Metagenome / Metatranscriptome Family F003005

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F003005
Family Type	Metagenome / Metatranscriptome
Number of Sequences	514
Average Sequence Length	37 residues
Representative Sequence	MSDVPQNAGYMVAAYIVTAVILLAYAVSLYRRTEKP
Number of Associated Samples	241
Number of Associated Scaffolds	514

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	73.83 %
% of genes near scaffold ends (potentially truncated)	12.65 %
% of genes from short scaffolds (< 2000 bps)	65.95 %
Associated GOLD sequencing projects	208
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (99.027 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.514 % of family members)
Environment Ontology (ENVO)	Unclassified (48.249 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (57.198 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.19% β-sheet: 0.00% Coil/Unstructured: 57.81%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.54
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 514 Family Scaffolds
PF01578	Cytochrom_C_asm	38.33
PF02602	HEM4	12.65
PF03379	CcmB	10.89
PF00005	ABC_tran	2.92
PF01379	Porphobil_deam	2.14
PF00072	Response_reg	1.95
PF00490	ALAD	1.75
PF03900	Porphobil_deamC	1.56
PF13620	CarboxypepD_reg	0.97
PF13466	STAS_2	0.97
PF14559	TPR_19	0.97
PF02801	Ketoacyl-synt_C	0.78
PF00515	TPR_1	0.78
PF08241	Methyltransf_11	0.58
PF00230	MIP	0.58
PF13432	TPR_16	0.58
PF03364	Polyketide_cyc	0.58
PF16177	ACAS_N	0.39
PF01494	FAD_binding_3	0.39
PF13490	zf-HC2	0.19
PF01797	Y1_Tnp	0.19
PF10604	Polyketide_cyc2	0.19
PF13520	AA_permease_2	0.19
PF07719	TPR_2	0.19
PF00930	DPPIV_N	0.19
PF01940	DUF92	0.19
PF04389	Peptidase_M28	0.19
PF03739	LptF_LptG	0.19
PF00557	Peptidase_M24	0.19
PF01522	Polysacc_deac_1	0.19
PF08281	Sigma70_r4_2	0.19
PF00795	CN_hydrolase	0.19

COG ID	Name	Functional Category	% Frequency in 514 Family Scaffolds
COG1587	Uroporphyrinogen-III synthase	Coenzyme transport and metabolism [H]	12.65
COG2386	ABC-type transport system involved in cytochrome c biogenesis, permease component	Posttranslational modification, protein turnover, chaperones [O]	10.89
COG0181	Porphobilinogen deaminase	Coenzyme transport and metabolism [H]	3.70
COG0113	Delta-aminolevulinic acid dehydratase, porphobilinogen synthase	Coenzyme transport and metabolism [H]	1.75
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	0.78
COG0580	Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)	Carbohydrate transport and metabolism [G]	0.58
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.39
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	0.39
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	0.39
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.19
COG0795	Lipopolysaccharide export LptBFGC system, permease protein LptF	Cell wall/membrane/envelope biogenesis [M]	0.19
COG0823	Periplasmic component TolB of the Tol biopolymer transport system	Intracellular trafficking, secretion, and vesicular transport [U]	0.19
COG1506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase	Amino acid transport and metabolism [E]	0.19
COG1836	Cytidylyltransferase family enzyme	General function prediction only [R]	0.19
COG1943	REP element-mobilizing transposase RayT	Mobilome: prophages, transposons [X]	0.19

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	99.03 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	99.03 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	99.03 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	19.46 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.75 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.19 %
Unclassified	root	N/A	0.97 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.58 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	19.46 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.39 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.39 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.19 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.19 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	10.70 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	7.20 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.39 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.19 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.19 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10.70 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	7.20 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.39 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.19 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.19 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10.70 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	7.00 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.39 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	0.19 %
Streptosporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	0.19 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.19 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10.70 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	5.84 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.39 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.19 %
Nonomuraea	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea	0.19 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.19 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10.70 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5.84 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.39 %
unclassified Nonomuraea	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea	0.19 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.19 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.19 %
Unclassified	root	N/A	0.97 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	10.70 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5.84 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.39 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.39 %
Nonomuraea sp. WAC 01424	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. WAC 01424	0.19 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.19 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.19 %
Unclassified	root	N/A	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001086\|JGI12709J13192_1003193	All Organisms → cellular organisms → Bacteria	2016	Open in IMG/M
3300001661\|JGI12053J15887_10106308	All Organisms → cellular organisms → Bacteria	1516	Open in IMG/M
3300002561\|JGI25384J37096_10061598	All Organisms → cellular organisms → Bacteria → Proteobacteria	1397	Open in IMG/M
3300005177\|Ga0066690_10240660	All Organisms → cellular organisms → Bacteria → Proteobacteria	1213	Open in IMG/M
3300005445\|Ga0070708_100253809	All Organisms → cellular organisms → Bacteria	1652	Open in IMG/M
3300005445\|Ga0070708_100293989	All Organisms → cellular organisms → Bacteria	1529	Open in IMG/M
3300005445\|Ga0070708_101549847	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	617	Open in IMG/M
3300005446\|Ga0066686_10098800	All Organisms → cellular organisms → Bacteria	1876	Open in IMG/M
3300005446\|Ga0066686_10239678	All Organisms → cellular organisms → Bacteria	1222	Open in IMG/M
3300005467\|Ga0070706_101235440	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300005518\|Ga0070699_100023944	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5263	Open in IMG/M
3300005529\|Ga0070741_10322703	All Organisms → cellular organisms → Bacteria	1442	Open in IMG/M
3300005536\|Ga0070697_100041442	All Organisms → cellular organisms → Bacteria	3727	Open in IMG/M
3300005540\|Ga0066697_10001191	All Organisms → cellular organisms → Bacteria	10495	Open in IMG/M
3300005540\|Ga0066697_10006422	All Organisms → cellular organisms → Bacteria	5806	Open in IMG/M
3300005540\|Ga0066697_10042877	All Organisms → cellular organisms → Bacteria	2546	Open in IMG/M
3300005540\|Ga0066697_10059856	All Organisms → cellular organisms → Bacteria	2173	Open in IMG/M
3300005540\|Ga0066697_10173583	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1278	Open in IMG/M
3300005540\|Ga0066697_10206493	All Organisms → cellular organisms → Bacteria	1168	Open in IMG/M
3300005540\|Ga0066697_10563896	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300005540\|Ga0066697_10688047	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300005540\|Ga0066697_10706566	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	551	Open in IMG/M
3300005552\|Ga0066701_10126549	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1518	Open in IMG/M
3300005552\|Ga0066701_10202295	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1218	Open in IMG/M
3300005552\|Ga0066701_10258050	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300005552\|Ga0066701_10264648	All Organisms → cellular organisms → Bacteria	1064	Open in IMG/M
3300005552\|Ga0066701_10408528	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300005552\|Ga0066701_10592118	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	676	Open in IMG/M
3300005552\|Ga0066701_10777793	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300005552\|Ga0066701_10919693	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300005553\|Ga0066695_10020922	All Organisms → cellular organisms → Bacteria	3649	Open in IMG/M
3300005553\|Ga0066695_10033327	All Organisms → cellular organisms → Bacteria	2992	Open in IMG/M
3300005553\|Ga0066695_10033458	All Organisms → cellular organisms → Bacteria	2987	Open in IMG/M
3300005553\|Ga0066695_10145549	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1474	Open in IMG/M
3300005553\|Ga0066695_10211195	All Organisms → cellular organisms → Bacteria	1219	Open in IMG/M
3300005553\|Ga0066695_10831931	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	530	Open in IMG/M
3300005553\|Ga0066695_10852711	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300005554\|Ga0066661_10027158	All Organisms → cellular organisms → Bacteria	3120	Open in IMG/M
3300005554\|Ga0066661_10115667	All Organisms → cellular organisms → Bacteria	1617	Open in IMG/M
3300005554\|Ga0066661_10244683	All Organisms → cellular organisms → Bacteria	1110	Open in IMG/M
3300005555\|Ga0066692_10026924	All Organisms → cellular organisms → Bacteria → Proteobacteria	2997	Open in IMG/M
3300005555\|Ga0066692_10169488	All Organisms → cellular organisms → Bacteria	1351	Open in IMG/M
3300005555\|Ga0066692_10221460	All Organisms → cellular organisms → Bacteria	1190	Open in IMG/M
3300005556\|Ga0066707_10026885	All Organisms → cellular organisms → Bacteria	3134	Open in IMG/M
3300005557\|Ga0066704_10697527	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300005557\|Ga0066704_10727901	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	622	Open in IMG/M
3300005558\|Ga0066698_10044412	All Organisms → cellular organisms → Bacteria	2777	Open in IMG/M
3300005558\|Ga0066698_10874806	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	577	Open in IMG/M
3300005558\|Ga0066698_10978023	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	538	Open in IMG/M
3300005558\|Ga0066698_11105505	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300005560\|Ga0066670_10009883	All Organisms → cellular organisms → Bacteria	4032	Open in IMG/M
3300005560\|Ga0066670_10361465	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M
3300005561\|Ga0066699_10117326	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1778	Open in IMG/M
3300005561\|Ga0066699_10245271	All Organisms → cellular organisms → Bacteria	1262	Open in IMG/M
3300005561\|Ga0066699_10678409	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300005566\|Ga0066693_10104809	All Organisms → cellular organisms → Bacteria	1024	Open in IMG/M
3300005569\|Ga0066705_10002913	All Organisms → cellular organisms → Bacteria	6777	Open in IMG/M
3300005569\|Ga0066705_10064999	All Organisms → cellular organisms → Bacteria	2089	Open in IMG/M
3300005574\|Ga0066694_10010092	All Organisms → cellular organisms → Bacteria	3995	Open in IMG/M
3300005574\|Ga0066694_10066426	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1657	Open in IMG/M
3300005574\|Ga0066694_10179322	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300005574\|Ga0066694_10246807	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300005574\|Ga0066694_10427913	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	621	Open in IMG/M
3300005575\|Ga0066702_10274843	All Organisms → cellular organisms → Bacteria	1028	Open in IMG/M
3300005576\|Ga0066708_10109573	All Organisms → cellular organisms → Bacteria	1652	Open in IMG/M
3300005576\|Ga0066708_10293318	All Organisms → cellular organisms → Bacteria	1040	Open in IMG/M
3300005576\|Ga0066708_10916697	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	546	Open in IMG/M
3300005586\|Ga0066691_10156743	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1312	Open in IMG/M
3300005586\|Ga0066691_10664552	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	617	Open in IMG/M
3300005598\|Ga0066706_10221308	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1462	Open in IMG/M
3300005598\|Ga0066706_10453727	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1021	Open in IMG/M
3300005836\|Ga0074470_10518466	All Organisms → cellular organisms → Bacteria	643	Open in IMG/M
3300005889\|Ga0075290_1012193	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300006031\|Ga0066651_10377929	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300006034\|Ga0066656_10003198	All Organisms → cellular organisms → Bacteria	7538	Open in IMG/M
3300006034\|Ga0066656_10137948	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1515	Open in IMG/M
3300006034\|Ga0066656_10297249	All Organisms → cellular organisms → Bacteria	1041	Open in IMG/M
3300006034\|Ga0066656_10466460	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	823	Open in IMG/M
3300006034\|Ga0066656_10685528	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300006034\|Ga0066656_10771592	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300006046\|Ga0066652_100023979	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4253	Open in IMG/M
3300006046\|Ga0066652_100027521	All Organisms → cellular organisms → Bacteria	4022	Open in IMG/M
3300006046\|Ga0066652_101698094	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300006049\|Ga0075417_10027980	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	2313	Open in IMG/M
3300006163\|Ga0070715_10172637	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300006173\|Ga0070716_100021090	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3429	Open in IMG/M
3300006175\|Ga0070712_101340170	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	624	Open in IMG/M
3300006755\|Ga0079222_10000736	All Organisms → cellular organisms → Bacteria	8340	Open in IMG/M
3300006755\|Ga0079222_10026730	All Organisms → cellular organisms → Bacteria	2405	Open in IMG/M
3300006755\|Ga0079222_10031877	All Organisms → cellular organisms → Bacteria	2260	Open in IMG/M
3300006755\|Ga0079222_10228106	All Organisms → cellular organisms → Bacteria	1149	Open in IMG/M
3300006755\|Ga0079222_10561805	All Organisms → cellular organisms → Bacteria	858	Open in IMG/M
3300006755\|Ga0079222_11226183	All Organisms → cellular organisms → Bacteria	675	Open in IMG/M
3300006791\|Ga0066653_10013589	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	2901	Open in IMG/M
3300006791\|Ga0066653_10164528	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1095	Open in IMG/M
3300006791\|Ga0066653_10242721	All Organisms → cellular organisms → Bacteria	917	Open in IMG/M
3300006791\|Ga0066653_10313314	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300006794\|Ga0066658_10024916	All Organisms → cellular organisms → Bacteria	2375	Open in IMG/M
3300006794\|Ga0066658_10025364	All Organisms → cellular organisms → Bacteria	2358	Open in IMG/M
3300006794\|Ga0066658_10511381	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	654	Open in IMG/M
3300006796\|Ga0066665_11567367	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	517	Open in IMG/M
3300006797\|Ga0066659_10320290	All Organisms → cellular organisms → Bacteria	1191	Open in IMG/M
3300006797\|Ga0066659_10361749	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1129	Open in IMG/M
3300006797\|Ga0066659_10854082	All Organisms → cellular organisms → Bacteria	757	Open in IMG/M
3300006800\|Ga0066660_11284034	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300006804\|Ga0079221_10040031	All Organisms → cellular organisms → Bacteria	2043	Open in IMG/M
3300006804\|Ga0079221_10075407	All Organisms → cellular organisms → Bacteria	1588	Open in IMG/M
3300006804\|Ga0079221_11456308	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300006806\|Ga0079220_10097751	All Organisms → cellular organisms → Bacteria	1514	Open in IMG/M
3300006806\|Ga0079220_10162437	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1246	Open in IMG/M
3300006806\|Ga0079220_10419257	All Organisms → cellular organisms → Bacteria	882	Open in IMG/M
3300006806\|Ga0079220_10908003	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	684	Open in IMG/M
3300006806\|Ga0079220_11592740	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300006852\|Ga0075433_10000113	All Organisms → cellular organisms → Bacteria	40079	Open in IMG/M
3300006852\|Ga0075433_10620207	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	949	Open in IMG/M
3300006854\|Ga0075425_100062458	All Organisms → cellular organisms → Bacteria → Proteobacteria	4181	Open in IMG/M
3300006854\|Ga0075425_100110334	All Organisms → cellular organisms → Bacteria	3136	Open in IMG/M
3300006854\|Ga0075425_100617798	All Organisms → cellular organisms → Bacteria	1246	Open in IMG/M
3300006854\|Ga0075425_100929588	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	994	Open in IMG/M
3300006854\|Ga0075425_102183646	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300006871\|Ga0075434_101196836	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300006876\|Ga0079217_10106343	All Organisms → cellular organisms → Bacteria	1273	Open in IMG/M
3300006903\|Ga0075426_10057838	All Organisms → cellular organisms → Bacteria	2767	Open in IMG/M
3300006914\|Ga0075436_100030003	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	3741	Open in IMG/M
3300007076\|Ga0075435_100003669	All Organisms → cellular organisms → Bacteria	10461	Open in IMG/M
3300007076\|Ga0075435_101267168	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	645	Open in IMG/M
3300007258\|Ga0099793_10025378	All Organisms → cellular organisms → Bacteria	2473	Open in IMG/M
3300007258\|Ga0099793_10140456	All Organisms → cellular organisms → Bacteria	1140	Open in IMG/M
3300007258\|Ga0099793_10518307	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300007265\|Ga0099794_10014636	All Organisms → cellular organisms → Bacteria	3441	Open in IMG/M
3300009012\|Ga0066710_100793360	All Organisms → cellular organisms → Bacteria	1451	Open in IMG/M
3300009012\|Ga0066710_101135728	All Organisms → cellular organisms → Bacteria	1209	Open in IMG/M
3300009012\|Ga0066710_101223293	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1164	Open in IMG/M
3300009012\|Ga0066710_101526740	All Organisms → cellular organisms → Bacteria	1029	Open in IMG/M
3300009012\|Ga0066710_102134866	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300009012\|Ga0066710_103814518	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	565	Open in IMG/M
3300009012\|Ga0066710_103997153	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300009038\|Ga0099829_10027080	All Organisms → cellular organisms → Bacteria	4033	Open in IMG/M
3300009038\|Ga0099829_10034600	All Organisms → cellular organisms → Bacteria	3634	Open in IMG/M
3300009038\|Ga0099829_10037907	All Organisms → cellular organisms → Bacteria	3488	Open in IMG/M
3300009038\|Ga0099829_10040083	All Organisms → cellular organisms → Bacteria	3405	Open in IMG/M
3300009038\|Ga0099829_11339827	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. WAC 01424	592	Open in IMG/M
3300009078\|Ga0105106_10116623	All Organisms → cellular organisms → Bacteria	1963	Open in IMG/M
3300009088\|Ga0099830_10031029	All Organisms → cellular organisms → Bacteria	3610	Open in IMG/M
3300009088\|Ga0099830_10192720	All Organisms → cellular organisms → Bacteria	1591	Open in IMG/M
3300009089\|Ga0099828_11035940	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	730	Open in IMG/M
3300009090\|Ga0099827_10000938	All Organisms → cellular organisms → Bacteria	14356	Open in IMG/M
3300009090\|Ga0099827_10002906	All Organisms → cellular organisms → Bacteria	9648	Open in IMG/M
3300009090\|Ga0099827_10021039	All Organisms → cellular organisms → Bacteria	4528	Open in IMG/M
3300009090\|Ga0099827_10067825	All Organisms → cellular organisms → Bacteria	2743	Open in IMG/M
3300009090\|Ga0099827_10154458	All Organisms → cellular organisms → Bacteria	1880	Open in IMG/M
3300009090\|Ga0099827_10274743	All Organisms → cellular organisms → Bacteria	1421	Open in IMG/M
3300009090\|Ga0099827_10293320	All Organisms → cellular organisms → Bacteria	1375	Open in IMG/M
3300009090\|Ga0099827_11385839	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	612	Open in IMG/M
3300009137\|Ga0066709_100356701	All Organisms → cellular organisms → Bacteria	2011	Open in IMG/M
3300009137\|Ga0066709_102491232	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300009137\|Ga0066709_102648441	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300009162\|Ga0075423_10953407	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300009162\|Ga0075423_11491679	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300009804\|Ga0105063_1023880	All Organisms → cellular organisms → Bacteria	747	Open in IMG/M
3300009813\|Ga0105057_1085881	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	564	Open in IMG/M
3300009814\|Ga0105082_1045213	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300010047\|Ga0126382_10119251	All Organisms → cellular organisms → Bacteria	1745	Open in IMG/M
3300010303\|Ga0134082_10059620	All Organisms → cellular organisms → Bacteria	1474	Open in IMG/M
3300010304\|Ga0134088_10096844	All Organisms → cellular organisms → Bacteria	1386	Open in IMG/M
3300010304\|Ga0134088_10223639	All Organisms → cellular organisms → Bacteria	903	Open in IMG/M
3300010304\|Ga0134088_10255570	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	843	Open in IMG/M
3300010321\|Ga0134067_10010008	All Organisms → cellular organisms → Bacteria	2670	Open in IMG/M
3300010321\|Ga0134067_10034357	All Organisms → cellular organisms → Bacteria	1584	Open in IMG/M
3300010321\|Ga0134067_10295976	All Organisms → cellular organisms → Bacteria	623	Open in IMG/M
3300010322\|Ga0134084_10175693	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300010325\|Ga0134064_10082940	All Organisms → cellular organisms → Bacteria	1031	Open in IMG/M
3300010326\|Ga0134065_10472419	All Organisms → cellular organisms → Bacteria	517	Open in IMG/M
3300010333\|Ga0134080_10664585	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300010336\|Ga0134071_10000747	All Organisms → cellular organisms → Bacteria	11160	Open in IMG/M
3300010336\|Ga0134071_10036696	All Organisms → cellular organisms → Bacteria	2170	Open in IMG/M
3300010336\|Ga0134071_10243746	All Organisms → cellular organisms → Bacteria	894	Open in IMG/M
3300010337\|Ga0134062_10174186	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300010337\|Ga0134062_10782007	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300010358\|Ga0126370_10594429	All Organisms → cellular organisms → Bacteria	954	Open in IMG/M
3300010371\|Ga0134125_10046629	All Organisms → cellular organisms → Bacteria	4823	Open in IMG/M
3300010391\|Ga0136847_12341942	All Organisms → cellular organisms → Bacteria	2110	Open in IMG/M
3300010396\|Ga0134126_11637387	All Organisms → cellular organisms → Bacteria	707	Open in IMG/M
3300010403\|Ga0134123_10505370	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1139	Open in IMG/M
3300011269\|Ga0137392_10106403	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2219	Open in IMG/M
3300011270\|Ga0137391_10693457	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300011270\|Ga0137391_11364078	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300011271\|Ga0137393_10008052	All Organisms → cellular organisms → Bacteria	7098	Open in IMG/M
3300011413\|Ga0137333_1082175	All Organisms → cellular organisms → Bacteria	742	Open in IMG/M
3300012096\|Ga0137389_11686594	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300012189\|Ga0137388_11517603	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	607	Open in IMG/M
3300012198\|Ga0137364_10106972	All Organisms → cellular organisms → Bacteria	1977	Open in IMG/M
3300012199\|Ga0137383_10009983	All Organisms → cellular organisms → Bacteria	6310	Open in IMG/M
3300012199\|Ga0137383_10010140	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6265	Open in IMG/M
3300012199\|Ga0137383_10067784	All Organisms → cellular organisms → Bacteria	2569	Open in IMG/M
3300012199\|Ga0137383_10154509	All Organisms → cellular organisms → Bacteria	1680	Open in IMG/M
3300012199\|Ga0137383_10154950	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300012199\|Ga0137383_10991235	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300012200\|Ga0137382_10036651	All Organisms → cellular organisms → Bacteria	2978	Open in IMG/M
3300012200\|Ga0137382_10107725	All Organisms → cellular organisms → Bacteria	1847	Open in IMG/M
3300012200\|Ga0137382_10370416	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300012200\|Ga0137382_10818883	All Organisms → cellular organisms → Bacteria	670	Open in IMG/M
3300012200\|Ga0137382_11017148	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300012201\|Ga0137365_10162506	All Organisms → cellular organisms → Bacteria	1674	Open in IMG/M
3300012201\|Ga0137365_10999302	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300012203\|Ga0137399_10190209	All Organisms → cellular organisms → Bacteria	1661	Open in IMG/M
3300012203\|Ga0137399_10371361	All Organisms → cellular organisms → Bacteria	1190	Open in IMG/M
3300012203\|Ga0137399_10712336	Not Available	845	Open in IMG/M
3300012204\|Ga0137374_10012219	All Organisms → cellular organisms → Bacteria	10019	Open in IMG/M
3300012204\|Ga0137374_10025201	All Organisms → cellular organisms → Bacteria	6640	Open in IMG/M
3300012204\|Ga0137374_10612645	All Organisms → cellular organisms → Bacteria	829	Open in IMG/M
3300012204\|Ga0137374_10722082	All Organisms → cellular organisms → Bacteria	746	Open in IMG/M
3300012204\|Ga0137374_10998926	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	605	Open in IMG/M
3300012205\|Ga0137362_10142407	All Organisms → cellular organisms → Bacteria	2045	Open in IMG/M
3300012206\|Ga0137380_10000017	All Organisms → cellular organisms → Bacteria	102178	Open in IMG/M
3300012206\|Ga0137380_10017648	All Organisms → cellular organisms → Bacteria	6534	Open in IMG/M
3300012206\|Ga0137380_10179049	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1928	Open in IMG/M
3300012206\|Ga0137380_10413706	All Organisms → cellular organisms → Bacteria	1196	Open in IMG/M
3300012206\|Ga0137380_11209792	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300012206\|Ga0137380_11596141	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300012206\|Ga0137380_11711172	All Organisms → cellular organisms → Bacteria	513	Open in IMG/M
3300012207\|Ga0137381_11443444	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300012208\|Ga0137376_10075860	All Organisms → cellular organisms → Bacteria	2808	Open in IMG/M
3300012209\|Ga0137379_10956643	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300012210\|Ga0137378_10031494	All Organisms → cellular organisms → Bacteria	4701	Open in IMG/M
3300012211\|Ga0137377_10057588	All Organisms → cellular organisms → Bacteria	3607	Open in IMG/M
3300012211\|Ga0137377_10269518	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1634	Open in IMG/M
3300012211\|Ga0137377_11071426	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300012211\|Ga0137377_11927950	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300012285\|Ga0137370_10029493	All Organisms → cellular organisms → Bacteria	2837	Open in IMG/M
3300012349\|Ga0137387_10053866	All Organisms → cellular organisms → Bacteria	2691	Open in IMG/M
3300012350\|Ga0137372_10012210	All Organisms → cellular organisms → Bacteria	8209	Open in IMG/M
3300012350\|Ga0137372_10045669	All Organisms → cellular organisms → Bacteria	3910	Open in IMG/M
3300012350\|Ga0137372_10054784	All Organisms → cellular organisms → Bacteria	3503	Open in IMG/M
3300012350\|Ga0137372_10442532	All Organisms → cellular organisms → Bacteria	976	Open in IMG/M
3300012351\|Ga0137386_10094240	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2111	Open in IMG/M
3300012351\|Ga0137386_10451415	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300012353\|Ga0137367_10620181	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300012354\|Ga0137366_10121099	All Organisms → cellular organisms → Bacteria	1976	Open in IMG/M
3300012354\|Ga0137366_10169242	All Organisms → cellular organisms → Bacteria	1641	Open in IMG/M
3300012354\|Ga0137366_10963983	All Organisms → cellular organisms → Bacteria	596	Open in IMG/M
3300012355\|Ga0137369_10052115	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	3574	Open in IMG/M
3300012355\|Ga0137369_10201815	All Organisms → cellular organisms → Bacteria	1536	Open in IMG/M
3300012356\|Ga0137371_10181532	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1649	Open in IMG/M
3300012358\|Ga0137368_10761785	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300012359\|Ga0137385_10393337	All Organisms → cellular organisms → Bacteria	1183	Open in IMG/M
3300012359\|Ga0137385_10916355	All Organisms → cellular organisms → Bacteria	725	Open in IMG/M
3300012362\|Ga0137361_10059906	All Organisms → cellular organisms → Bacteria	3179	Open in IMG/M
3300012362\|Ga0137361_10343333	All Organisms → cellular organisms → Bacteria	1370	Open in IMG/M
3300012399\|Ga0134061_1205900	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	544	Open in IMG/M
3300012582\|Ga0137358_10030286	All Organisms → cellular organisms → Bacteria	3547	Open in IMG/M
3300012683\|Ga0137398_10065202	All Organisms → cellular organisms → Bacteria	2205	Open in IMG/M
3300012683\|Ga0137398_10123171	All Organisms → cellular organisms → Bacteria	1658	Open in IMG/M
3300012683\|Ga0137398_10168562	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1430	Open in IMG/M
3300012685\|Ga0137397_10006287	All Organisms → cellular organisms → Bacteria	8222	Open in IMG/M
3300012685\|Ga0137397_10481718	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300012918\|Ga0137396_10283237	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1225	Open in IMG/M
3300012918\|Ga0137396_10407878	All Organisms → cellular organisms → Bacteria	1007	Open in IMG/M
3300012922\|Ga0137394_10083562	All Organisms → cellular organisms → Bacteria	2675	Open in IMG/M
3300012922\|Ga0137394_11332855	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300012924\|Ga0137413_11818039	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300012925\|Ga0137419_10238214	All Organisms → cellular organisms → Bacteria	1366	Open in IMG/M
3300012925\|Ga0137419_10863467	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300012925\|Ga0137419_10935182	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	715	Open in IMG/M
3300012927\|Ga0137416_10120282	All Organisms → cellular organisms → Bacteria	2009	Open in IMG/M
3300012929\|Ga0137404_10265547	All Organisms → cellular organisms → Bacteria	1478	Open in IMG/M
3300012929\|Ga0137404_10886478	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	813	Open in IMG/M
3300012929\|Ga0137404_11725768	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300012931\|Ga0153915_10052247	All Organisms → cellular organisms → Bacteria	4194	Open in IMG/M
3300012944\|Ga0137410_10654627	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300012975\|Ga0134110_10003530	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5710	Open in IMG/M
3300012976\|Ga0134076_10011241	All Organisms → cellular organisms → Bacteria	3047	Open in IMG/M
3300012976\|Ga0134076_10189175	All Organisms → cellular organisms → Bacteria	859	Open in IMG/M
3300014150\|Ga0134081_10145281	All Organisms → cellular organisms → Bacteria	776	Open in IMG/M
3300014150\|Ga0134081_10201416	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	676	Open in IMG/M
3300014154\|Ga0134075_10415954	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300014157\|Ga0134078_10148032	All Organisms → cellular organisms → Bacteria	921	Open in IMG/M
3300014157\|Ga0134078_10349022	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300014157\|Ga0134078_10586723	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300015242\|Ga0137412_10473752	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	961	Open in IMG/M
3300015356\|Ga0134073_10014647	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	1804	Open in IMG/M
3300015358\|Ga0134089_10002902	All Organisms → cellular organisms → Bacteria	4918	Open in IMG/M
3300015358\|Ga0134089_10251039	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300015359\|Ga0134085_10238247	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	790	Open in IMG/M
3300015371\|Ga0132258_10736082	All Organisms → cellular organisms → Bacteria	2484	Open in IMG/M
3300015371\|Ga0132258_11168414	All Organisms → cellular organisms → Bacteria	1945	Open in IMG/M
3300015372\|Ga0132256_100578761	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1237	Open in IMG/M
3300017656\|Ga0134112_10002014	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	6148	Open in IMG/M
3300017657\|Ga0134074_1081381	All Organisms → cellular organisms → Bacteria	1105	Open in IMG/M
3300017659\|Ga0134083_10020997	All Organisms → cellular organisms → Bacteria	2305	Open in IMG/M
3300017659\|Ga0134083_10436841	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300017959\|Ga0187779_10587291	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300017966\|Ga0187776_10467696	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300018027\|Ga0184605_10000058	All Organisms → cellular organisms → Bacteria	31101	Open in IMG/M
3300018031\|Ga0184634_10000756	All Organisms → cellular organisms → Bacteria	8824	Open in IMG/M
3300018031\|Ga0184634_10197731	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300018031\|Ga0184634_10230350	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300018060\|Ga0187765_10727311	All Organisms → cellular organisms → Bacteria	654	Open in IMG/M
3300018063\|Ga0184637_10007265	All Organisms → cellular organisms → Bacteria	6708	Open in IMG/M
3300018071\|Ga0184618_10097998	All Organisms → cellular organisms → Bacteria	1146	Open in IMG/M
3300018071\|Ga0184618_10165614	All Organisms → cellular organisms → Bacteria	911	Open in IMG/M
3300018074\|Ga0184640_10074704	All Organisms → cellular organisms → Bacteria	1441	Open in IMG/M
3300018074\|Ga0184640_10243762	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300018431\|Ga0066655_10000571	All Organisms → cellular organisms → Bacteria	12420	Open in IMG/M
3300018431\|Ga0066655_10042773	All Organisms → cellular organisms → Bacteria	2290	Open in IMG/M
3300018431\|Ga0066655_10068258	All Organisms → cellular organisms → Bacteria	1896	Open in IMG/M
3300018431\|Ga0066655_10071282	All Organisms → cellular organisms → Bacteria	1864	Open in IMG/M
3300018431\|Ga0066655_10085122	All Organisms → cellular organisms → Bacteria	1733	Open in IMG/M
3300018431\|Ga0066655_10295633	All Organisms → cellular organisms → Bacteria	1053	Open in IMG/M
3300018431\|Ga0066655_10366454	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	948	Open in IMG/M
3300018431\|Ga0066655_10471803	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	829	Open in IMG/M
3300018431\|Ga0066655_11317079	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	519	Open in IMG/M
3300018433\|Ga0066667_10000887	All Organisms → cellular organisms → Bacteria	10740	Open in IMG/M
3300018433\|Ga0066667_10027663	All Organisms → cellular organisms → Bacteria	3136	Open in IMG/M
3300018433\|Ga0066667_10083363	All Organisms → cellular organisms → Bacteria	2068	Open in IMG/M
3300018433\|Ga0066667_10270232	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M
3300018433\|Ga0066667_10356163	All Organisms → cellular organisms → Bacteria	1166	Open in IMG/M
3300018433\|Ga0066667_10535802	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300018433\|Ga0066667_10760397	All Organisms → cellular organisms → Bacteria	819	Open in IMG/M
3300018433\|Ga0066667_11030207	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300018433\|Ga0066667_11137788	All Organisms → cellular organisms → Bacteria	677	Open in IMG/M
3300018433\|Ga0066667_11184447	All Organisms → cellular organisms → Bacteria	664	Open in IMG/M
3300018468\|Ga0066662_10006419	All Organisms → cellular organisms → Bacteria	5827	Open in IMG/M
3300018468\|Ga0066662_10127200	All Organisms → cellular organisms → Bacteria	1875	Open in IMG/M
3300018468\|Ga0066662_10172011	All Organisms → cellular organisms → Bacteria	1671	Open in IMG/M
3300018468\|Ga0066662_10235580	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300018468\|Ga0066662_10296414	All Organisms → cellular organisms → Bacteria	1355	Open in IMG/M
3300018468\|Ga0066662_10551333	All Organisms → cellular organisms → Bacteria	1065	Open in IMG/M
3300018468\|Ga0066662_11286642	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300018482\|Ga0066669_10001830	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	8382	Open in IMG/M
3300018482\|Ga0066669_10002203	All Organisms → cellular organisms → Bacteria	7919	Open in IMG/M
3300018482\|Ga0066669_10099621	All Organisms → cellular organisms → Bacteria	2014	Open in IMG/M
3300018482\|Ga0066669_10136646	All Organisms → cellular organisms → Bacteria	1778	Open in IMG/M
3300018482\|Ga0066669_10161428	All Organisms → cellular organisms → Bacteria	1664	Open in IMG/M
3300018482\|Ga0066669_10257818	All Organisms → cellular organisms → Bacteria	1384	Open in IMG/M
3300018482\|Ga0066669_11872175	All Organisms → cellular organisms → Bacteria	557	Open in IMG/M
3300019789\|Ga0137408_1188023	All Organisms → cellular organisms → Bacteria	1597	Open in IMG/M
3300020004\|Ga0193755_1000228	All Organisms → cellular organisms → Bacteria	15917	Open in IMG/M
3300020170\|Ga0179594_10003980	All Organisms → cellular organisms → Bacteria	3621	Open in IMG/M
3300020170\|Ga0179594_10017837	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2108	Open in IMG/M
3300020199\|Ga0179592_10025865	All Organisms → cellular organisms → Bacteria	2633	Open in IMG/M
3300020200\|Ga0194121_10131945	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	1494	Open in IMG/M
3300021046\|Ga0215015_10039324	All Organisms → cellular organisms → Bacteria	6037	Open in IMG/M
3300021046\|Ga0215015_10195947	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	3491	Open in IMG/M
3300021046\|Ga0215015_10703577	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5768	Open in IMG/M
3300021086\|Ga0179596_10008403	All Organisms → cellular organisms → Bacteria	3266	Open in IMG/M
3300021086\|Ga0179596_10205331	All Organisms → cellular organisms → Bacteria	960	Open in IMG/M
3300021086\|Ga0179596_10286146	All Organisms → cellular organisms → Bacteria	820	Open in IMG/M
3300021178\|Ga0210408_10404916	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1087	Open in IMG/M
3300021559\|Ga0210409_10207772	All Organisms → cellular organisms → Bacteria	1781	Open in IMG/M
3300024182\|Ga0247669_1000542	All Organisms → cellular organisms → Bacteria	14622	Open in IMG/M
3300024246\|Ga0247680_1001613	All Organisms → cellular organisms → Bacteria	4304	Open in IMG/M
3300024330\|Ga0137417_1182235	All Organisms → cellular organisms → Bacteria	1509	Open in IMG/M
3300024330\|Ga0137417_1353456	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	1722	Open in IMG/M
3300025159\|Ga0209619_10294356	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300025165\|Ga0209108_10181326	All Organisms → cellular organisms → Bacteria	1097	Open in IMG/M
3300025885\|Ga0207653_10027443	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1828	Open in IMG/M
3300025898\|Ga0207692_10152439	All Organisms → cellular organisms → Bacteria	1325	Open in IMG/M
3300025906\|Ga0207699_10020032	All Organisms → cellular organisms → Bacteria → Proteobacteria	3577	Open in IMG/M
3300025910\|Ga0207684_10090253	All Organisms → cellular organisms → Bacteria	2611	Open in IMG/M
3300025910\|Ga0207684_10402741	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1176	Open in IMG/M
3300025922\|Ga0207646_11267904	Not Available	644	Open in IMG/M
3300025922\|Ga0207646_11477028	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300025939\|Ga0207665_10012940	All Organisms → cellular organisms → Bacteria	5488	Open in IMG/M
3300026277\|Ga0209350_1004535	All Organisms → cellular organisms → Bacteria	4929	Open in IMG/M
3300026277\|Ga0209350_1016935	All Organisms → cellular organisms → Bacteria	2278	Open in IMG/M
3300026277\|Ga0209350_1024854	All Organisms → cellular organisms → Bacteria	1824	Open in IMG/M
3300026277\|Ga0209350_1155613	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300026277\|Ga0209350_1161526	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300026295\|Ga0209234_1001845	All Organisms → cellular organisms → Bacteria	8063	Open in IMG/M
3300026295\|Ga0209234_1018528	All Organisms → cellular organisms → Bacteria	2630	Open in IMG/M
3300026295\|Ga0209234_1030715	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	2039	Open in IMG/M
3300026295\|Ga0209234_1307306	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300026295\|Ga0209234_1308721	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300026296\|Ga0209235_1000422	All Organisms → cellular organisms → Bacteria	21050	Open in IMG/M
3300026296\|Ga0209235_1000443	All Organisms → cellular organisms → Bacteria	20575	Open in IMG/M
3300026296\|Ga0209235_1004507	All Organisms → cellular organisms → Bacteria → Proteobacteria	7788	Open in IMG/M
3300026296\|Ga0209235_1004610	All Organisms → cellular organisms → Bacteria	7702	Open in IMG/M
3300026296\|Ga0209235_1038388	All Organisms → cellular organisms → Bacteria	2407	Open in IMG/M
3300026296\|Ga0209235_1047334	All Organisms → cellular organisms → Bacteria	2093	Open in IMG/M
3300026296\|Ga0209235_1063464	All Organisms → cellular organisms → Bacteria	1715	Open in IMG/M
3300026296\|Ga0209235_1103875	All Organisms → cellular organisms → Bacteria	1220	Open in IMG/M
3300026296\|Ga0209235_1115932	All Organisms → cellular organisms → Bacteria	1132	Open in IMG/M
3300026296\|Ga0209235_1150527	All Organisms → cellular organisms → Bacteria	926	Open in IMG/M
3300026296\|Ga0209235_1175205	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	799	Open in IMG/M
3300026297\|Ga0209237_1007396	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	6601	Open in IMG/M
3300026297\|Ga0209237_1013044	All Organisms → cellular organisms → Bacteria	4912	Open in IMG/M
3300026297\|Ga0209237_1030500	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	2949	Open in IMG/M
3300026297\|Ga0209237_1118339	All Organisms → cellular organisms → Bacteria	1120	Open in IMG/M
3300026298\|Ga0209236_1017346	All Organisms → cellular organisms → Bacteria	4097	Open in IMG/M
3300026301\|Ga0209238_1010135	All Organisms → cellular organisms → Bacteria	3703	Open in IMG/M
3300026301\|Ga0209238_1031155	All Organisms → cellular organisms → Bacteria	1982	Open in IMG/M
3300026301\|Ga0209238_1037200	All Organisms → cellular organisms → Bacteria	1787	Open in IMG/M
3300026301\|Ga0209238_1143014	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300026301\|Ga0209238_1179168	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300026301\|Ga0209238_1201388	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300026304\|Ga0209240_1041711	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1740	Open in IMG/M
3300026305\|Ga0209688_1088235	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	566	Open in IMG/M
3300026306\|Ga0209468_1002435	All Organisms → cellular organisms → Bacteria	7752	Open in IMG/M
3300026306\|Ga0209468_1004718	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5365	Open in IMG/M
3300026306\|Ga0209468_1026871	All Organisms → cellular organisms → Bacteria	2026	Open in IMG/M
3300026306\|Ga0209468_1191685	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	517	Open in IMG/M
3300026307\|Ga0209469_1000691	All Organisms → cellular organisms → Bacteria	20116	Open in IMG/M
3300026307\|Ga0209469_1132924	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300026309\|Ga0209055_1000405	All Organisms → cellular organisms → Bacteria	30407	Open in IMG/M
3300026309\|Ga0209055_1000777	All Organisms → cellular organisms → Bacteria	21863	Open in IMG/M
3300026309\|Ga0209055_1144849	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300026310\|Ga0209239_1064943	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1607	Open in IMG/M
3300026310\|Ga0209239_1116318	All Organisms → cellular organisms → Bacteria	1115	Open in IMG/M
3300026310\|Ga0209239_1215249	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300026312\|Ga0209153_1005965	All Organisms → cellular organisms → Bacteria	3806	Open in IMG/M
3300026313\|Ga0209761_1284701	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	588	Open in IMG/M
3300026314\|Ga0209268_1003685	All Organisms → cellular organisms → Bacteria	7014	Open in IMG/M
3300026314\|Ga0209268_1070799	All Organisms → cellular organisms → Bacteria	1047	Open in IMG/M
3300026314\|Ga0209268_1181351	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	520	Open in IMG/M
3300026317\|Ga0209154_1101712	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1224	Open in IMG/M
3300026318\|Ga0209471_1045441	All Organisms → cellular organisms → Bacteria	2064	Open in IMG/M
3300026318\|Ga0209471_1046837	All Organisms → cellular organisms → Bacteria	2025	Open in IMG/M
3300026318\|Ga0209471_1090715	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1335	Open in IMG/M
3300026318\|Ga0209471_1310674	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300026323\|Ga0209472_1001070	All Organisms → cellular organisms → Bacteria	15963	Open in IMG/M
3300026324\|Ga0209470_1152061	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1015	Open in IMG/M
3300026324\|Ga0209470_1298892	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300026325\|Ga0209152_10086319	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300026326\|Ga0209801_1025069	All Organisms → cellular organisms → Bacteria	2880	Open in IMG/M
3300026328\|Ga0209802_1000173	All Organisms → cellular organisms → Bacteria	48927	Open in IMG/M
3300026328\|Ga0209802_1016815	All Organisms → cellular organisms → Bacteria → Proteobacteria	4121	Open in IMG/M
3300026329\|Ga0209375_1007458	All Organisms → cellular organisms → Bacteria	7040	Open in IMG/M
3300026329\|Ga0209375_1014335	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	4776	Open in IMG/M
3300026332\|Ga0209803_1235850	All Organisms → cellular organisms → Bacteria	638	Open in IMG/M
3300026335\|Ga0209804_1116441	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1216	Open in IMG/M
3300026335\|Ga0209804_1256719	All Organisms → cellular organisms → Bacteria	641	Open in IMG/M
3300026358\|Ga0257166_1017770	All Organisms → cellular organisms → Bacteria	923	Open in IMG/M
3300026523\|Ga0209808_1004273	All Organisms → cellular organisms → Bacteria	7297	Open in IMG/M
3300026524\|Ga0209690_1000401	All Organisms → cellular organisms → Bacteria	22887	Open in IMG/M
3300026527\|Ga0209059_1109194	All Organisms → cellular organisms → Bacteria	1092	Open in IMG/M
3300026528\|Ga0209378_1021155	All Organisms → cellular organisms → Bacteria	3622	Open in IMG/M
3300026537\|Ga0209157_1092916	All Organisms → cellular organisms → Bacteria	1451	Open in IMG/M
3300026537\|Ga0209157_1093840	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1441	Open in IMG/M
3300026538\|Ga0209056_10000218	All Organisms → cellular organisms → Bacteria	63565	Open in IMG/M
3300026540\|Ga0209376_1022603	All Organisms → cellular organisms → Bacteria	4123	Open in IMG/M
3300026540\|Ga0209376_1133524	All Organisms → cellular organisms → Bacteria	1213	Open in IMG/M
3300026548\|Ga0209161_10249869	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300026551\|Ga0209648_10008469	All Organisms → cellular organisms → Bacteria	8878	Open in IMG/M
3300026551\|Ga0209648_10014029	All Organisms → cellular organisms → Bacteria	6996	Open in IMG/M
3300026551\|Ga0209648_10025340	All Organisms → cellular organisms → Bacteria	5183	Open in IMG/M
3300026551\|Ga0209648_10059553	All Organisms → cellular organisms → Bacteria	3242	Open in IMG/M
3300026551\|Ga0209648_10147048	All Organisms → cellular organisms → Bacteria	1866	Open in IMG/M
3300026551\|Ga0209648_10156132	All Organisms → cellular organisms → Bacteria	1795	Open in IMG/M
3300026551\|Ga0209648_10398358	All Organisms → cellular organisms → Bacteria	905	Open in IMG/M
3300026552\|Ga0209577_10728241	All Organisms → cellular organisms → Bacteria	558	Open in IMG/M
3300026557\|Ga0179587_10103683	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1725	Open in IMG/M
3300027324\|Ga0209845_1034269	All Organisms → cellular organisms → Bacteria	814	Open in IMG/M
3300027383\|Ga0209213_1043617	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	848	Open in IMG/M
3300027587\|Ga0209220_1000082	All Organisms → cellular organisms → Bacteria	46605	Open in IMG/M
3300027633\|Ga0208988_1103909	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300027643\|Ga0209076_1038487	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300027643\|Ga0209076_1151107	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300027671\|Ga0209588_1019426	All Organisms → cellular organisms → Bacteria	2120	Open in IMG/M
3300027725\|Ga0209178_1091553	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300027725\|Ga0209178_1092388	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300027725\|Ga0209178_1214155	All Organisms → cellular organisms → Bacteria	686	Open in IMG/M
3300027725\|Ga0209178_1236382	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300027748\|Ga0209689_1000370	All Organisms → cellular organisms → Bacteria	30334	Open in IMG/M
3300027787\|Ga0209074_10157812	All Organisms → cellular organisms → Bacteria	822	Open in IMG/M
3300027787\|Ga0209074_10157903	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300027846\|Ga0209180_10021261	All Organisms → cellular organisms → Bacteria	3442	Open in IMG/M
3300027862\|Ga0209701_10028334	All Organisms → cellular organisms → Bacteria	3645	Open in IMG/M
3300027862\|Ga0209701_10346331	All Organisms → cellular organisms → Bacteria	842	Open in IMG/M
3300027873\|Ga0209814_10001575	All Organisms → cellular organisms → Bacteria	8116	Open in IMG/M
3300027874\|Ga0209465_10368935	All Organisms → cellular organisms → Bacteria	719	Open in IMG/M
3300027875\|Ga0209283_10008361	All Organisms → cellular organisms → Bacteria	6046	Open in IMG/M
3300027882\|Ga0209590_10001306	All Organisms → cellular organisms → Bacteria	9343	Open in IMG/M
3300027882\|Ga0209590_10034628	All Organisms → cellular organisms → Bacteria	2702	Open in IMG/M
3300027903\|Ga0209488_11120324	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300027948\|Ga0209858_1014374	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300028536\|Ga0137415_10017910	All Organisms → cellular organisms → Bacteria	7023	Open in IMG/M
3300028536\|Ga0137415_10140515	All Organisms → cellular organisms → Bacteria	2254	Open in IMG/M
3300028792\|Ga0307504_10207664	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	697	Open in IMG/M
3300030006\|Ga0299907_10652773	All Organisms → cellular organisms → Bacteria	811	Open in IMG/M
3300031152\|Ga0307501_10033082	All Organisms → cellular organisms → Bacteria	1071	Open in IMG/M
3300031421\|Ga0308194_10037537	All Organisms → cellular organisms → Bacteria	1178	Open in IMG/M
3300031720\|Ga0307469_10000541	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	13898	Open in IMG/M
3300031720\|Ga0307469_10003656	All Organisms → cellular organisms → Bacteria	6519	Open in IMG/M
3300031720\|Ga0307469_10056521	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	2505	Open in IMG/M
3300031720\|Ga0307469_10080578	All Organisms → cellular organisms → Bacteria	2204	Open in IMG/M
3300031720\|Ga0307469_10300165	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1322	Open in IMG/M
3300031720\|Ga0307469_10771850	All Organisms → cellular organisms → Bacteria	879	Open in IMG/M
3300031720\|Ga0307469_11177120	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	723	Open in IMG/M
3300031720\|Ga0307469_11465227	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300031740\|Ga0307468_100425816	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1024	Open in IMG/M
3300031753\|Ga0307477_10394211	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300031820\|Ga0307473_10070300	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1752	Open in IMG/M
3300031949\|Ga0214473_10038705	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	5601	Open in IMG/M
3300031962\|Ga0307479_10212795	All Organisms → cellular organisms → Bacteria	1904	Open in IMG/M
3300031962\|Ga0307479_10403120	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300031962\|Ga0307479_10685939	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300032180\|Ga0307471_100709426	All Organisms → cellular organisms → Bacteria	1171	Open in IMG/M
3300032180\|Ga0307471_101648089	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300032180\|Ga0307471_102019251	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300032342\|Ga0315286_12091540	Not Available	524	Open in IMG/M
3300032770\|Ga0335085_10001132	All Organisms → cellular organisms → Bacteria	61456	Open in IMG/M
3300032770\|Ga0335085_10001812	All Organisms → cellular organisms → Bacteria	42881	Open in IMG/M
3300032770\|Ga0335085_10540473	All Organisms → cellular organisms → Bacteria	1322	Open in IMG/M
3300032805\|Ga0335078_10170308	All Organisms → cellular organisms → Bacteria	3059	Open in IMG/M
3300032805\|Ga0335078_10834499	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1118	Open in IMG/M
3300032829\|Ga0335070_10163663	All Organisms → cellular organisms → Bacteria	2249	Open in IMG/M
3300033004\|Ga0335084_10230826	All Organisms → cellular organisms → Bacteria	1920	Open in IMG/M
3300033407\|Ga0214472_10468125	All Organisms → cellular organisms → Bacteria	1174	Open in IMG/M
3300033407\|Ga0214472_10803921	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300033803\|Ga0314862_0039464	All Organisms → cellular organisms → Bacteria	993	Open in IMG/M
3300033808\|Ga0314867_128123	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.11%
Host-Associated	Host-Associated	3.89%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	93.00%
Plants	Host-Associated → Plants	3.89%
Aquatic	Environmental → Aquatic	3.11%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	93.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.50%
Sediment	Environmental → Aquatic → Sediment	2.14%
Freshwater	Environmental → Aquatic → Freshwater	0.97%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.39%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	85.02%
Loam	Environmental → Terrestrial → Soil → Loam	4.47%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.31%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.53%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.14%
Sand	Environmental → Terrestrial → Soil → Sand	0.97%
Lake	Environmental → Aquatic → Freshwater → Lake	0.58%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.39%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.19%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.19%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.19%

Habitat	Taxonomy	Distribution
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	41.63%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.24%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.47%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.09%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.31%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.53%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.14%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.17%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.97%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.58%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.39%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.19%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.19%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.19%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.19%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	24.51%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	24.51%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	17.12%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	6.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.09%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.31%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.56%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.36%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.97%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.97%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.97%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.58%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.58%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.39%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.39%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.39%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.39%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.19%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.19%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.19%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.19%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.19%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.19%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.19%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.19%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.19%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.19%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.19%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001086	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005446	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005889	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006796	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009804	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40	Environmental	Open in IMG/M
3300009813	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20	Environmental	Open in IMG/M
3300009814	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG	Environmental	Open in IMG/M
3300010326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011413	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012399	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300018027	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020200	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m	Environmental	Open in IMG/M
3300021046	Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300024182	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10	Environmental	Open in IMG/M
3300024246	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21	Environmental	Open in IMG/M
3300024330	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025159	Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3	Environmental	Open in IMG/M
3300025165	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026277	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026305	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)	Environmental	Open in IMG/M
3300026306	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)	Environmental	Open in IMG/M
3300026307	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)	Environmental	Open in IMG/M
3300026309	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)	Environmental	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300026312	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)	Environmental	Open in IMG/M
3300026313	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026314	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026324	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)	Environmental	Open in IMG/M
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300026524	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)	Environmental	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026537	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027324	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes)	Environmental	Open in IMG/M
3300027383	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)	Environmental	Open in IMG/M
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027633	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027643	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)	Environmental	Open in IMG/M
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027748	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027948	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032342	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033407	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175	Environmental	Open in IMG/M
3300033803	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10	Environmental	Open in IMG/M
3300033808	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12709J13192_10031931	3300001086	Forest Soil	MPETVPANAGYMVAAYTAAALILVGYAVLLYRRTRKL*
JGI12053J15887_101063083	3300001661	Forest Soil	MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP*
JGI25384J37096_100615981	3300002561	Grasslands Soil	VGGAPAMPDVPQNTGYMVAAYVVTAVILVAYAVSLYRRTNKP*
Ga0066690_102406603	3300005177	Soil	ISAVVPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR*
Ga0070708_1002538092	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVLQNGGYMVAAYIVTAVILVAYAIVLARRTRNKHY*
Ga0070708_1002939891	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MRTVGGAPAMSDVPQNAGYMVAAYVVTAVILVAYTVSLYRRSHKS*
Ga0070708_1015498471	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	PSMDNAVPQNTGYLIAAYILVPTILIGYALSLYRRSLRP*
Ga0066686_100988002	3300005446	Soil	MQLMPEGVPQNAGYLMAAYILVPTILIAYAVSLYRRTNKP*
Ga0066686_102396782	3300005446	Soil	VPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP*
Ga0070706_1012354402	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVLQNGGYMVAAYIVTAVILVAYAIVLARRARNKHY*
Ga0070699_1000239448	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVSQNGGYMVAAYIITAVILVVYTIVLARRTRNKHY*
Ga0070741_103227032	3300005529	Surface Soil	MNQLPQNGGYMVAAYVVAAVILVAFALSLYRRSK*
Ga0070697_1000414426	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	TRWGTRTMPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP*
Ga0066697_100011917	3300005540	Soil	VPEVPQNAGYLVAAYVVTAVILLCYTFSLYRRSSKG*
Ga0066697_100064222	3300005540	Soil	MGDQVPHNAGYLIAAYILVPTILIVYALSLYRRGQRP*
Ga0066697_100428774	3300005540	Soil	MPETFPHNAGYMVAAYTVAAVILVAYAVSLYRRTRNL*
Ga0066697_100598562	3300005540	Soil	MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRAKQP*
Ga0066697_101735832	3300005540	Soil	MADVPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL*
Ga0066697_102064932	3300005540	Soil	MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP*
Ga0066697_105638962	3300005540	Soil	MLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP*
Ga0066697_106880471	3300005540	Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD*
Ga0066697_107065661	3300005540	Soil	MPDVPHNGGYMVAAYIVTAVILLAYAVSLYRRTERR*
Ga0066701_101265492	3300005552	Soil	MADAPHNAGYMAAAYVATALILLAYAVSLYRRAARR*
Ga0066701_102022952	3300005552	Soil	MPETFPHNAGYMIAAYTVAAVILVAYALSLYRRTRGL*
Ga0066701_102580503	3300005552	Soil	VPDVPHNAGYMVAAYVTTALILLAYACSLYRRAAKR*
Ga0066701_102646482	3300005552	Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRATRP*
Ga0066701_104085282	3300005552	Soil	MPDVPQNAGYMVAAYIVTAVILLIYAISLHRRTAKP*
Ga0066701_105921182	3300005552	Soil	MSEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0066701_107777932	3300005552	Soil	MPEVPHNAGYMAAAYIVTAVILLGYAFSLYRRSTRR*
Ga0066701_109196931	3300005552	Soil	MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKL*
Ga0066695_100209225	3300005553	Soil	MSETFPQNAGYMVAAYTVAAVILVAYAVTLWRRTRGL*
Ga0066695_100333272	3300005553	Soil	MPDVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP*
Ga0066695_100334581	3300005553	Soil	NMADVPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL*
Ga0066695_101455493	3300005553	Soil	MPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL*
Ga0066695_102111951	3300005553	Soil	RSMPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKP*
Ga0066695_108319312	3300005553	Soil	MSEVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP*
Ga0066695_108527111	3300005553	Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKR*
Ga0066661_100271581	3300005554	Soil	GAPMPDVPHNGGYMVAAYIVTAVILLGYAISLYRRTGKP*
Ga0066661_101156673	3300005554	Soil	MADIPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL*
Ga0066661_102446832	3300005554	Soil	MPEIIPQNAGYMTAAYIVAAAILLTYAGALWRRTRGR*
Ga0066692_100269245	3300005555	Soil	VPEVPQNAGYLVAAYVVTAVILLGYTLSLYRRSSKG*
Ga0066692_101694883	3300005555	Soil	VPDAPHNAGYMVAAYVTTALILLAYAFSLYRRTAKR*
Ga0066692_102214603	3300005555	Soil	MPDVPHNGGYMVAAYIVTAVILLGYAISLYRRTGKP*
Ga0066707_100268856	3300005556	Soil	MPDVPQNGAYMVAAYIVTAVILLGYALSLYRRAKQP*
Ga0066704_106975272	3300005557	Soil	VPEGVPANGGYMVAAYIVTAVILVTYTLLLYKRTGRL*
Ga0066704_107279011	3300005557	Soil	RGTMLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP*
Ga0066698_100444123	3300005558	Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSRS*
Ga0066698_108748062	3300005558	Soil	MPDVPHNSGYMVAAYIVTAVILLGYALSLYRRTEKR*
Ga0066698_109780231	3300005558	Soil	SVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP*
Ga0066698_111055052	3300005558	Soil	MHLMPEGVPQNAGYLVAAYILVPTILIAYAVSLYRRTNKP*
Ga0066670_100098834	3300005560	Soil	MSEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRGTRP*
Ga0066670_103614652	3300005560	Soil	MPDVPHNSGYMVAAYIVTAAILVGYALSLYRRSEKR*
Ga0066699_101173263	3300005561	Soil	MSEVPQNAGYLVAAYIMVPVILLAYAVSLYRRSARP*
Ga0066699_102452712	3300005561	Soil	MSEVPRNAAYLVAAYIVVPVILLAYALSLYRRSTRP*
Ga0066699_106784092	3300005561	Soil	CGAKPRRMAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTRP*
Ga0066693_101048092	3300005566	Soil	MSEGLPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP*
Ga0066705_100029131	3300005569	Soil	RGARMPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD*
Ga0066705_100649993	3300005569	Soil	MSDAVPQNAGYMVAAYIVAAVILAAYAASLYRRTKGL*
Ga0066694_100100926	3300005574	Soil	MPDVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP*
Ga0066694_100664263	3300005574	Soil	MSEAVPQNAGYMVAAYIIAAVILVTYAISLFRRTRGL*
Ga0066694_101793223	3300005574	Soil	RSPGRGRARKPAMSEGFPHNAGYMVAAYTVAAVILVAYAVTLWRRTRGL*
Ga0066694_102468072	3300005574	Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAASLYRRSTRS*
Ga0066694_104279132	3300005574	Soil	MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSARP*
Ga0066702_102748432	3300005575	Soil	MAEGVPQNAAYLAAAYIVVPLILLAYAVSLYRRSTRP*
Ga0066708_101095732	3300005576	Soil	MPEVPQNGGYAVAAYIVTAVILVSYALSLHRRTRR*
Ga0066708_102933181	3300005576	Soil	GARRPAVSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0066708_109166972	3300005576	Soil	MPDVPQNAGYMVAAYIVTAVILLAYALSLYRRTAKP*
Ga0066691_101567432	3300005586	Soil	TMLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP*
Ga0066691_106645521	3300005586	Soil	GTMLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP*
Ga0066706_102213081	3300005598	Soil	MSDAVPQNAGYMVAAYIVAAVILVTYAVTLWRRTRGL*
Ga0066706_104537272	3300005598	Soil	MSEAVPQNAGYMVAAYIVAAVILVTYAVTLFRRTRGL*
Ga0074470_105184662	3300005836	Sediment (Intertidal)	MPVPDAVPRDAGYMIAAYIVAAVILLGYTIALARRARRRGR*
Ga0075290_10121933	3300005889	Rice Paddy Soil	CGRPGRAWGGTMPEVPQNAGYTAAAYIVTAVILLGYAVSLYRRTTKP*
Ga0066651_103779292	3300006031	Soil	MPDVPHNSGYMIAAYIVTAVILVGYAVSLYRRGEKR*
Ga0066656_100031984	3300006034	Soil	VPEVPQNAGYLVAAYVVTAVILLGYTFSLYRRSSKG*
Ga0066656_101379483	3300006034	Soil	MSDAPHNAGYMAAAYVATALILLAYAVSLYRRAARR*
Ga0066656_102972492	3300006034	Soil	MGSVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP*
Ga0066656_104664602	3300006034	Soil	MSEGFPQNAGYMVAAYAVAAVILVAYAVSLWRRTRGL*
Ga0066656_106855282	3300006034	Soil	MPDVPQNAGYMVAAYVVTALILLVYAASLSRRADKP*
Ga0066656_107715921	3300006034	Soil	PGRGRRPPMPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL*
Ga0066652_1000239794	3300006046	Soil	MPEGFPQNAGYLVAAYTVAAVILIAYAVSLFRRTRGL*
Ga0066652_1000275214	3300006046	Soil	MPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKP*
Ga0066652_1016980942	3300006046	Soil	MSEGVPQNAGYLVAAYIVVPVILRAYAASLYRRSTRS*
Ga0075417_100279803	3300006049	Populus Rhizosphere	MPDVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP*
Ga0070715_101726373	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSRRP*
Ga0070716_1000210905	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MSDVPQNAGYMVAAYVVTAVILVAYAISLYRRSYKS*
Ga0070712_1013401702	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSDVPQNAGYMVAAYVVTAVILVAYAISLYRRSHKS*
Ga0079222_100007367	3300006755	Agricultural Soil	MPDVPHNAGYMAAAYILTAVILLAYTISLYRRSDRR*
Ga0079222_100267305	3300006755	Agricultural Soil	MDNAVPQNTGYLIAAYILVPTILIGYALSLYRRSLRP*
Ga0079222_100318774	3300006755	Agricultural Soil	MGDTVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP*
Ga0079222_102281062	3300006755	Agricultural Soil	MPEGIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR*
Ga0079222_105618052	3300006755	Agricultural Soil	MDSGVPQNAGYLMAAYILVPTILIAYAVSLYRRSRRP*
Ga0079222_112261832	3300006755	Agricultural Soil	MPEVPQNAGYMVAAYIVTAAILLGYALLLYRRSIMAR*
Ga0066653_100135891	3300006791	Soil	MSEGFPHNAGYMVAAYTVAAVILVAYAVTLWRRTRGL*
Ga0066653_101645282	3300006791	Soil	MSEVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP*
Ga0066653_102427212	3300006791	Soil	MPEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0066653_103133142	3300006791	Soil	MPDVPHNSGYMIAAYIVTAVILLGYAVSLYRRGEKR*
Ga0066658_100249164	3300006794	Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSTRS*
Ga0066658_100253644	3300006794	Soil	VPDTPHNAGYMIAAYITTALILVAYAFSLYRRAAKR*
Ga0066658_105113812	3300006794	Soil	VSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0066665_115673672	3300006796	Soil	MSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTGKP*
Ga0066659_103202902	3300006797	Soil	MSEVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP*
Ga0066659_103617492	3300006797	Soil	MAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTRP*
Ga0066659_108540821	3300006797	Soil	VPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR*
Ga0066660_112840342	3300006800	Soil	MPDVPHNGGYMIAAYIVTAVILVGYALSLYRRGEKR*
Ga0079221_100400313	3300006804	Agricultural Soil	MPENIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR*
Ga0079221_100754072	3300006804	Agricultural Soil	MAEVPQNAGYMVAAYIVTAVIVLGYAVSLVRRSRNL*
Ga0079221_114563082	3300006804	Agricultural Soil	MADGVPQNAGYLAAAYVLVPTILIAYAVSLYRRSKR*
Ga0079220_100977512	3300006806	Agricultural Soil	MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKQL*
Ga0079220_101624372	3300006806	Agricultural Soil	MPEGIPQNAGYMVAAYIVTAVVLLAYTLSLYRRTRGR*
Ga0079220_104192572	3300006806	Agricultural Soil	VSEAVPQNAGYLVAAYLVVPLILLAYAASLYRRDGRP*
Ga0079220_109080031	3300006806	Agricultural Soil	RAGRRPSMDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSRRP*
Ga0079220_115927401	3300006806	Agricultural Soil	RPSMDNAVPQNTGYLIAAYILVPTILIGYALSLYRRSLRP*
Ga0075433_1000011321	3300006852	Populus Rhizosphere	MSDVPQNAGYMMAAYVVTAVILVAYAVSLYRRANKP*
Ga0075433_101483233	3300006852	Populus Rhizosphere	MNGPPQNAAFMVAAYIATAVILVAYAVILIRRTRGL*
Ga0075433_106202072	3300006852	Populus Rhizosphere	MADVPQNAGYMMAAYVVTAVILIAYAVSLYRRTRNL*
Ga0075425_1000624587	3300006854	Populus Rhizosphere	MSEAVPQNAGYLVAAYIVVPLILLAYAASLYRRDTRP*
Ga0075425_1001103346	3300006854	Populus Rhizosphere	MDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP*
Ga0075425_1006177982	3300006854	Populus Rhizosphere	MPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP*
Ga0075425_1009295883	3300006854	Populus Rhizosphere	MPENIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR*
Ga0075425_1021836462	3300006854	Populus Rhizosphere	MPETIPQNAGYMVAAYIVTAIIVLGYALSLYRRSRGR*
Ga0075434_1011968362	3300006871	Populus Rhizosphere	MPENIPQNAGYMVAAYIVTAIVILAYAASLYRRTRGR*
Ga0079217_101063432	3300006876	Agricultural Soil	VRENAGYMVAAYIVTGAVYLIYFLRLLRRSRGLRE*
Ga0075426_100578383	3300006903	Populus Rhizosphere	MSEALPQNAGYLVAAYIIVPLILLAYAASLYRRDTRP*
Ga0075436_1000300034	3300006914	Populus Rhizosphere	MPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTNKP*
Ga0075435_1000036691	3300007076	Populus Rhizosphere	ARRPAMPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP*
Ga0075435_1012671681	3300007076	Populus Rhizosphere	PMSEALPQNAGYLVAAYIIVPLILLAYAASLYRRDTRP*
Ga0099793_100253785	3300007258	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNKS*
Ga0099793_101404562	3300007258	Vadose Zone Soil	MPETFPHNAGYMIAAYTVAAVVLVVYAVSLYRRTKGL*
Ga0099793_105183072	3300007258	Vadose Zone Soil	MLEVPQNGGYMVAAYVVTAAILLGYALSLYRRTTKP*
Ga0099794_100146364	3300007265	Vadose Zone Soil	MTEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL*
Ga0066710_1007933602	3300009012	Grasslands Soil	MPEAIPQNAGYMVAAYIVTAIVILAYAASLYRRTRGR
Ga0066710_1011357282	3300009012	Grasslands Soil	MSDAVPQNAGYMVAAYIVAAVILVTYAVTLFRRTRGL
Ga0066710_1012232932	3300009012	Grasslands Soil	MPEVPPNAGYAVAAYIVTAAILVGYALSLHRRTRRR
Ga0066710_1015267401	3300009012	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERR
Ga0066710_1021348662	3300009012	Grasslands Soil	MPEGFPQNAGYMVAAYTVAAVILVAYAVSLFRRTRGL
Ga0066710_1038145182	3300009012	Grasslands Soil	MPDVPQNAGYMVAAYVVTALILLVYAASLSRRADKP
Ga0066710_1039971532	3300009012	Grasslands Soil	MPEVPQNGGYAVAAYIVTAAILLVYALTLHRRTRRR
Ga0099829_100270805	3300009038	Vadose Zone Soil	MSDVPQNAGYLVAAYVVTAVILLAYAVSLYRRANKS*
Ga0099829_100346004	3300009038	Vadose Zone Soil	VADVPQTGGYMVAAYVVTALILLAYALSLYRRTKRP*
Ga0099829_100379075	3300009038	Vadose Zone Soil	VQPMAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKL*
Ga0099829_100400832	3300009038	Vadose Zone Soil	MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSNL*
Ga0099829_113398272	3300009038	Vadose Zone Soil	MPEVPQNAAYMVAAYVVTAAILLGYAYALYRRSTKP*
Ga0105106_101166232	3300009078	Freshwater Sediment	MPELPQNGAYMVAAYIVTAVILMGYAVSLWMRSR*
Ga0099830_100310295	3300009088	Vadose Zone Soil	MPDVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0099830_101927204	3300009088	Vadose Zone Soil	MSESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR*
Ga0099828_110359402	3300009089	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNQS*
Ga0099827_1000093812	3300009090	Vadose Zone Soil	MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF*
Ga0099827_100029067	3300009090	Vadose Zone Soil	VPEVPQNAGYLVAAYIVTAVILLGYTFSLYRRSSKG*
Ga0099827_100210396	3300009090	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNKA*
Ga0099827_100678253	3300009090	Vadose Zone Soil	MSETFPHNAGYMIAAYTVAAVILVAYAVLLYRRTRGL*
Ga0099827_101544583	3300009090	Vadose Zone Soil	VSEVPHNGAYMVAAYIVTAGILLGYALALYRRTRKP*
Ga0099827_102747433	3300009090	Vadose Zone Soil	MPEGVANGGYMVAAYIAAAVILVAYALFLYSRSRKL*
Ga0099827_102933203	3300009090	Vadose Zone Soil	MPEVPHNAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0099827_113858392	3300009090	Vadose Zone Soil	MSEGFPHNAGYMVAAYTVAAVILVAYAVSLFRRTRGL*
Ga0066709_1003567013	3300009137	Grasslands Soil	MPDVPQNAGYMVAAYIGTAVLLLAYAVSLYRRTNKKP*
Ga0066709_1024912321	3300009137	Grasslands Soil	MPDVPQNGGYMVAAYIVTAVILLGYALSLYRRTNKL*
Ga0066709_1026484411	3300009137	Grasslands Soil	GKAMPEVPQNGGYAVAAYIVTAVILVSYALSLHRRTRR*
Ga0075423_109534071	3300009162	Populus Rhizosphere	MADVPQNAGYMMAAYVVTAVILIGYAVSLYRRTSKP
Ga0075423_114916792	3300009162	Populus Rhizosphere	MPEEVPLNGGYMVAAYIVTAVILLGYSIVLARRTRKY*
Ga0105063_10238802	3300009804	Groundwater Sand	VLEVPENAGYLVAAYIVTAVILLGYALSLYRRTNKP*
Ga0105057_10858812	3300009813	Groundwater Sand	MAEVPQNAEYMVAAYIVTAVILLGYALSLYRRTTKL*
Ga0105082_10452132	3300009814	Groundwater Sand	MAEVPQNTEYMVAAYIVTAVILLGYALSLYRRTTKL*
Ga0126382_101192512	3300010047	Tropical Forest Soil	MPEGVAENGGYMVAAYIVTAVILVAYTILLARRTGNKHN*
Ga0134082_100596202	3300010303	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILVGYAVSLYRRGEKR*
Ga0134088_100968442	3300010304	Grasslands Soil	MADIPQNAGYMVAAYIVTGVILLGYAVSLGRRSRNL*
Ga0134088_102236393	3300010304	Grasslands Soil	VPEVPQNAGYMVAAYVVTAVILVAYAVSLYRRISKP*
Ga0134088_102555702	3300010304	Grasslands Soil	MPEGVPQNAGYLMAAYILVPTILIAYAVSLYRRTNKP*
Ga0134067_100100082	3300010321	Grasslands Soil	MPDVPHNSGYMIAAYIVTAVILVGYALSLYRRGEKR*
Ga0134067_100343572	3300010321	Grasslands Soil	VSEVPENAGYMMAAYIVTAVILIAYAVSLFRRTSKP*
Ga0134067_102959762	3300010321	Grasslands Soil	MSEVPQNAGYLVAAYIMVPVILLAYAVSLYRLSARP*
Ga0134084_101756932	3300010322	Grasslands Soil	MPEGIPHNAGYRAAAYVLVPLILLAYAVSLYRRSARP*
Ga0134064_100829402	3300010325	Grasslands Soil	VSEVPENAGYMMAAYIVTPVILIAYAVSLYRRTSKP*
Ga0134065_104724192	3300010326	Grasslands Soil	VSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTGKP*
Ga0134080_106645852	3300010333	Grasslands Soil	DVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP*
Ga0134071_100007472	3300010336	Grasslands Soil	VPEVPQNAGYLVAAYVVTAVILLGYAFSLYRRSSKG*
Ga0134071_100366962	3300010336	Grasslands Soil	MSEGVPQNAGYMVAAYIVAAVILVAYAVTLFRRTRGL*
Ga0134071_102437462	3300010336	Grasslands Soil	MPDVPQNAGYLAAAYIVTAVILLGYTVSLYRRGRTP*
Ga0134062_101741862	3300010337	Grasslands Soil	RMPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKR*
Ga0134062_107820072	3300010337	Grasslands Soil	MSEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP*
Ga0126370_105944292	3300010358	Tropical Forest Soil	MPEGVAENGGYMVAAYIVTAVILVAYTMLLARRTRN*
Ga0134125_100466293	3300010371	Terrestrial Soil	MSDVPHNAGYMVAAYVVTAVILVAYAVSLYRRSNKS*
Ga0136847_123419424	3300010391	Freshwater Sediment	MGETPQNAGFMVAAYIVTAAILLGYAIALARRSRGR*
Ga0134126_116373872	3300010396	Terrestrial Soil	MSDVPQNAGYMVAAYVVTAVILVAYTVSLYRRSHKS*
Ga0134123_105053703	3300010403	Terrestrial Soil	MADVPHNAAYMVAAYVVTAVILVAYAISLYRRSHKS*
Ga0137392_101064031	3300011269	Vadose Zone Soil	SARVQPMAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSNKL*
Ga0137391_106934572	3300011270	Vadose Zone Soil	MAEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL*
Ga0137391_113640782	3300011270	Vadose Zone Soil	MFESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR*
Ga0137393_100080525	3300011271	Vadose Zone Soil	MSEGIPQNAGYMVAAYVVTAIVLLSYALSLYRRTRGR*
Ga0137333_10821752	3300011413	Soil	DRVPHNEGYMVAAYIVAAVIVVGYAVSLYRRSRNR*
Ga0137389_116865942	3300012096	Vadose Zone Soil	MPEAVAQNGGYMVAAYIVTAVILVAYTIVLARRTRNKHY*
Ga0137388_115176032	3300012189	Vadose Zone Soil	EGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF*
Ga0137364_101069723	3300012198	Vadose Zone Soil	MPDVPHNSSYMIAAYIVTAVILLGYAVSLYRRGEKR*
Ga0137383_100099835	3300012199	Vadose Zone Soil	MPEVLQNGGYAVAAYIVTAAILLGYALSLHRRTRRR*
Ga0137383_100101408	3300012199	Vadose Zone Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRGEKR*
Ga0137383_100677844	3300012199	Vadose Zone Soil	MLDVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP*
Ga0137383_101545093	3300012199	Vadose Zone Soil	MSEGFPQNAGYMVAAYAVAAVILVAYAVSLLRRTRGL*
Ga0137383_101549503	3300012199	Vadose Zone Soil	MPEVPQNAGYMMAAYVVTAVILIAYAVSLYRRTSKP*
Ga0137383_109912351	3300012199	Vadose Zone Soil	MPENIPQDAGYMVAAYVVTAIIVLAYAASLYRRTRGR*
Ga0137382_100366516	3300012200	Vadose Zone Soil	MPDVPQNAGYMVAAYIVTAVILLAYAVSLHRRAAKP*
Ga0137382_101077252	3300012200	Vadose Zone Soil	MPESIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR*
Ga0137382_103704162	3300012200	Vadose Zone Soil	MSDAVPQNAGYMVAAYIVAAVILVTYAVTLFRRTRGL*
Ga0137382_108188832	3300012200	Vadose Zone Soil	MSEVPQNAGYMMAAYIVTAVILLAYAVSLYRRTSKP*
Ga0137382_110171482	3300012200	Vadose Zone Soil	MSEVIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR*
Ga0137365_101625063	3300012201	Vadose Zone Soil	MPDVPQNAGYMMAAYAVTAVILITYAVSLYRRTSKP*
Ga0137365_109993022	3300012201	Vadose Zone Soil	MSEGFPQNAGYMVAAYTVAAVILVAYAVTLFRRTRGL*
Ga0137399_101902093	3300012203	Vadose Zone Soil	MPETFPHNAGYMIAAYTVAAVILVVYAVSLYRRTKGL*
Ga0137399_103713612	3300012203	Vadose Zone Soil	MSDVPQNAGYMAAAYVVTAVILLVYAVSLYRRTNKP*
Ga0137399_107123362	3300012203	Vadose Zone Soil	MLEVPQNGGYTVAAYVVTAAILLGYALSLYRRTTKP*
Ga0137374_100122197	3300012204	Vadose Zone Soil	MPEGFPQNAGYMVAAYTVAAVILVAYAVSLFRRTRGL*
Ga0137374_100252014	3300012204	Vadose Zone Soil	MPDVPQNAGYMVAAYIVTAVILLGYAVSLYRRTDKP*
Ga0137374_106126453	3300012204	Vadose Zone Soil	VPEVPQNAGYMVAAYVVTAVVLVAYAVSLYRRSMKL*
Ga0137374_107220822	3300012204	Vadose Zone Soil	VEDRVSEVPQNAGYMVAAYVVTAVILLGYAVSLYRRSMKL*
Ga0137374_109989262	3300012204	Vadose Zone Soil	MPQNAGYMVAAYVVTAVILLAYAVSLYRRTNKPRL*
Ga0137362_101424074	3300012205	Vadose Zone Soil	MPDVPQNAGYMVAAYIVTAVILLIYTISLHRRTAKP*
Ga0137380_1000001765	3300012206	Vadose Zone Soil	VPDVPQDAGYMVAAYIVTAVILVAYAVSLYRRTEKP*
Ga0137380_100176483	3300012206	Vadose Zone Soil	MSEGVPQNAGYLVAAYIVVPVILLTYALSLYRRATRP*
Ga0137380_101790492	3300012206	Vadose Zone Soil	VPEVPQNGGYMVAAYIVTAVILLAYAFSLYRRTGKE*
Ga0137380_104137062	3300012206	Vadose Zone Soil	MPDVPQNAGYMMAAYVVTAVILIAYAVSLYRRTSKP*
Ga0137380_112097922	3300012206	Vadose Zone Soil	MPETIPQNAGYMVAAYIVTALVILAYAASLYRRTRGR*
Ga0137380_115961412	3300012206	Vadose Zone Soil	MPEGVPQNAGYLVAAYILVPTILIAYAVSLYRRTNKP*
Ga0137380_117111722	3300012206	Vadose Zone Soil	MSEGFPQNAGYMVAAYAVAAVVLVAYAVSLFRRTRGL*
Ga0137381_114434441	3300012207	Vadose Zone Soil	VPEVPQNAGYMVAAYIVTAGILLAYAFSLYRRIGKE*
Ga0137376_100758602	3300012208	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRTNQS*
Ga0137379_109566432	3300012209	Vadose Zone Soil	MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTGP*
Ga0137378_100314941	3300012210	Vadose Zone Soil	DVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP*
Ga0137377_100575885	3300012211	Vadose Zone Soil	VPEVPQNAGYMVAAYIVTAGILLAYAFSLYRRIGKL*
Ga0137377_102695182	3300012211	Vadose Zone Soil	MAEGIPHNAGYLVAAYVVVPLILLAYAVSLYRRSTRP*
Ga0137377_110714262	3300012211	Vadose Zone Soil	MPESIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR*
Ga0137377_119279501	3300012211	Vadose Zone Soil	MPEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKL*
Ga0137370_100294932	3300012285	Vadose Zone Soil	MPDVPRNAGYMVAAYIVTAVILLAYALSLYRRTAKP*
Ga0137387_100538662	3300012349	Vadose Zone Soil	VPEVPQNAGYMVAAYIVTAVILLAYALSLYRRIGKL*
Ga0137372_100122107	3300012350	Vadose Zone Soil	MPDAVPQNAGFMVAAYITTAVILVAYAVTLYRRTLKP*
Ga0137372_100456694	3300012350	Vadose Zone Soil	LADVPQNAGYMVAAYVVTAVILLVYALSLYRRSNKP*
Ga0137372_100547842	3300012350	Vadose Zone Soil	MPEGFPQNAGYMVAAYTVAAMILVAYAVSLFRRTRGL*
Ga0137372_104425322	3300012350	Vadose Zone Soil	MPDVPQNAGYMVAAYIVTAVILLGYAVSLYRRADKP*
Ga0137386_100942402	3300012351	Vadose Zone Soil	VPEVPQNGGYMVAAYIVTAVILLAYAFSLYRRIGKE*
Ga0137386_104514151	3300012351	Vadose Zone Soil	MPETIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR*
Ga0137367_106201812	3300012353	Vadose Zone Soil	VPEVPQNAGYMVAAYVVTAVILVAYAVSLYRRSTKL*
Ga0137366_101210994	3300012354	Vadose Zone Soil	MPEVPQNAGYMMAAYAVTAVILIAYAVSLYRRTSKP*
Ga0137366_101692422	3300012354	Vadose Zone Soil	LAEVPQNAGYMVAAYVVTAVILLVYALSLYRRGTKP*
Ga0137366_109639832	3300012354	Vadose Zone Soil	MSETFPQNAGYMVAAYTVAAVILVAYAVTLFRRTRGL*
Ga0137369_100521152	3300012355	Vadose Zone Soil	VPEVPQNAGYMVAAYVATAVILVAYAVSLYRRSMKL*
Ga0137369_102018152	3300012355	Vadose Zone Soil	MSDVPHNAGYMVAAYVVTAVILVTYAVSLYRRTNKP*
Ga0137371_101815323	3300012356	Vadose Zone Soil	MPEGFPQNAGYLVAAYTVAAVILIAYAVVLYRRTRGL*
Ga0137368_107617852	3300012358	Vadose Zone Soil	MSDVPHNAGYMVVAYVVTAVILVTYAVSLYRRTNKP*
Ga0137385_103933372	3300012359	Vadose Zone Soil	MPEVPQNAGYMMAAYVVTAVILIAYAVSLYRRTSRP*
Ga0137385_109163552	3300012359	Vadose Zone Soil	VPEVPQNAGYMAAAYIVTAGILLAYAFSLYRRIGKL*
Ga0137361_100599064	3300012362	Vadose Zone Soil	VPDVPQNAGYMVAAYVVTAVILLAYAISLHRRTAKP*
Ga0137361_103433332	3300012362	Vadose Zone Soil	MSEVPQNASYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0134061_12059001	3300012399	Grasslands Soil	MPEVPQNAGYMMAAYIVTGVILIAYAVSLYRRTSKP*
Ga0137358_100302864	3300012582	Vadose Zone Soil	MAEGVPQNAAYLVAAYIAVPAILIAYAVSLYRRSKKL*
Ga0137398_100652022	3300012683	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRTNKS*
Ga0137398_101231714	3300012683	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVTYAVSLYRRTNQP*
Ga0137398_101685621	3300012683	Vadose Zone Soil	MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSKP*
Ga0137397_1000628712	3300012685	Vadose Zone Soil	MPENIPQNAGYMVAAYIVTAIIILAYAASLYRRTRGR*
Ga0137397_104817182	3300012685	Vadose Zone Soil	MSEVPQNASYMVAAYVITAVILVGYAVSLYRRTNKP*
Ga0137396_102832371	3300012918	Vadose Zone Soil	MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRRAKP*
Ga0137396_104078782	3300012918	Vadose Zone Soil	MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRAAKP*
Ga0137394_100835625	3300012922	Vadose Zone Soil	MSDVPHNAGYMVAAYVVTAMILVAYAVSLYRRSNKS*
Ga0137394_113328552	3300012922	Vadose Zone Soil	MSEAVPQNAGYMVAAYIVAAVILVTYAISLYRRTRGL*
Ga0137413_118180392	3300012924	Vadose Zone Soil	MPENIPQNAGYMVAAYIVTAVVLLTYALSLYRRTRGR*
Ga0137419_102382143	3300012925	Vadose Zone Soil	MAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL*
Ga0137419_108634672	3300012925	Vadose Zone Soil	MSDVPQNAGYMAAAYVVTAMILVAYAVSLYRRTTKP*
Ga0137419_109351822	3300012925	Vadose Zone Soil	RVGGAPAMSDLPHNAGYMVAAYVVTAVILVAYAVSLYRRSSKS*
Ga0137416_101202823	3300012927	Vadose Zone Soil	MPDVPQNAAYMAAAYVVTAVILVAYAVSLYRRTNKP*
Ga0137404_102655472	3300012929	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVVYAVSLYRRTNTP*
Ga0137404_108864781	3300012929	Vadose Zone Soil	MPEGVPQNVGYLVAAYIAVPAILIAYAVSLYRRSKKL*
Ga0137404_117257681	3300012929	Vadose Zone Soil	MPDVPQNAGYMVAAYIVTAVVLLTYALSLYRRTRGR*
Ga0153915_100522473	3300012931	Freshwater Wetlands	MPEVPQNAGYTAAAYIVTAVILLGYAVSLYRRTTKP*
Ga0137410_106546272	3300012944	Vadose Zone Soil	MSDVPQNAGYMAAAYVVTAVILFVYAVSLYRRTNKP*
Ga0134110_100035306	3300012975	Grasslands Soil	MSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP*
Ga0134076_100112413	3300012976	Grasslands Soil	MPEVPQNAGYMVAAYVVTAIILLAYAVSLYRRTGRP*
Ga0134076_101891752	3300012976	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLAYAVFLYRRTTHP*
Ga0134081_101452812	3300014150	Grasslands Soil	MPDVPHNSGYMIAAYIVTAVILLGYALSLYRRTER*
Ga0134081_102014161	3300014150	Grasslands Soil	MSQVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP*
Ga0134075_104159541	3300014154	Grasslands Soil	PEVLQNGGYAVAAYIVTAAILLVYALTLHRRTRRR*
Ga0134078_101480322	3300014157	Grasslands Soil	MSEVPQNAGYMTAAYIVTAVILIAYAVSLYRRTSKA*
Ga0134078_103490222	3300014157	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTNRP*
Ga0134078_105867232	3300014157	Grasslands Soil	MPDVPRNAGYMVAAYVVTAVILVTYAVSLYRRSNQP*
Ga0137412_104737523	3300015242	Vadose Zone Soil	AWVQPMAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL*
Ga0134073_100146473	3300015356	Grasslands Soil	PDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD*
Ga0134089_100029021	3300015358	Grasslands Soil	MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRTNKL*
Ga0134089_102510392	3300015358	Grasslands Soil	MSDAVPQNAGYMVAAYIVAAVILVGYAVTLFRRTRGL*
Ga0134085_102382471	3300015359	Grasslands Soil	ARRSPMPETFPHNAGYMVAAYTVAAVILVAYAVSLYRRTRNL*
Ga0132258_107360823	3300015371	Arabidopsis Rhizosphere	LPEVPQNAGYMIAAYVVTAVILLAYVFLLGRRGRNL*
Ga0132258_111684141	3300015371	Arabidopsis Rhizosphere	MPETVAQNGGYMVAAYIVTAVILVAYTIVLARRTGKKL*
Ga0132256_1005787613	3300015372	Arabidopsis Rhizosphere	MPETVAQNGGYMVAAYIVTAVILVAYTIVLARRTGK
Ga0134112_100020143	3300017656	Grasslands Soil	MPEVPQNAGYMVAAYVVTAIILLAYAVSLYRRTGRP
Ga0134074_10813812	3300017657	Grasslands Soil	VPEGIPQNAGFMVAAYVTAAAILLGYALSLYRRTLKP
Ga0134083_100209973	3300017659	Grasslands Soil	MGSVPAVPDVPKNAGYMVAAYVVTAVILLAYSISLYRRTGKP
Ga0134083_104368412	3300017659	Grasslands Soil	VPEVPQNAGYMVAAYVVTAVILVAYAVSLYRRISKP
Ga0187779_105872911	3300017959	Tropical Peatland	MAEGVPSNAGYMVAAYIAAAVILVGYALTLYRRSRHR
Ga0187776_104676962	3300017966	Tropical Peatland	MPETIPQNGGYMVAAYIVAAVILVGYALSLYRRSR
Ga0184605_1000005814	3300018027	Groundwater Sediment	VPDVPQNAGYMVAAYIVTAVILLVYAVSLSRRANRP
Ga0184634_100007569	3300018031	Groundwater Sediment	MPEAGPANAGYMVAAYIAAAVILVSYAVLLYRRTRKL
Ga0184634_101977312	3300018031	Groundwater Sediment	MPETVPANAGYMVAAYVVTAVILLSYAIALYRRTRKL
Ga0184634_102303502	3300018031	Groundwater Sediment	MPETIPANGGYMVAAYVTVAVILVGYAVSLYRRTRKL
Ga0187765_107273111	3300018060	Tropical Peatland	MAEGVPNNAGYMVAAYITAAVILVGYALSLYRRSRHR
Ga0184637_100072652	3300018063	Groundwater Sediment	MPEAVPANAGYMVAAYIAAAVILVSYAVLLYRRTRKL
Ga0184618_100979983	3300018071	Groundwater Sediment	MSDVPHNAGYMVAAYVVTAVILVAYAVSLYRRSNRS
Ga0184618_101656142	3300018071	Groundwater Sediment	VPDVPQNGGYMVAAYIVTAVILLVYAVSLYRRANRP
Ga0184640_100747043	3300018074	Groundwater Sediment	ASSWRRQGRWAMPETIPANGGYMVAAYVTVAVILVGYAVSLYRRTRKL
Ga0184640_102437622	3300018074	Groundwater Sediment	MPETVPANAGYMVAAYVVTAAILLSYAIALYRRTRKL
Ga0066655_100005718	3300018431	Grasslands Soil	MLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP
Ga0066655_100427734	3300018431	Grasslands Soil	MPETFPHNAGYMVAAYTVAAVILVAYAVSLYLRSGNL
Ga0066655_100682583	3300018431	Grasslands Soil	VPEVPQNAGYLVAAYVVTAVILLCYTFSLYRRSSKG
Ga0066655_100712822	3300018431	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD
Ga0066655_100851221	3300018431	Grasslands Soil	RRHMSEVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP
Ga0066655_102956333	3300018431	Grasslands Soil	ATRSPGRGRRPPMPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL
Ga0066655_103664543	3300018431	Grasslands Soil	MPDVPQNAGYMVAAYIVTAVILLIYAISLHRRTAKP
Ga0066655_104718032	3300018431	Grasslands Soil	VPDVPHNAGYMVAAYVTTALILLAYACSLYRRAAKR
Ga0066655_113170791	3300018431	Grasslands Soil	RGARMPDVPHNSGYMIAAYIVTAVILVGYAVSLYRRGEKR
Ga0066667_1000088715	3300018433	Grasslands Soil	MPETFPHNAGYMVAAYTVAAVILVAYAVSLYRRTRNL
Ga0066667_100276633	3300018433	Grasslands Soil	MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSARP
Ga0066667_100833633	3300018433	Grasslands Soil	MADAPHNAGYMAAAYVATALILLAYAVSLYRRAARR
Ga0066667_102702322	3300018433	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTER
Ga0066667_103561632	3300018433	Grasslands Soil	MSEVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP
Ga0066667_105358022	3300018433	Grasslands Soil	MPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL
Ga0066667_107603972	3300018433	Grasslands Soil	MPDVPHNSGYMVAAYIVTAAILVGYALSLYRRSEKR
Ga0066667_110302072	3300018433	Grasslands Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSTRP
Ga0066667_111377882	3300018433	Grasslands Soil	MPDVPHNSGYMIAAYIVTAVILVGYAVSLYRRGEKR
Ga0066667_111844472	3300018433	Grasslands Soil	MPDVPQNAGYMVAAYVVTAVILLVYAASLSRRSDKP
Ga0066662_100064197	3300018468	Grasslands Soil	MGDQVPHNAGYLIAAYILVPTILIVYALSLYRRGQRP
Ga0066662_101272004	3300018468	Grasslands Soil	MAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTRP
Ga0066662_101720113	3300018468	Grasslands Soil	MSDAPHNAGYMAAAYVATALILLAYAVSLYRRAARR
Ga0066662_102355802	3300018468	Grasslands Soil	VPEVPQNAGYLVAAYVVTAVILLGYTLSLYRRSSKG
Ga0066662_102964143	3300018468	Grasslands Soil	VSEVPHNGAYMVAAYIVTAGILLGYALALYRRTRKP
Ga0066662_105513332	3300018468	Grasslands Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRATRP
Ga0066662_112866422	3300018468	Grasslands Soil	MSEVPQNSGYMMAAYIVTAVILIAYAVSLYRRTSKP
Ga0066669_100018302	3300018482	Grasslands Soil	MADIPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL
Ga0066669_100022033	3300018482	Grasslands Soil	VPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP
Ga0066669_100996212	3300018482	Grasslands Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSTRS
Ga0066669_101366462	3300018482	Grasslands Soil	MPETFPHNAGYMVAAYTVAAVILVAYAVSRYRRTRNL
Ga0066669_101614282	3300018482	Grasslands Soil	MSEAVPQNAGYMVAAYIIAAVILVTYAISLFRRTRGL
Ga0066669_102578183	3300018482	Grasslands Soil	MPDVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP
Ga0066669_118721752	3300018482	Grasslands Soil	MSEVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP
Ga0137408_11880232	3300019789	Vadose Zone Soil	MSEVPQNASYMMAAYIVTAVILIAYAVSLYRRTSKP
Ga0193755_100022815	3300020004	Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNQS
Ga0179594_100039804	3300020170	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNKS
Ga0179594_100178373	3300020170	Vadose Zone Soil	MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKL
Ga0179592_100258654	3300020199	Vadose Zone Soil	MAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL
Ga0194121_101319453	3300020200	Freshwater Lake	MNQEQATTGGYMVAAYLITAVILLGYFASLYRRGRR
Ga0215015_100393247	3300021046	Soil	VPEVPQNAGYLAAAYVVTAVILLGYAVSLFRRLRRP
Ga0215015_101959472	3300021046	Soil	MADVPQTGGYMVAAYVVTAVILLAYTLSLYLRTRRP
Ga0215015_107035777	3300021046	Soil	VADVPQTGGYMVAAYVVTALILLAYALSLYRRTKRP
Ga0179596_100084033	3300021086	Vadose Zone Soil	MAEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL
Ga0179596_102053312	3300021086	Vadose Zone Soil	MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSNL
Ga0179596_102861462	3300021086	Vadose Zone Soil	MSDVIPQNASYMVAAYIVTAIIVLAYAASLYRRTRGR
Ga0210408_104049161	3300021178	Soil	MAEGVPQNAGYLIAAYIAVPAILIAYAVSLYRRSKKL
Ga0210409_102077722	3300021559	Soil	MPEHIPQNAGYMVAAYIVTAIVLLTYAASLYRRTRGR
Ga0247669_10005427	3300024182	Soil	MDSGVPQNAGYLIAAYILVPTILIAYAASLYRRSRRP
Ga0247680_10016137	3300024246	Soil	MPENIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR
Ga0137417_11822353	3300024330	Vadose Zone Soil	MRDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP
Ga0137417_13534561	3300024330	Vadose Zone Soil	MSDLPHNAGYMVAAYVVTAVILVAYAVSLYRRSNKS
Ga0209619_102943562	3300025159	Soil	MAEVPQNAGYMVAAYIATAVILVGYALSLYRRTTKL
Ga0209108_101813262	3300025165	Soil	MVDGVPQNAGFMVAAYVVTAVILLAYAVSLYRRSRDS
Ga0207653_100274432	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	MPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP
Ga0207692_101524393	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	MDSEVPQNAGYLIAAYILVPTILIAYAVSLYRRSRRP
Ga0207699_100200327	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSQRP
Ga0207684_100902534	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MPEVPQNGGYAVAAYIVTAAILLGYALSLHRRRRR
Ga0207684_104027412	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKQL
Ga0207646_112679042	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MPETVLQNGGYMVAAYIVTAVILVAYAIVLARRTRNKHY
Ga0207646_114770282	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MPESIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR
Ga0207665_100129406	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MSDVPQNAGYMVAAYVVTAVILVAYAISLYRRSYKS
Ga0209350_10045352	3300026277	Grasslands Soil	MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP
Ga0209350_10169352	3300026277	Grasslands Soil	MPEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP
Ga0209350_10248542	3300026277	Grasslands Soil	VSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP
Ga0209350_11556132	3300026277	Grasslands Soil	MSEVPQNAGYLVAAYIMVPVILLAYAVSLYRRSARP
Ga0209350_11615261	3300026277	Grasslands Soil	RGSTPTMPDVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP
Ga0209234_10018455	3300026295	Grasslands Soil	MSEGVPQNAAYLAAAYIVVPLILLAYAVSLYRRSTRP
Ga0209234_10185282	3300026295	Grasslands Soil	MSEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRSTRP
Ga0209234_10307153	3300026295	Grasslands Soil	MSEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP
Ga0209234_13073061	3300026295	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLAYAVSLYRRTERR
Ga0209234_13087212	3300026295	Grasslands Soil	MPEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRSTRP
Ga0209235_100042216	3300026296	Grasslands Soil	MPDVPQNGGYMVAAYIVTAVILLGYALSLYRRTNKL
Ga0209235_100044311	3300026296	Grasslands Soil	VPDVPHNAGYMVAAYVTTALILLAYACSLYRRAAQR
Ga0209235_10045078	3300026296	Grasslands Soil	VPEVPQNAGYLVAAYIVTAVILLGYTLSLYRRSSKG
Ga0209235_10046102	3300026296	Grasslands Soil	MPDVPQNTGYMVAAYVVTAVILVAYAVSLYRRTNKP
Ga0209235_10383883	3300026296	Grasslands Soil	MPDVPQNAGYMVAAYIVTAVILLVYAISLHRRTAKP
Ga0209235_10473343	3300026296	Grasslands Soil	VPDAPHNAGYMVAAYITTALILVAYAFSLYRRAAKR
Ga0209235_10634644	3300026296	Grasslands Soil	MTEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF
Ga0209235_11038752	3300026296	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKRD
Ga0209235_11159322	3300026296	Grasslands Soil	VPDAPHNAGYMVAAYVTTALILLAYAFSLYRRTAKR
Ga0209235_11505272	3300026296	Grasslands Soil	VPDAPHNAGYMVAAYVTTALILLAYACSLYRRAAKR
Ga0209235_11752052	3300026296	Grasslands Soil	MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF
Ga0209237_10073963	3300026297	Grasslands Soil	VPEVPQNAGYLVAAYVVTAVILLGYTFSLYRRSSKG
Ga0209237_10130445	3300026297	Grasslands Soil	MPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKL
Ga0209237_10305005	3300026297	Grasslands Soil	MSEGVPQNAGYLVAAYIVVPVILLTYAVSLYRRATRP
Ga0209237_11183392	3300026297	Grasslands Soil	MSEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP
Ga0209236_10173467	3300026298	Grasslands Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKR
Ga0209238_10101355	3300026301	Grasslands Soil	MGSTPIMPDVPRNAAYMVAAYIVTAVILLAYALSLYRRTAKP
Ga0209238_10311551	3300026301	Grasslands Soil	MPDVPHNSGYMVAAYIVTAAILVGYAVSLYRRSNRP
Ga0209238_10372002	3300026301	Grasslands Soil	MSEGLPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP
Ga0209238_11430142	3300026301	Grasslands Soil	MPDVPHNGGYMIAAYIVTAVILLGYALSLYRRTARR
Ga0209238_11791682	3300026301	Grasslands Soil	MSEGFPQNAGYMVAAYAVAAVILVAYAVSLWRRTRG
Ga0209238_12013882	3300026301	Grasslands Soil	VPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR
Ga0209240_10417114	3300026304	Grasslands Soil	VRLMAEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL
Ga0209688_10882352	3300026305	Soil	MSEGVPQNAGYLVAAYIVVPVMLLAYAVSLYRRSTRS
Ga0209468_10024355	3300026306	Soil	MSEGFPHNAGYMVAAYTVAAVILVAYAVTLWRRTRGL
Ga0209468_10047184	3300026306	Soil	MPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKP
Ga0209468_10268714	3300026306	Soil	MSEVPQNAGYMMAAYIVTAVILLAYAVSLYRRTSK
Ga0209468_11916852	3300026306	Soil	SRAGARRPAMSEVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP
Ga0209469_100069114	3300026307	Soil	MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRAKQP
Ga0209469_11329242	3300026307	Soil	MSEVPQNAGYMTAAYIVTAVILIAYAVSLYRRTSKP
Ga0209055_100040526	3300026309	Soil	MPDVPHNGGYMVAAYIVTAVILLAYAVSLYRRTERRD
Ga0209055_100077728	3300026309	Soil	MPDVPHNGGYMVAAYIVTAVILLGYAISLYRRTGKP
Ga0209055_11448492	3300026309	Soil	MPEIIPQNAGYMTAAYIVAAAILLGYAGALWRRTRGR
Ga0209239_10649432	3300026310	Grasslands Soil	MSEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRGTRP
Ga0209239_11163182	3300026310	Grasslands Soil	MADVPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL
Ga0209239_12152492	3300026310	Grasslands Soil	MAEGVPQNAAYLAAAYIVVPLILLAYAVSLYRRSTRP
Ga0209153_10059655	3300026312	Soil	MSEVPRNAAYLVAAYIVVPVILLAYALSLYRRSTRP
Ga0209761_12847012	3300026313	Grasslands Soil	SRGSTPTMPDVPQNAGYMVAAYIVTAVILLIYAISLHRRTAKP
Ga0209268_10036859	3300026314	Soil	MPDVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP
Ga0209268_10707992	3300026314	Soil	MRSRGRAKELNMSEAVPQNAGYMVAAYIIAAVILVTYAISLFRRTRGL
Ga0209268_11813512	3300026314	Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTNRP
Ga0209154_11017123	3300026317	Soil	VADAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR
Ga0209471_10454413	3300026318	Soil	MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP
Ga0209471_10468374	3300026318	Soil	ADAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR
Ga0209471_10907151	3300026318	Soil	RLPMSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSRS
Ga0209471_13106741	3300026318	Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRG
Ga0209472_100107011	3300026323	Soil	MSEVPQNAGYMMAAYIVTAVILLAYAVSLYRRTSKP
Ga0209470_11520612	3300026324	Soil	MSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTGKP
Ga0209470_12988921	3300026324	Soil	MLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTK
Ga0209152_100863193	3300026325	Soil	VPDTPHNAGYMIAAYITTALILVAYAFSLYRRAAKR
Ga0209801_10250691	3300026326	Soil	GSVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP
Ga0209802_100017339	3300026328	Soil	MPEVPHNAGYMAAAYIVTAVILLGYAFSLYRRSTRR
Ga0209802_10168152	3300026328	Soil	VPDVPQNAGYMVAAYVVTAVILLAYAISLHRRTAKP
Ga0209375_10074582	3300026329	Soil	MSETFPQNAGYMVAAYTVAAVILVAYAVTLWRRTRGL
Ga0209375_10143351	3300026329	Soil	MSEGFPHNAGYMVAAYTVAAVILVAYAVTLFRRTRGL
Ga0209803_12358502	3300026332	Soil	MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTQR
Ga0209804_11164411	3300026335	Soil	ISAVVPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR
Ga0209804_12567191	3300026335	Soil	MPETFPHNAGYMIAAYTVAAVILVAYALSLYRRTRG
Ga0257166_10177702	3300026358	Soil	MPEVVAQNGGYMVAAYIVTAVILVAYTIVLARRTRNKHY
Ga0209808_10042738	3300026523	Soil	MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRANKP
Ga0209690_10004016	3300026524	Soil	MPDVPHNGGYMVAAYIVVTAVILLGYALSLYRRTERR
Ga0209059_11091942	3300026527	Soil	MPDVPHNGGYMIAAYMVTAVILVGYALSLYRRGEKR
Ga0209378_10211556	3300026528	Soil	MPDVPQNGAYMVAAYIVTAVILLGYALSLYRRAKQP
Ga0209157_10929163	3300026537	Soil	MQLMPEGVPQNAGYLMAAYILVPTILIAYAVSLYRRTNKP
Ga0209157_10938403	3300026537	Soil	MPEVPQNGGYAVAAYIVTAVILVSYALSLHRRTRR
Ga0209056_1000021810	3300026538	Soil	MSDGVPQNAGYLVAAYIVVPVILLAYAVSLYRRATRP
Ga0209376_10226034	3300026540	Soil	MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSRS
Ga0209376_11335243	3300026540	Soil	MGSVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP
Ga0209161_102498692	3300026548	Soil	MSDAVPQNAGYMVAAYIVAAVILVTYAVTLWRRTRGL
Ga0209648_100084699	3300026551	Grasslands Soil	VPEVPQNAGYLAAAYMVTAAILLGYAWSLYRRARQP
Ga0209648_100140294	3300026551	Grasslands Soil	MADVPLTGGYMVAAYVVTAVILLAYTLSLYLRTRRP
Ga0209648_100253404	3300026551	Grasslands Soil	VADVPQTGGYMVAAYVVTALILLAYAVSLYRRAKRP
Ga0209648_100595532	3300026551	Grasslands Soil	MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSKP
Ga0209648_101470483	3300026551	Grasslands Soil	VAEVPQNAGYLAAAYVVTAVVLVAYAVSLYRRLRRP
Ga0209648_101561322	3300026551	Grasslands Soil	MPESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR
Ga0209648_103983582	3300026551	Grasslands Soil	MAEGVPQNAGYLLAAYTAVPAILIAYAVSLYRRSKKL
Ga0209577_107282412	3300026552	Soil	MAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTR
Ga0179587_101036833	3300026557	Vadose Zone Soil	VQPMAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL
Ga0209845_10342692	3300027324	Groundwater Sand	MAEVPQNTEYMVAAYIATAVILLGYALSLYRRTTKL
Ga0209213_10436172	3300027383	Forest Soil	TMPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP
Ga0209220_100008232	3300027587	Forest Soil	MPETVPANAGYMVAAYTAAALILVGYAVLLYRRTRKL
Ga0208988_11039092	3300027633	Forest Soil	MSDVPQNAGYMVAAYIVTAVILLAYAVSLYRRTEKP
Ga0209076_10384873	3300027643	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSSKS
Ga0209076_11511072	3300027643	Vadose Zone Soil	MPETFPHNAGYMIAAYTVAAVVLVVYAVSLYRRTKGL
Ga0209588_10194263	3300027671	Vadose Zone Soil	MTEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL
Ga0209178_10915532	3300027725	Agricultural Soil	MAEVPQNAGYMVAAYIVTAVIVLGYAVSLVRRSRNL
Ga0209178_10923882	3300027725	Agricultural Soil	MPDVPHNAGYMAAAYILTAVILLAYTISLYRRSDRR
Ga0209178_12141552	3300027725	Agricultural Soil	MGDTVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP
Ga0209178_12363822	3300027725	Agricultural Soil	MGDTVPQNAGYLMAAYILVPTILIAYAVSLYRRSRNP
Ga0209689_100037018	3300027748	Soil	MPETFPHNAGYMIAAYTVAAVILVAYALSLYRRTRGL
Ga0209074_101578121	3300027787	Agricultural Soil	MPEGIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR
Ga0209074_101579032	3300027787	Agricultural Soil	MDSGVPQNAGYLMAAYILVPTILIAYAVSLYRRSRRP
Ga0209180_100212615	3300027846	Vadose Zone Soil	MSDVPQNAGYMVAAYVVTAVILLAYAVSLYRRANKS
Ga0209701_100283346	3300027862	Vadose Zone Soil	VPDAPHNAGYMVAAYVTTALILLAYACSLYRRAAKH
Ga0209701_103463312	3300027862	Vadose Zone Soil	MPDVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP
Ga0209814_100015753	3300027873	Populus Rhizosphere	MPDVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP
Ga0209465_103689351	3300027874	Tropical Forest Soil	LNETVPQTGSYMVAAYIVTAVILVAYAILLARRTGNRHN
Ga0209283_100083617	3300027875	Vadose Zone Soil	VADVPQTGGYMVAAYVVTALILLAYAVSLYRRTKRP
Ga0209590_100013067	3300027882	Vadose Zone Soil	VPEVPQNAGYLVAAYIVTAVILLGYTFSLYRRSSKG
Ga0209590_100346284	3300027882	Vadose Zone Soil	MSETFPHNAGYMIAAYTVAAVILVAYAVLLYRRTRGL
Ga0209488_111203241	3300027903	Vadose Zone Soil	MSESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR
Ga0209858_10143741	3300027948	Groundwater Sand	MAEVPQNAEYMVAAYIATAVILLGYALSLYRRTTKL
Ga0137415_100179103	3300028536	Vadose Zone Soil	MPETFPHNAGYMIAAYTVAAVILVVYAVSLYRRTKGL
Ga0137415_101405152	3300028536	Vadose Zone Soil	VGSAPAMSDVPQNAGYMAAAYVVTAVILVAYAVSLYRRTNKP
Ga0307504_102076642	3300028792	Soil	MPDLPQNAGYMVAAYVLTAVILIAYAVSLYRRSKQH
Ga0299907_106527732	3300030006	Soil	MPEGVPQNAGYMIAAYIVASTLLVAYAVSLYIRIRNLR
Ga0307501_100330822	3300031152	Soil	MPDVPQNSGYMVAAYIVTAVILLAYAVSLYRRTEKP
Ga0308194_100375372	3300031421	Soil	VPDVPQNAGYMVAAYIVTAVILLVYAVSLYRRANRP
Ga0307469_1000054118	3300031720	Hardwood Forest Soil	MGDQVPQNAGYLMAAYILVPTILIAYAVSLYRRSKGP
Ga0307469_100036564	3300031720	Hardwood Forest Soil	MSDVPHNAGYMVAAYVVTAVILVTYAVSLYRRTNKP
Ga0307469_100565214	3300031720	Hardwood Forest Soil	MGDSVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP
Ga0307469_100805781	3300031720	Hardwood Forest Soil	LRMSPEVVPQNAGYMVAAYIVAAVILVAYAVTLWRRTRGL
Ga0307469_103001651	3300031720	Hardwood Forest Soil	MDSGVPQNAGYLIAAYILVPTILITYAVSLYRRSRRP
Ga0307469_105065062	3300031720	Hardwood Forest Soil	MAEGPANGGYMVAAYVAAAVILVAYALILYNRTRNL
Ga0307469_107718503	3300031720	Hardwood Forest Soil	MSPDAVPQNAGYMVAAYIVAAVILVAYAVTLWRRTRG
Ga0307469_111771202	3300031720	Hardwood Forest Soil	MSDVPQNAGYMMAAYIVTAIILIAYVVSLYRRTRNL
Ga0307469_114652272	3300031720	Hardwood Forest Soil	MAEGVPQNTGYLVAAYIAVPAILIAYAVSLYRRSKQL
Ga0307468_1004258162	3300031740	Hardwood Forest Soil	MGDSVPQNAGYLMAAYILVPTILIAYAVSLYRRSRNP
Ga0307477_103942113	3300031753	Hardwood Forest Soil	MPDVPQNAGYMMAAYIVTAIILIAYVVSLYRRTRNL
Ga0307473_100703002	3300031820	Hardwood Forest Soil	MAEGVPQNAGYLVAAYIAVPAILLAYAVSLYRRSKQL
Ga0214473_100387057	3300031949	Soil	VTPEIVPATGSYMVAAYIVAAVILVVYAIVLSRRSRRD
Ga0307479_102127952	3300031962	Hardwood Forest Soil	MAEVPQNAGYMAAAYVVTATILLGYALSLYRRARRP
Ga0307479_104031202	3300031962	Hardwood Forest Soil	MAEGVPQNAGYLVAAYSLVPVILLAYAVSLYRRSTRP
Ga0307479_106859392	3300031962	Hardwood Forest Soil	MGDVPQTGGYMVAAYIVTAGILLGYAISLYRRTQRL
Ga0307471_1007094263	3300032180	Hardwood Forest Soil	MSPDAVPQNAGYMVAAYIVAAVILVAYAVTLWRRTRGL
Ga0307471_1016480892	3300032180	Hardwood Forest Soil	MDNAVPQNTSYLIAAYILVPTILIGYALSLYRRSLRP
Ga0307471_1020192512	3300032180	Hardwood Forest Soil	MSDVPHNAGYMVAAYVVTAVILVAYAVSLYRRSNKS
Ga0315286_120915401	3300032342	Sediment	SDAVPQTGSYMVAAYIAAAAILLGYAIVLARRARRS
Ga0335085_1000113226	3300032770	Soil	MPDTMPQNGAYMVAAYIDAAVILLVYALFLFRRSRRSS
Ga0335085_100018124	3300032770	Soil	MPDAIPQNGGYMVAAYVVAAVILVVYALSLYRRSR
Ga0335085_105404732	3300032770	Soil	MPEAVPQNGAYMVAAYIDAAVILLVYALTLFRRSRRPS
Ga0335078_101703083	3300032805	Soil	MPEGVPANSGYMVAAYIVAAVILVGYALLLARRSGKL
Ga0335078_108344993	3300032805	Soil	MPEGVPANGGYMVAAYIVAAVILVSYALFLARRSGKF
Ga0335070_101636632	3300032829	Soil	MAEGVPNNAGYMVAAYIMAAVILVGYALSLYRRSRHR
Ga0335084_102308262	3300033004	Soil	MPETVPQNGAYMVAAYIDAAVILLVYALTLFRRSRRPS
Ga0214472_104681253	3300033407	Soil	VEPVPEIVPANAGYMVAAYIVTAVILLSYTVAMLRRGSASKH
Ga0214472_108039212	3300033407	Soil	MPETVPANAGYMIAAYTVAAVILLSYAVLLFRRTRKL
Ga0314862_0039464_773_889	3300033803	Peatland	MPETMPQNGAFMVAAYIDAAVILLVYALFLFRRSRRSS
Ga0314867_128123_1_111	3300033808	Peatland	AEGVPSNAGYMVAAYIAAAVILVGYALTLYRRSRHR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F003005

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences