDRASAPTISTLALQY |
| Ga0210407_106152881 | 3300020579 | Soil | MRTKSIIIFAVAFMFALTVGVLTAESVNDRASSPTIPTLALQY |
| Ga0210406_101194962 | 3300021168 | Soil | MITVIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0210406_103810931 | 3300021168 | Soil | IIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGTLALQY |
| Ga0210406_108921421 | 3300021168 | Soil | MMTINTIIFVAAFVFALTVGILTAESVNDRGTNPTIPTLALQY |
| Ga0210400_105421151 | 3300021170 | Soil | MEADLEAQGAFMITVIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0210408_100322913 | 3300021178 | Soil | MMTKGIIIAAAFMFALTVGILTADSGNDRASSPTIRTLALQY |
| Ga0213874_101022202 | 3300021377 | Plant Roots | MMTKNIIVVVAMFLFALTVGILTGNLAESGNDRASGPTIGTLALQY |
| Ga0210393_110248851 | 3300021401 | Soil | MITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPPHGTLALQY |
| Ga0210387_115919962 | 3300021405 | Soil | MMTTNTIVFVAAFVFALTVGILTAESVNDRGTSPTIPTLA |
| Ga0210392_102109201 | 3300021475 | Soil | AAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0210402_100546808 | 3300021478 | Soil | MITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGTLALQY |
| Ga0126371_100933183 | 3300021560 | Tropical Forest Soil | MMAKGIIAVAAAFMFALTVGILTAQSSNDRASNPTLRTLALQY |
| Ga0126371_102022171 | 3300021560 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0126371_102177643 | 3300021560 | Tropical Forest Soil | MTKGIIAAAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY |
| Ga0126371_102184494 | 3300021560 | Tropical Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQ |
| Ga0126371_108472142 | 3300021560 | Tropical Forest Soil | MMTKGIIIAAAAFMFALTVGILTAHSGNDRASNPTIRTLALQY |
| Ga0126371_108801812 | 3300021560 | Tropical Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAQSGNDRASGPTIRTLALQY |
| Ga0126371_109701602 | 3300021560 | Tropical Forest Soil | MMTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0126371_111999162 | 3300021560 | Tropical Forest Soil | IAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLVLQY |
| Ga0126371_118767601 | 3300021560 | Tropical Forest Soil | MMTKNIIVVVAMFMFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0126371_118807872 | 3300021560 | Tropical Forest Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY |
| Ga0126371_124549151 | 3300021560 | Tropical Forest Soil | MTKGIIAVAAAFMFALTVGILTAKIAESGNDRASNPT |
| Ga0126371_125522613 | 3300021560 | Tropical Forest Soil | ASMMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY |
| Ga0126371_138260141 | 3300021560 | Tropical Forest Soil | MMTKGIIIVAAAFVFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0242651_10383691 | 3300022511 | Soil | LGAFMMTRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGTLALQY |
| Ga0242658_10804271 | 3300022530 | Soil | IAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0242660_11813022 | 3300022531 | Soil | EAFMITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGTLALQY |
| Ga0242660_12482021 | 3300022531 | Soil | ASMMTKGIIAVAAAFLFALTLGILTAESGNDRASNPTIRTLALQY |
| Ga0242662_101355211 | 3300022533 | Soil | GASMRTKSIIIFAVAFMFALTVGVLTAESVNDRASSPTIPTLALQY |
| Ga0242662_102009352 | 3300022533 | Soil | ASMMTKGIIAVAAAFIFALTVGILTANLAESGNDRASNPTIRTLALQY |
| Ga0207685_100105095 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRATIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0207699_111675981 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MITRAIIAVAAAFLFALTVGILTADLAVSGNDRASGPTHGALALQY |
| Ga0207684_103358422 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKGIIIAAAAFMFALTVGILTAESGNDRASSPTIRTLALQY |
| Ga0207684_105671672 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTKGIIIAAAAFMFALTVGILTAETSNDRASNPTIRTLALQY |
| Ga0207684_113729821 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTRGIIITAAAFIFALTVGILTAESSNDRASSPTIRTLALQ |
| Ga0207693_101360386 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTRAVIAVAAAFLFALTVGILTANLAESGNDRASGPT |
| Ga0207693_105958781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IIVAAMFMFALTVGILTANLAESGNDRASAPTISTLALQY |
| Ga0207693_106209971 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0207693_111491991 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AFAFALAFGILNAKVAQSGNDRASNPTIRTLALQY |
| Ga0207663_105500651 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0207664_109316402 | 3300025929 | Agricultural Soil | MITRAIIAVAAAFLFALTVGILTANLAESGNDRASGPTIG |
| Ga0207665_102509821 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YGTEVEIESQEAFMITRAIIAVAAAFLFALTVGILTADLAVSDNDRASGPTHGTLALQY |
| Ga0207665_102561113 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MMTINTIIFVAAFVFALTVGILTAESVNDRASNPPIPTLALQY |
| Ga0207665_107516841 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QGAFMMTRATIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0209234_10395002 | 3300026295 | Grasslands Soil | MMTKGIIVVAAFAFAATFGILTAKIAESGNDKASSPTIHTLLLQY |
| Ga0209234_11891972 | 3300026295 | Grasslands Soil | VQVEIEAQGAFMMTRATIAVAAAFLFALTVGILTANLAESGNDRASGPTIGTLALQY |
| Ga0209153_10737213 | 3300026312 | Soil | MMTKNIIVVVAMFMFALTVGILTANLAESGNDRASGPTIGALALQY |
| Ga0209266_12492641 | 3300026327 | Soil | IIITAAAFVFALTVGILTAESGNDRASSPTIRTLVLQY |
| Ga0257165_10540882 | 3300026507 | Soil | MTKGIIVTAAAFMFALTVGILTAESGNDRASNPTVRTLALQY |
| Ga0209648_105657712 | 3300026551 | Grasslands Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRAKNPTIRTLALQY |
| Ga0209577_104910751 | 3300026552 | Soil | MMTKAIIITAAAFVFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0209729_10518932 | 3300027061 | Forest Soil | MMTKGIIIAAAAFMFALTVGILTANLAESGNDRASNPTIRTLALQY |
| Ga0209622_10333822 | 3300027502 | Forest Soil | MMTKGIIAVAAAFLFALMVGILTAESGNDRASNPTIRTLPLQY |
| Ga0209799_10254032 | 3300027654 | Tropical Forest Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTIRTLALQY |
| Ga0209590_100920172 | 3300027882 | Vadose Zone Soil | MMTKGIIITAAAFMFALTVGILTAESGNDRASSPTIRTLVLQY |
| Ga0209526_100454563 | 3300028047 | Forest Soil | MMTKGIMIAATAFMFALTVGMLTAESGNDRASSPTIRTFALQY |
| Ga0318516_100083253 | 3300031543 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTFALQY |
| Ga0318516_101181634 | 3300031543 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0318516_102179913 | 3300031543 | Soil | MMAKGLIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0318516_104109411 | 3300031543 | Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLALQY |
| Ga0318516_105679922 | 3300031543 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAQSGNDRASNPTIRTLALQY |
| Ga0318516_105748112 | 3300031543 | Soil | MMTKGIIAVAAAFMFALTVGMLTAKIAESGNDRASNPTIRTLALQY |
| Ga0318516_108708691 | 3300031543 | Soil | AVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0318541_100318974 | 3300031545 | Soil | MMTKGIIAAAAAFMFALTVGMLTAESGNDRASNPTIRTLALQY |
| Ga0318541_100492232 | 3300031545 | Soil | MMTKGIIVAVAAFMFALTVGILTANLAESGNDKATGPTIRTLALQY |
| Ga0318541_102848072 | 3300031545 | Soil | MMTKGIIAVTAAFMFALTVGILTAKMAESGNDRASTPTIRTLALQY |
| Ga0318541_102871411 | 3300031545 | Soil | MMTKGIIAVAAAFLFALTVGILTAKMAESGNDRASNPTIRTLALQY |
| Ga0318541_108126161 | 3300031545 | Soil | TKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0318538_100692792 | 3300031546 | Soil | MTKGIIAVAAAFLFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0318538_101178733 | 3300031546 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRT |
| Ga0318538_101312393 | 3300031546 | Soil | SMMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTFALQY |
| Ga0318571_103471921 | 3300031549 | Soil | SMMTKGIIAVVAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0318528_100782522 | 3300031561 | Soil | MQRDLEALGASMMAKGLIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0318528_104079862 | 3300031561 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTI |
| Ga0318573_101191633 | 3300031564 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0310915_105088562 | 3300031573 | Soil | VLEAQGASMMTKGIIAAAAAFMFALTVGILTANLAESGNDKASAPTVRTLALQY |
| Ga0310915_105754772 | 3300031573 | Soil | MMTKNIMAVVAAFLFSLTVGMLTANMAESGNDKASNPT |
| Ga0318542_104481151 | 3300031668 | Soil | MMTKGIIAVAAAFLFALTVGILTAKMAESGNDRASNP |
| Ga0306917_110414652 | 3300031719 | Soil | MITRAIIAVAAAFLFALTVGILTANLAESDNDRASGPTTGTLALQY |
| Ga0306917_115215531 | 3300031719 | Soil | KNIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0307469_118498811 | 3300031720 | Hardwood Forest Soil | MMTKGIIVAAAAFMFALTVGILTANLAESGNDRASNPTIR |
| Ga0307469_119203772 | 3300031720 | Hardwood Forest Soil | MMTKGIIAVAAAFLFALTVGILTANLAESGNDRATGPTIGTLALQY |
| Ga0318493_106754391 | 3300031723 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSSNDRASNPTI |
| Ga0306918_109948801 | 3300031744 | Soil | AAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0306918_112640442 | 3300031744 | Soil | MMTKGIIVVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0306918_114894411 | 3300031744 | Soil | KSIIAVAAAFMFALTVGILTAKIALSGNDRASNPTIRTLALQY |
| Ga0318492_102352111 | 3300031748 | Soil | HRQLLNKLLCMQRDLEALGASMMAKGLIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0318537_101005912 | 3300031763 | Soil | LDIMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTFALQY |
| Ga0318509_101115092 | 3300031768 | Soil | MMTKGIIAVAAAFMFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0318521_100475115 | 3300031770 | Soil | MMTKGIIAVTAAFMLALTVGILTANMAESGNDRASNPTIRTLALQY |
| Ga0318546_112785001 | 3300031771 | Soil | MTKGIIVAAAAFMFALTVGILAANLAESGNDRATSPTIRTLALQY |
| Ga0318498_105425561 | 3300031778 | Soil | SIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0318566_102940221 | 3300031779 | Soil | MMTKGIIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQ |
| Ga0318497_108610942 | 3300031805 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLGLQY |
| Ga0318568_100570071 | 3300031819 | Soil | GIIVVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0310917_107361392 | 3300031833 | Soil | MMTKGIIALATAFLFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0318527_100523832 | 3300031859 | Soil | MQHDLRSLDMMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTFALQY |
| Ga0318495_103932591 | 3300031860 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLA |
| Ga0306919_104105832 | 3300031879 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNP |
| Ga0306919_108257791 | 3300031879 | Soil | MRGVLEAQGASMMTKGIIAAAAAFMFALTVGILTANLAESGNDKASAPTVRTLALQY |
| Ga0306925_102222793 | 3300031890 | Soil | MQRDLEALGASMMTKGIIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0306925_102689301 | 3300031890 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQ |
| Ga0306925_104579384 | 3300031890 | Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDKASNPTIRTLALQY |
| Ga0306925_104891923 | 3300031890 | Soil | MMTKGIIAVVAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0306925_109502753 | 3300031890 | Soil | MTKGTIVAAAAFMFALTVGILAANLAESGNDRATSPTIRTLALQY |
| Ga0306925_113040402 | 3300031890 | Soil | MTTKGIIVAAAAFMFALTVGILTANLAQSGNDRASGPTIRTLALQY |
| Ga0306925_113758412 | 3300031890 | Soil | MNKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0318551_100061249 | 3300031896 | Soil | MMTKGIIAVAAAFLFALTVGILTVQSSNDRASNPTIRTLALQY |
| Ga0306923_107282322 | 3300031910 | Soil | MMTKGIIAAAAAFMFALTVGILTANLAESGNDKASAPTVRTLALQY |
| Ga0306923_114383692 | 3300031910 | Soil | MTKGIIVAAAAFMFALTVGILTANLAESGNDRASGPTIRTLALQY |
| Ga0306923_115371211 | 3300031910 | Soil | MTTKGIIAIAAAFLFALTVGILTADSGNDRASNPTIRTLALQY |
| Ga0306923_116943241 | 3300031910 | Soil | MTKSIIAVAAAFMFALTVGILTAKIAQSGNDRASNPTIRTLALQY |
| Ga0306923_117235181 | 3300031910 | Soil | MMTKGIIAVVAAFLFALTVGILTAQSGNDRASNPTI |
| Ga0306923_118863401 | 3300031910 | Soil | MMTKGILAVAAAFLFALTVGILTAESGNDRASNPTVRTLPLQY |
| Ga0306923_123957071 | 3300031910 | Soil | NIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0306921_106761833 | 3300031912 | Soil | GASTMTKGIIVAAAAFMFALTVGILAANLAESGNDRATSPTIRTLALQY |
| Ga0310912_108522691 | 3300031941 | Soil | SMMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0310912_113541882 | 3300031941 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASNPTI |
| Ga0310916_110703291 | 3300031942 | Soil | DVTSESLGGSMMTKGIIAVGAAFLFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0310916_117504731 | 3300031942 | Soil | VAAAFMFALTVGILTAKIAESGNDRASSPTIRTFALQY |
| Ga0310910_103898531 | 3300031946 | Soil | NKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0310909_100578164 | 3300031947 | Soil | MTKGIIAAAAAFMFALTVGMLTAESGNDRASNPTIRTLALQY |
| Ga0310909_114154292 | 3300031947 | Soil | MMTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLA |
| Ga0310909_115503001 | 3300031947 | Soil | GASTMTKGTIVAAAAFMFALTVGILAANLAESGNDRATSPTIRTLALQY |
| Ga0306926_123744991 | 3300031954 | Soil | KGIIAAAAAFMFALTVGILTANLAESGNDKASAPTVRTLALQH |
| Ga0306926_125068741 | 3300031954 | Soil | MMTKGIIAVAAAFLFALTVGILTADGGNDRASNPTVRTLPLQ |
| Ga0318530_102222871 | 3300031959 | Soil | VAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0318531_103532882 | 3300031981 | Soil | TQSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQY |
| Ga0306922_117232291 | 3300032001 | Soil | MTKGIIAVAAAFLFALTVGILTAESGNDRASNPTIRTL |
| Ga0318563_100979132 | 3300032009 | Soil | AVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0318507_101321131 | 3300032025 | Soil | MMAKGLIAVAAAFMFALTVGILTAQSSNDRASNPTIRTLAL |
| Ga0310911_104849362 | 3300032035 | Soil | GIIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0318559_102799381 | 3300032039 | Soil | IIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0318545_103838731 | 3300032042 | Soil | MMTKGIIAVAAAFMFALTVGILTAKMAESGNDRASTPTIRTLALQY |
| Ga0318570_104321631 | 3300032054 | Soil | MMTKGIIAVVAAFLFALTVGILTAQSGNDRASNPT |
| Ga0318570_104405102 | 3300032054 | Soil | MTKGIIAVAAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0318505_100289143 | 3300032060 | Soil | SIIAVVAAFLFALTVGILTAESGNDRASNPTVRTLPLQY |
| Ga0318504_106207701 | 3300032063 | Soil | MMAKGIIAVAAAFMFALTVGILTAESGNDRASNPTIRTLALQY |
| Ga0318513_100940151 | 3300032065 | Soil | MMTKSIIAVAAAFMFALTVGILTAKIAESGNDRASSPTIRTLALQ |
| Ga0306924_118801301 | 3300032076 | Soil | TKGILAVAAAFLFALTVGILTAESGNDRASNPTVRTLPLQY |
| Ga0306924_120605101 | 3300032076 | Soil | MMAKGIIAVAAAFMFALTVGILTAESGNDRASNPTIR |
| Ga0318540_102237501 | 3300032094 | Soil | MMTKGIIAVAAAFMLALTVGILTANMAESGNDRASNPTIRTLALQ |
| Ga0318540_104856071 | 3300032094 | Soil | IIIAAAAFMFALTVGILTAESGNDRASSPTVRTLALQY |
| Ga0318540_105645351 | 3300032094 | Soil | KGIIAVVAAFLFALTVGILTAQSGNDRASNPTIRTLALQY |
| Ga0307470_103917902 | 3300032174 | Hardwood Forest Soil | IIIFAAAFLFALTVGILTAESVNDRATSPTIPTLALQY |
| Ga0307471_1031872491 | 3300032180 | Hardwood Forest Soil | MMTKGIIITAAAFMFALTVGILTAESGNDRASSPTIRTLALQY |
| Ga0307472_1004958511 | 3300032205 | Hardwood Forest Soil | FAAAFMFALTVGILTAESVNDRASNPPIPTLALQY |
| Ga0307472_1017616242 | 3300032205 | Hardwood Forest Soil | MMTKAIIITAAAFVFALTVGILTAESGNDRASNPTIRTLPLQY |
| Ga0306920_1002538505 | 3300032261 | Soil | TKGIIAVAAAFLFALTVGILTAQSSNDRASNPTIRTLALQY |
| Ga0306920_1019228702 | 3300032261 | Soil | MMTKGIIAVVAAFMFALTVGILTAKMAESGNDRASNPTIRTLALQY |
| Ga0306920_1032126402 | 3300032261 | Soil | MMTKGIMIAAAAFMFALTVGMLTAESGNDRASSPTIRTLALQY |
| Ga0306920_1033827551 | 3300032261 | Soil | MMAKSIIAVVAAFLFALTVGILTAESGNDRASNPTVRTLPLQY |
| ⦗Top⦘ |