| Basic Information | |
|---|---|
| Family ID | F003005 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 514 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MSDVPQNAGYMVAAYIVTAVILLAYAVSLYRRTEKP |
| Number of Associated Samples | 241 |
| Number of Associated Scaffolds | 514 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.83 % |
| % of genes near scaffold ends (potentially truncated) | 12.65 % |
| % of genes from short scaffolds (< 2000 bps) | 65.95 % |
| Associated GOLD sequencing projects | 208 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.027 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (24.514 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.249 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.198 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.19% β-sheet: 0.00% Coil/Unstructured: 57.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 514 Family Scaffolds |
|---|---|---|
| PF01578 | Cytochrom_C_asm | 38.33 |
| PF02602 | HEM4 | 12.65 |
| PF03379 | CcmB | 10.89 |
| PF00005 | ABC_tran | 2.92 |
| PF01379 | Porphobil_deam | 2.14 |
| PF00072 | Response_reg | 1.95 |
| PF00490 | ALAD | 1.75 |
| PF03900 | Porphobil_deamC | 1.56 |
| PF13620 | CarboxypepD_reg | 0.97 |
| PF13466 | STAS_2 | 0.97 |
| PF14559 | TPR_19 | 0.97 |
| PF02801 | Ketoacyl-synt_C | 0.78 |
| PF00515 | TPR_1 | 0.78 |
| PF08241 | Methyltransf_11 | 0.58 |
| PF00230 | MIP | 0.58 |
| PF13432 | TPR_16 | 0.58 |
| PF03364 | Polyketide_cyc | 0.58 |
| PF16177 | ACAS_N | 0.39 |
| PF01494 | FAD_binding_3 | 0.39 |
| PF13490 | zf-HC2 | 0.19 |
| PF01797 | Y1_Tnp | 0.19 |
| PF10604 | Polyketide_cyc2 | 0.19 |
| PF13520 | AA_permease_2 | 0.19 |
| PF07719 | TPR_2 | 0.19 |
| PF00930 | DPPIV_N | 0.19 |
| PF01940 | DUF92 | 0.19 |
| PF04389 | Peptidase_M28 | 0.19 |
| PF03739 | LptF_LptG | 0.19 |
| PF00557 | Peptidase_M24 | 0.19 |
| PF01522 | Polysacc_deac_1 | 0.19 |
| PF08281 | Sigma70_r4_2 | 0.19 |
| PF00795 | CN_hydrolase | 0.19 |
| COG ID | Name | Functional Category | % Frequency in 514 Family Scaffolds |
|---|---|---|---|
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 12.65 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 10.89 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 3.70 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 1.75 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.78 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.58 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.39 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.39 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.39 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.19 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.19 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.19 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.19 |
| COG1836 | Cytidylyltransferase family enzyme | General function prediction only [R] | 0.19 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.19 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.03 % |
| Unclassified | root | N/A | 0.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1003193 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300001661|JGI12053J15887_10106308 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300002561|JGI25384J37096_10061598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1397 | Open in IMG/M |
| 3300005177|Ga0066690_10240660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1213 | Open in IMG/M |
| 3300005445|Ga0070708_100253809 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300005445|Ga0070708_100293989 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300005445|Ga0070708_101549847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300005446|Ga0066686_10098800 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
| 3300005446|Ga0066686_10239678 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300005467|Ga0070706_101235440 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005518|Ga0070699_100023944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5263 | Open in IMG/M |
| 3300005529|Ga0070741_10322703 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300005536|Ga0070697_100041442 | All Organisms → cellular organisms → Bacteria | 3727 | Open in IMG/M |
| 3300005540|Ga0066697_10001191 | All Organisms → cellular organisms → Bacteria | 10495 | Open in IMG/M |
| 3300005540|Ga0066697_10006422 | All Organisms → cellular organisms → Bacteria | 5806 | Open in IMG/M |
| 3300005540|Ga0066697_10042877 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300005540|Ga0066697_10059856 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
| 3300005540|Ga0066697_10173583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1278 | Open in IMG/M |
| 3300005540|Ga0066697_10206493 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005540|Ga0066697_10563896 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005540|Ga0066697_10688047 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005540|Ga0066697_10706566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 551 | Open in IMG/M |
| 3300005552|Ga0066701_10126549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1518 | Open in IMG/M |
| 3300005552|Ga0066701_10202295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1218 | Open in IMG/M |
| 3300005552|Ga0066701_10258050 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005552|Ga0066701_10264648 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005552|Ga0066701_10408528 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300005552|Ga0066701_10592118 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 676 | Open in IMG/M |
| 3300005552|Ga0066701_10777793 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005552|Ga0066701_10919693 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005553|Ga0066695_10020922 | All Organisms → cellular organisms → Bacteria | 3649 | Open in IMG/M |
| 3300005553|Ga0066695_10033327 | All Organisms → cellular organisms → Bacteria | 2992 | Open in IMG/M |
| 3300005553|Ga0066695_10033458 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
| 3300005553|Ga0066695_10145549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1474 | Open in IMG/M |
| 3300005553|Ga0066695_10211195 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300005553|Ga0066695_10831931 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300005553|Ga0066695_10852711 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005554|Ga0066661_10027158 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
| 3300005554|Ga0066661_10115667 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300005554|Ga0066661_10244683 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005555|Ga0066692_10026924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2997 | Open in IMG/M |
| 3300005555|Ga0066692_10169488 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300005555|Ga0066692_10221460 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300005556|Ga0066707_10026885 | All Organisms → cellular organisms → Bacteria | 3134 | Open in IMG/M |
| 3300005557|Ga0066704_10697527 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005557|Ga0066704_10727901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300005558|Ga0066698_10044412 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300005558|Ga0066698_10874806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300005558|Ga0066698_10978023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 538 | Open in IMG/M |
| 3300005558|Ga0066698_11105505 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005560|Ga0066670_10009883 | All Organisms → cellular organisms → Bacteria | 4032 | Open in IMG/M |
| 3300005560|Ga0066670_10361465 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300005561|Ga0066699_10117326 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1778 | Open in IMG/M |
| 3300005561|Ga0066699_10245271 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300005561|Ga0066699_10678409 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005566|Ga0066693_10104809 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005569|Ga0066705_10002913 | All Organisms → cellular organisms → Bacteria | 6777 | Open in IMG/M |
| 3300005569|Ga0066705_10064999 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300005574|Ga0066694_10010092 | All Organisms → cellular organisms → Bacteria | 3995 | Open in IMG/M |
| 3300005574|Ga0066694_10066426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1657 | Open in IMG/M |
| 3300005574|Ga0066694_10179322 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300005574|Ga0066694_10246807 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005574|Ga0066694_10427913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
| 3300005575|Ga0066702_10274843 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300005576|Ga0066708_10109573 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300005576|Ga0066708_10293318 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005576|Ga0066708_10916697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300005586|Ga0066691_10156743 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1312 | Open in IMG/M |
| 3300005586|Ga0066691_10664552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
| 3300005598|Ga0066706_10221308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1462 | Open in IMG/M |
| 3300005598|Ga0066706_10453727 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1021 | Open in IMG/M |
| 3300005836|Ga0074470_10518466 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005889|Ga0075290_1012193 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300006031|Ga0066651_10377929 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006034|Ga0066656_10003198 | All Organisms → cellular organisms → Bacteria | 7538 | Open in IMG/M |
| 3300006034|Ga0066656_10137948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1515 | Open in IMG/M |
| 3300006034|Ga0066656_10297249 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300006034|Ga0066656_10466460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 823 | Open in IMG/M |
| 3300006034|Ga0066656_10685528 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006034|Ga0066656_10771592 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006046|Ga0066652_100023979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4253 | Open in IMG/M |
| 3300006046|Ga0066652_100027521 | All Organisms → cellular organisms → Bacteria | 4022 | Open in IMG/M |
| 3300006046|Ga0066652_101698094 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006049|Ga0075417_10027980 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2313 | Open in IMG/M |
| 3300006163|Ga0070715_10172637 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006173|Ga0070716_100021090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3429 | Open in IMG/M |
| 3300006175|Ga0070712_101340170 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 624 | Open in IMG/M |
| 3300006755|Ga0079222_10000736 | All Organisms → cellular organisms → Bacteria | 8340 | Open in IMG/M |
| 3300006755|Ga0079222_10026730 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300006755|Ga0079222_10031877 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300006755|Ga0079222_10228106 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300006755|Ga0079222_10561805 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300006755|Ga0079222_11226183 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300006791|Ga0066653_10013589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2901 | Open in IMG/M |
| 3300006791|Ga0066653_10164528 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1095 | Open in IMG/M |
| 3300006791|Ga0066653_10242721 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006791|Ga0066653_10313314 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300006794|Ga0066658_10024916 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300006794|Ga0066658_10025364 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
| 3300006794|Ga0066658_10511381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300006796|Ga0066665_11567367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
| 3300006797|Ga0066659_10320290 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300006797|Ga0066659_10361749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1129 | Open in IMG/M |
| 3300006797|Ga0066659_10854082 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006800|Ga0066660_11284034 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006804|Ga0079221_10040031 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300006804|Ga0079221_10075407 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300006804|Ga0079221_11456308 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006806|Ga0079220_10097751 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300006806|Ga0079220_10162437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1246 | Open in IMG/M |
| 3300006806|Ga0079220_10419257 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300006806|Ga0079220_10908003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 684 | Open in IMG/M |
| 3300006806|Ga0079220_11592740 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006852|Ga0075433_10000113 | All Organisms → cellular organisms → Bacteria | 40079 | Open in IMG/M |
| 3300006852|Ga0075433_10620207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 949 | Open in IMG/M |
| 3300006854|Ga0075425_100062458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4181 | Open in IMG/M |
| 3300006854|Ga0075425_100110334 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300006854|Ga0075425_100617798 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300006854|Ga0075425_100929588 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 994 | Open in IMG/M |
| 3300006854|Ga0075425_102183646 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006871|Ga0075434_101196836 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006876|Ga0079217_10106343 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300006903|Ga0075426_10057838 | All Organisms → cellular organisms → Bacteria | 2767 | Open in IMG/M |
| 3300006914|Ga0075436_100030003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3741 | Open in IMG/M |
| 3300007076|Ga0075435_100003669 | All Organisms → cellular organisms → Bacteria | 10461 | Open in IMG/M |
| 3300007076|Ga0075435_101267168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
| 3300007258|Ga0099793_10025378 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300007258|Ga0099793_10140456 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300007258|Ga0099793_10518307 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300007265|Ga0099794_10014636 | All Organisms → cellular organisms → Bacteria | 3441 | Open in IMG/M |
| 3300009012|Ga0066710_100793360 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300009012|Ga0066710_101135728 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300009012|Ga0066710_101223293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300009012|Ga0066710_101526740 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300009012|Ga0066710_102134866 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009012|Ga0066710_103814518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 565 | Open in IMG/M |
| 3300009012|Ga0066710_103997153 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009038|Ga0099829_10027080 | All Organisms → cellular organisms → Bacteria | 4033 | Open in IMG/M |
| 3300009038|Ga0099829_10034600 | All Organisms → cellular organisms → Bacteria | 3634 | Open in IMG/M |
| 3300009038|Ga0099829_10037907 | All Organisms → cellular organisms → Bacteria | 3488 | Open in IMG/M |
| 3300009038|Ga0099829_10040083 | All Organisms → cellular organisms → Bacteria | 3405 | Open in IMG/M |
| 3300009038|Ga0099829_11339827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. WAC 01424 | 592 | Open in IMG/M |
| 3300009078|Ga0105106_10116623 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300009088|Ga0099830_10031029 | All Organisms → cellular organisms → Bacteria | 3610 | Open in IMG/M |
| 3300009088|Ga0099830_10192720 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300009089|Ga0099828_11035940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 730 | Open in IMG/M |
| 3300009090|Ga0099827_10000938 | All Organisms → cellular organisms → Bacteria | 14356 | Open in IMG/M |
| 3300009090|Ga0099827_10002906 | All Organisms → cellular organisms → Bacteria | 9648 | Open in IMG/M |
| 3300009090|Ga0099827_10021039 | All Organisms → cellular organisms → Bacteria | 4528 | Open in IMG/M |
| 3300009090|Ga0099827_10067825 | All Organisms → cellular organisms → Bacteria | 2743 | Open in IMG/M |
| 3300009090|Ga0099827_10154458 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300009090|Ga0099827_10274743 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300009090|Ga0099827_10293320 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300009090|Ga0099827_11385839 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300009137|Ga0066709_100356701 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300009137|Ga0066709_102491232 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300009137|Ga0066709_102648441 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009162|Ga0075423_10953407 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009162|Ga0075423_11491679 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009804|Ga0105063_1023880 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300009813|Ga0105057_1085881 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
| 3300009814|Ga0105082_1045213 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300010047|Ga0126382_10119251 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300010303|Ga0134082_10059620 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300010304|Ga0134088_10096844 | All Organisms → cellular organisms → Bacteria | 1386 | Open in IMG/M |
| 3300010304|Ga0134088_10223639 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300010304|Ga0134088_10255570 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 843 | Open in IMG/M |
| 3300010321|Ga0134067_10010008 | All Organisms → cellular organisms → Bacteria | 2670 | Open in IMG/M |
| 3300010321|Ga0134067_10034357 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300010321|Ga0134067_10295976 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010322|Ga0134084_10175693 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010325|Ga0134064_10082940 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300010326|Ga0134065_10472419 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010333|Ga0134080_10664585 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010336|Ga0134071_10000747 | All Organisms → cellular organisms → Bacteria | 11160 | Open in IMG/M |
| 3300010336|Ga0134071_10036696 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300010336|Ga0134071_10243746 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300010337|Ga0134062_10174186 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300010337|Ga0134062_10782007 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300010358|Ga0126370_10594429 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300010371|Ga0134125_10046629 | All Organisms → cellular organisms → Bacteria | 4823 | Open in IMG/M |
| 3300010391|Ga0136847_12341942 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300010396|Ga0134126_11637387 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300010403|Ga0134123_10505370 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1139 | Open in IMG/M |
| 3300011269|Ga0137392_10106403 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2219 | Open in IMG/M |
| 3300011270|Ga0137391_10693457 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300011270|Ga0137391_11364078 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300011271|Ga0137393_10008052 | All Organisms → cellular organisms → Bacteria | 7098 | Open in IMG/M |
| 3300011413|Ga0137333_1082175 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300012096|Ga0137389_11686594 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012189|Ga0137388_11517603 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 607 | Open in IMG/M |
| 3300012198|Ga0137364_10106972 | All Organisms → cellular organisms → Bacteria | 1977 | Open in IMG/M |
| 3300012199|Ga0137383_10009983 | All Organisms → cellular organisms → Bacteria | 6310 | Open in IMG/M |
| 3300012199|Ga0137383_10010140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6265 | Open in IMG/M |
| 3300012199|Ga0137383_10067784 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300012199|Ga0137383_10154509 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300012199|Ga0137383_10154950 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300012199|Ga0137383_10991235 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012200|Ga0137382_10036651 | All Organisms → cellular organisms → Bacteria | 2978 | Open in IMG/M |
| 3300012200|Ga0137382_10107725 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300012200|Ga0137382_10370416 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300012200|Ga0137382_10818883 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012200|Ga0137382_11017148 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012201|Ga0137365_10162506 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300012201|Ga0137365_10999302 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012203|Ga0137399_10190209 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
| 3300012203|Ga0137399_10371361 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300012203|Ga0137399_10712336 | Not Available | 845 | Open in IMG/M |
| 3300012204|Ga0137374_10012219 | All Organisms → cellular organisms → Bacteria | 10019 | Open in IMG/M |
| 3300012204|Ga0137374_10025201 | All Organisms → cellular organisms → Bacteria | 6640 | Open in IMG/M |
| 3300012204|Ga0137374_10612645 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012204|Ga0137374_10722082 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012204|Ga0137374_10998926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 605 | Open in IMG/M |
| 3300012205|Ga0137362_10142407 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300012206|Ga0137380_10000017 | All Organisms → cellular organisms → Bacteria | 102178 | Open in IMG/M |
| 3300012206|Ga0137380_10017648 | All Organisms → cellular organisms → Bacteria | 6534 | Open in IMG/M |
| 3300012206|Ga0137380_10179049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1928 | Open in IMG/M |
| 3300012206|Ga0137380_10413706 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300012206|Ga0137380_11209792 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012206|Ga0137380_11596141 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012206|Ga0137380_11711172 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012207|Ga0137381_11443444 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012208|Ga0137376_10075860 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300012209|Ga0137379_10956643 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012210|Ga0137378_10031494 | All Organisms → cellular organisms → Bacteria | 4701 | Open in IMG/M |
| 3300012211|Ga0137377_10057588 | All Organisms → cellular organisms → Bacteria | 3607 | Open in IMG/M |
| 3300012211|Ga0137377_10269518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1634 | Open in IMG/M |
| 3300012211|Ga0137377_11071426 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012211|Ga0137377_11927950 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012285|Ga0137370_10029493 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
| 3300012349|Ga0137387_10053866 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
| 3300012350|Ga0137372_10012210 | All Organisms → cellular organisms → Bacteria | 8209 | Open in IMG/M |
| 3300012350|Ga0137372_10045669 | All Organisms → cellular organisms → Bacteria | 3910 | Open in IMG/M |
| 3300012350|Ga0137372_10054784 | All Organisms → cellular organisms → Bacteria | 3503 | Open in IMG/M |
| 3300012350|Ga0137372_10442532 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300012351|Ga0137386_10094240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2111 | Open in IMG/M |
| 3300012351|Ga0137386_10451415 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300012353|Ga0137367_10620181 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300012354|Ga0137366_10121099 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300012354|Ga0137366_10169242 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300012354|Ga0137366_10963983 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012355|Ga0137369_10052115 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3574 | Open in IMG/M |
| 3300012355|Ga0137369_10201815 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
| 3300012356|Ga0137371_10181532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1649 | Open in IMG/M |
| 3300012358|Ga0137368_10761785 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012359|Ga0137385_10393337 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
| 3300012359|Ga0137385_10916355 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012362|Ga0137361_10059906 | All Organisms → cellular organisms → Bacteria | 3179 | Open in IMG/M |
| 3300012362|Ga0137361_10343333 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300012399|Ga0134061_1205900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300012582|Ga0137358_10030286 | All Organisms → cellular organisms → Bacteria | 3547 | Open in IMG/M |
| 3300012683|Ga0137398_10065202 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300012683|Ga0137398_10123171 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300012683|Ga0137398_10168562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1430 | Open in IMG/M |
| 3300012685|Ga0137397_10006287 | All Organisms → cellular organisms → Bacteria | 8222 | Open in IMG/M |
| 3300012685|Ga0137397_10481718 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300012918|Ga0137396_10283237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1225 | Open in IMG/M |
| 3300012918|Ga0137396_10407878 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012922|Ga0137394_10083562 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300012922|Ga0137394_11332855 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012924|Ga0137413_11818039 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012925|Ga0137419_10238214 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300012925|Ga0137419_10863467 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012925|Ga0137419_10935182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 715 | Open in IMG/M |
| 3300012927|Ga0137416_10120282 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300012929|Ga0137404_10265547 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300012929|Ga0137404_10886478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 813 | Open in IMG/M |
| 3300012929|Ga0137404_11725768 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012931|Ga0153915_10052247 | All Organisms → cellular organisms → Bacteria | 4194 | Open in IMG/M |
| 3300012944|Ga0137410_10654627 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012975|Ga0134110_10003530 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5710 | Open in IMG/M |
| 3300012976|Ga0134076_10011241 | All Organisms → cellular organisms → Bacteria | 3047 | Open in IMG/M |
| 3300012976|Ga0134076_10189175 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300014150|Ga0134081_10145281 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300014150|Ga0134081_10201416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 676 | Open in IMG/M |
| 3300014154|Ga0134075_10415954 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300014157|Ga0134078_10148032 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300014157|Ga0134078_10349022 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300014157|Ga0134078_10586723 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300015242|Ga0137412_10473752 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 961 | Open in IMG/M |
| 3300015356|Ga0134073_10014647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1804 | Open in IMG/M |
| 3300015358|Ga0134089_10002902 | All Organisms → cellular organisms → Bacteria | 4918 | Open in IMG/M |
| 3300015358|Ga0134089_10251039 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300015359|Ga0134085_10238247 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 790 | Open in IMG/M |
| 3300015371|Ga0132258_10736082 | All Organisms → cellular organisms → Bacteria | 2484 | Open in IMG/M |
| 3300015371|Ga0132258_11168414 | All Organisms → cellular organisms → Bacteria | 1945 | Open in IMG/M |
| 3300015372|Ga0132256_100578761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1237 | Open in IMG/M |
| 3300017656|Ga0134112_10002014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6148 | Open in IMG/M |
| 3300017657|Ga0134074_1081381 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300017659|Ga0134083_10020997 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| 3300017659|Ga0134083_10436841 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300017959|Ga0187779_10587291 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300017966|Ga0187776_10467696 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300018027|Ga0184605_10000058 | All Organisms → cellular organisms → Bacteria | 31101 | Open in IMG/M |
| 3300018031|Ga0184634_10000756 | All Organisms → cellular organisms → Bacteria | 8824 | Open in IMG/M |
| 3300018031|Ga0184634_10197731 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300018031|Ga0184634_10230350 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300018060|Ga0187765_10727311 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018063|Ga0184637_10007265 | All Organisms → cellular organisms → Bacteria | 6708 | Open in IMG/M |
| 3300018071|Ga0184618_10097998 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300018071|Ga0184618_10165614 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300018074|Ga0184640_10074704 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300018074|Ga0184640_10243762 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300018431|Ga0066655_10000571 | All Organisms → cellular organisms → Bacteria | 12420 | Open in IMG/M |
| 3300018431|Ga0066655_10042773 | All Organisms → cellular organisms → Bacteria | 2290 | Open in IMG/M |
| 3300018431|Ga0066655_10068258 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300018431|Ga0066655_10071282 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300018431|Ga0066655_10085122 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
| 3300018431|Ga0066655_10295633 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300018431|Ga0066655_10366454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 948 | Open in IMG/M |
| 3300018431|Ga0066655_10471803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 829 | Open in IMG/M |
| 3300018431|Ga0066655_11317079 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300018433|Ga0066667_10000887 | All Organisms → cellular organisms → Bacteria | 10740 | Open in IMG/M |
| 3300018433|Ga0066667_10027663 | All Organisms → cellular organisms → Bacteria | 3136 | Open in IMG/M |
| 3300018433|Ga0066667_10083363 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300018433|Ga0066667_10270232 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300018433|Ga0066667_10356163 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300018433|Ga0066667_10535802 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300018433|Ga0066667_10760397 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300018433|Ga0066667_11030207 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300018433|Ga0066667_11137788 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300018433|Ga0066667_11184447 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018468|Ga0066662_10006419 | All Organisms → cellular organisms → Bacteria | 5827 | Open in IMG/M |
| 3300018468|Ga0066662_10127200 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300018468|Ga0066662_10172011 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300018468|Ga0066662_10235580 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300018468|Ga0066662_10296414 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300018468|Ga0066662_10551333 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300018468|Ga0066662_11286642 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300018482|Ga0066669_10001830 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 8382 | Open in IMG/M |
| 3300018482|Ga0066669_10002203 | All Organisms → cellular organisms → Bacteria | 7919 | Open in IMG/M |
| 3300018482|Ga0066669_10099621 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300018482|Ga0066669_10136646 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300018482|Ga0066669_10161428 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300018482|Ga0066669_10257818 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300018482|Ga0066669_11872175 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300019789|Ga0137408_1188023 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300020004|Ga0193755_1000228 | All Organisms → cellular organisms → Bacteria | 15917 | Open in IMG/M |
| 3300020170|Ga0179594_10003980 | All Organisms → cellular organisms → Bacteria | 3621 | Open in IMG/M |
| 3300020170|Ga0179594_10017837 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2108 | Open in IMG/M |
| 3300020199|Ga0179592_10025865 | All Organisms → cellular organisms → Bacteria | 2633 | Open in IMG/M |
| 3300020200|Ga0194121_10131945 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1494 | Open in IMG/M |
| 3300021046|Ga0215015_10039324 | All Organisms → cellular organisms → Bacteria | 6037 | Open in IMG/M |
| 3300021046|Ga0215015_10195947 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3491 | Open in IMG/M |
| 3300021046|Ga0215015_10703577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5768 | Open in IMG/M |
| 3300021086|Ga0179596_10008403 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300021086|Ga0179596_10205331 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300021086|Ga0179596_10286146 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300021178|Ga0210408_10404916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1087 | Open in IMG/M |
| 3300021559|Ga0210409_10207772 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300024182|Ga0247669_1000542 | All Organisms → cellular organisms → Bacteria | 14622 | Open in IMG/M |
| 3300024246|Ga0247680_1001613 | All Organisms → cellular organisms → Bacteria | 4304 | Open in IMG/M |
| 3300024330|Ga0137417_1182235 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300024330|Ga0137417_1353456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1722 | Open in IMG/M |
| 3300025159|Ga0209619_10294356 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300025165|Ga0209108_10181326 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300025885|Ga0207653_10027443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1828 | Open in IMG/M |
| 3300025898|Ga0207692_10152439 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300025906|Ga0207699_10020032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3577 | Open in IMG/M |
| 3300025910|Ga0207684_10090253 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300025910|Ga0207684_10402741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1176 | Open in IMG/M |
| 3300025922|Ga0207646_11267904 | Not Available | 644 | Open in IMG/M |
| 3300025922|Ga0207646_11477028 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300025939|Ga0207665_10012940 | All Organisms → cellular organisms → Bacteria | 5488 | Open in IMG/M |
| 3300026277|Ga0209350_1004535 | All Organisms → cellular organisms → Bacteria | 4929 | Open in IMG/M |
| 3300026277|Ga0209350_1016935 | All Organisms → cellular organisms → Bacteria | 2278 | Open in IMG/M |
| 3300026277|Ga0209350_1024854 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
| 3300026277|Ga0209350_1155613 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026277|Ga0209350_1161526 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026295|Ga0209234_1001845 | All Organisms → cellular organisms → Bacteria | 8063 | Open in IMG/M |
| 3300026295|Ga0209234_1018528 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
| 3300026295|Ga0209234_1030715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2039 | Open in IMG/M |
| 3300026295|Ga0209234_1307306 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026295|Ga0209234_1308721 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300026296|Ga0209235_1000422 | All Organisms → cellular organisms → Bacteria | 21050 | Open in IMG/M |
| 3300026296|Ga0209235_1000443 | All Organisms → cellular organisms → Bacteria | 20575 | Open in IMG/M |
| 3300026296|Ga0209235_1004507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7788 | Open in IMG/M |
| 3300026296|Ga0209235_1004610 | All Organisms → cellular organisms → Bacteria | 7702 | Open in IMG/M |
| 3300026296|Ga0209235_1038388 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300026296|Ga0209235_1047334 | All Organisms → cellular organisms → Bacteria | 2093 | Open in IMG/M |
| 3300026296|Ga0209235_1063464 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300026296|Ga0209235_1103875 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300026296|Ga0209235_1115932 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300026296|Ga0209235_1150527 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300026296|Ga0209235_1175205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 799 | Open in IMG/M |
| 3300026297|Ga0209237_1007396 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6601 | Open in IMG/M |
| 3300026297|Ga0209237_1013044 | All Organisms → cellular organisms → Bacteria | 4912 | Open in IMG/M |
| 3300026297|Ga0209237_1030500 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2949 | Open in IMG/M |
| 3300026297|Ga0209237_1118339 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300026298|Ga0209236_1017346 | All Organisms → cellular organisms → Bacteria | 4097 | Open in IMG/M |
| 3300026301|Ga0209238_1010135 | All Organisms → cellular organisms → Bacteria | 3703 | Open in IMG/M |
| 3300026301|Ga0209238_1031155 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300026301|Ga0209238_1037200 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300026301|Ga0209238_1143014 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300026301|Ga0209238_1179168 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300026301|Ga0209238_1201388 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026304|Ga0209240_1041711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1740 | Open in IMG/M |
| 3300026305|Ga0209688_1088235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 566 | Open in IMG/M |
| 3300026306|Ga0209468_1002435 | All Organisms → cellular organisms → Bacteria | 7752 | Open in IMG/M |
| 3300026306|Ga0209468_1004718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5365 | Open in IMG/M |
| 3300026306|Ga0209468_1026871 | All Organisms → cellular organisms → Bacteria | 2026 | Open in IMG/M |
| 3300026306|Ga0209468_1191685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
| 3300026307|Ga0209469_1000691 | All Organisms → cellular organisms → Bacteria | 20116 | Open in IMG/M |
| 3300026307|Ga0209469_1132924 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300026309|Ga0209055_1000405 | All Organisms → cellular organisms → Bacteria | 30407 | Open in IMG/M |
| 3300026309|Ga0209055_1000777 | All Organisms → cellular organisms → Bacteria | 21863 | Open in IMG/M |
| 3300026309|Ga0209055_1144849 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300026310|Ga0209239_1064943 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1607 | Open in IMG/M |
| 3300026310|Ga0209239_1116318 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300026310|Ga0209239_1215249 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300026312|Ga0209153_1005965 | All Organisms → cellular organisms → Bacteria | 3806 | Open in IMG/M |
| 3300026313|Ga0209761_1284701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
| 3300026314|Ga0209268_1003685 | All Organisms → cellular organisms → Bacteria | 7014 | Open in IMG/M |
| 3300026314|Ga0209268_1070799 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300026314|Ga0209268_1181351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300026317|Ga0209154_1101712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1224 | Open in IMG/M |
| 3300026318|Ga0209471_1045441 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300026318|Ga0209471_1046837 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300026318|Ga0209471_1090715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1335 | Open in IMG/M |
| 3300026318|Ga0209471_1310674 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026323|Ga0209472_1001070 | All Organisms → cellular organisms → Bacteria | 15963 | Open in IMG/M |
| 3300026324|Ga0209470_1152061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1015 | Open in IMG/M |
| 3300026324|Ga0209470_1298892 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300026325|Ga0209152_10086319 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300026326|Ga0209801_1025069 | All Organisms → cellular organisms → Bacteria | 2880 | Open in IMG/M |
| 3300026328|Ga0209802_1000173 | All Organisms → cellular organisms → Bacteria | 48927 | Open in IMG/M |
| 3300026328|Ga0209802_1016815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4121 | Open in IMG/M |
| 3300026329|Ga0209375_1007458 | All Organisms → cellular organisms → Bacteria | 7040 | Open in IMG/M |
| 3300026329|Ga0209375_1014335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4776 | Open in IMG/M |
| 3300026332|Ga0209803_1235850 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300026335|Ga0209804_1116441 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1216 | Open in IMG/M |
| 3300026335|Ga0209804_1256719 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300026358|Ga0257166_1017770 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300026523|Ga0209808_1004273 | All Organisms → cellular organisms → Bacteria | 7297 | Open in IMG/M |
| 3300026524|Ga0209690_1000401 | All Organisms → cellular organisms → Bacteria | 22887 | Open in IMG/M |
| 3300026527|Ga0209059_1109194 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300026528|Ga0209378_1021155 | All Organisms → cellular organisms → Bacteria | 3622 | Open in IMG/M |
| 3300026537|Ga0209157_1092916 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300026537|Ga0209157_1093840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1441 | Open in IMG/M |
| 3300026538|Ga0209056_10000218 | All Organisms → cellular organisms → Bacteria | 63565 | Open in IMG/M |
| 3300026540|Ga0209376_1022603 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
| 3300026540|Ga0209376_1133524 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300026548|Ga0209161_10249869 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300026551|Ga0209648_10008469 | All Organisms → cellular organisms → Bacteria | 8878 | Open in IMG/M |
| 3300026551|Ga0209648_10014029 | All Organisms → cellular organisms → Bacteria | 6996 | Open in IMG/M |
| 3300026551|Ga0209648_10025340 | All Organisms → cellular organisms → Bacteria | 5183 | Open in IMG/M |
| 3300026551|Ga0209648_10059553 | All Organisms → cellular organisms → Bacteria | 3242 | Open in IMG/M |
| 3300026551|Ga0209648_10147048 | All Organisms → cellular organisms → Bacteria | 1866 | Open in IMG/M |
| 3300026551|Ga0209648_10156132 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300026551|Ga0209648_10398358 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300026552|Ga0209577_10728241 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300026557|Ga0179587_10103683 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1725 | Open in IMG/M |
| 3300027324|Ga0209845_1034269 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300027383|Ga0209213_1043617 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 848 | Open in IMG/M |
| 3300027587|Ga0209220_1000082 | All Organisms → cellular organisms → Bacteria | 46605 | Open in IMG/M |
| 3300027633|Ga0208988_1103909 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300027643|Ga0209076_1038487 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300027643|Ga0209076_1151107 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300027671|Ga0209588_1019426 | All Organisms → cellular organisms → Bacteria | 2120 | Open in IMG/M |
| 3300027725|Ga0209178_1091553 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300027725|Ga0209178_1092388 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300027725|Ga0209178_1214155 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027725|Ga0209178_1236382 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300027748|Ga0209689_1000370 | All Organisms → cellular organisms → Bacteria | 30334 | Open in IMG/M |
| 3300027787|Ga0209074_10157812 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300027787|Ga0209074_10157903 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300027846|Ga0209180_10021261 | All Organisms → cellular organisms → Bacteria | 3442 | Open in IMG/M |
| 3300027862|Ga0209701_10028334 | All Organisms → cellular organisms → Bacteria | 3645 | Open in IMG/M |
| 3300027862|Ga0209701_10346331 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300027873|Ga0209814_10001575 | All Organisms → cellular organisms → Bacteria | 8116 | Open in IMG/M |
| 3300027874|Ga0209465_10368935 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300027875|Ga0209283_10008361 | All Organisms → cellular organisms → Bacteria | 6046 | Open in IMG/M |
| 3300027882|Ga0209590_10001306 | All Organisms → cellular organisms → Bacteria | 9343 | Open in IMG/M |
| 3300027882|Ga0209590_10034628 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
| 3300027903|Ga0209488_11120324 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300027948|Ga0209858_1014374 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300028536|Ga0137415_10017910 | All Organisms → cellular organisms → Bacteria | 7023 | Open in IMG/M |
| 3300028536|Ga0137415_10140515 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300028792|Ga0307504_10207664 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300030006|Ga0299907_10652773 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300031152|Ga0307501_10033082 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300031421|Ga0308194_10037537 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300031720|Ga0307469_10000541 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 13898 | Open in IMG/M |
| 3300031720|Ga0307469_10003656 | All Organisms → cellular organisms → Bacteria | 6519 | Open in IMG/M |
| 3300031720|Ga0307469_10056521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2505 | Open in IMG/M |
| 3300031720|Ga0307469_10080578 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
| 3300031720|Ga0307469_10300165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1322 | Open in IMG/M |
| 3300031720|Ga0307469_10771850 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031720|Ga0307469_11177120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300031720|Ga0307469_11465227 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031740|Ga0307468_100425816 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1024 | Open in IMG/M |
| 3300031753|Ga0307477_10394211 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300031820|Ga0307473_10070300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1752 | Open in IMG/M |
| 3300031949|Ga0214473_10038705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5601 | Open in IMG/M |
| 3300031962|Ga0307479_10212795 | All Organisms → cellular organisms → Bacteria | 1904 | Open in IMG/M |
| 3300031962|Ga0307479_10403120 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300031962|Ga0307479_10685939 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300032180|Ga0307471_100709426 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300032180|Ga0307471_101648089 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300032180|Ga0307471_102019251 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300032342|Ga0315286_12091540 | Not Available | 524 | Open in IMG/M |
| 3300032770|Ga0335085_10001132 | All Organisms → cellular organisms → Bacteria | 61456 | Open in IMG/M |
| 3300032770|Ga0335085_10001812 | All Organisms → cellular organisms → Bacteria | 42881 | Open in IMG/M |
| 3300032770|Ga0335085_10540473 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300032805|Ga0335078_10170308 | All Organisms → cellular organisms → Bacteria | 3059 | Open in IMG/M |
| 3300032805|Ga0335078_10834499 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1118 | Open in IMG/M |
| 3300032829|Ga0335070_10163663 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300033004|Ga0335084_10230826 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300033407|Ga0214472_10468125 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300033407|Ga0214472_10803921 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300033803|Ga0314862_0039464 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300033808|Ga0314867_128123 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 24.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 17.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.31% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.36% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.39% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.39% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.39% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.39% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.19% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.19% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.19% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.19% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.19% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.19% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.19% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.19% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.19% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.19% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10031931 | 3300001086 | Forest Soil | MPETVPANAGYMVAAYTAAALILVGYAVLLYRRTRKL* |
| JGI12053J15887_101063083 | 3300001661 | Forest Soil | MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP* |
| JGI25384J37096_100615981 | 3300002561 | Grasslands Soil | VGGAPAMPDVPQNTGYMVAAYVVTAVILVAYAVSLYRRTNKP* |
| Ga0066690_102406603 | 3300005177 | Soil | ISAVVPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR* |
| Ga0070708_1002538092 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVLQNGGYMVAAYIVTAVILVAYAIVLARRTRNKHY* |
| Ga0070708_1002939891 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVGGAPAMSDVPQNAGYMVAAYVVTAVILVAYTVSLYRRSHKS* |
| Ga0070708_1015498471 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PSMDNAVPQNTGYLIAAYILVPTILIGYALSLYRRSLRP* |
| Ga0066686_100988002 | 3300005446 | Soil | MQLMPEGVPQNAGYLMAAYILVPTILIAYAVSLYRRTNKP* |
| Ga0066686_102396782 | 3300005446 | Soil | VPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP* |
| Ga0070706_1012354402 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVLQNGGYMVAAYIVTAVILVAYAIVLARRARNKHY* |
| Ga0070699_1000239448 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVSQNGGYMVAAYIITAVILVVYTIVLARRTRNKHY* |
| Ga0070741_103227032 | 3300005529 | Surface Soil | MNQLPQNGGYMVAAYVVAAVILVAFALSLYRRSK* |
| Ga0070697_1000414426 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TRWGTRTMPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP* |
| Ga0066697_100011917 | 3300005540 | Soil | VPEVPQNAGYLVAAYVVTAVILLCYTFSLYRRSSKG* |
| Ga0066697_100064222 | 3300005540 | Soil | MGDQVPHNAGYLIAAYILVPTILIVYALSLYRRGQRP* |
| Ga0066697_100428774 | 3300005540 | Soil | MPETFPHNAGYMVAAYTVAAVILVAYAVSLYRRTRNL* |
| Ga0066697_100598562 | 3300005540 | Soil | MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRAKQP* |
| Ga0066697_101735832 | 3300005540 | Soil | MADVPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL* |
| Ga0066697_102064932 | 3300005540 | Soil | MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP* |
| Ga0066697_105638962 | 3300005540 | Soil | MLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP* |
| Ga0066697_106880471 | 3300005540 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD* |
| Ga0066697_107065661 | 3300005540 | Soil | MPDVPHNGGYMVAAYIVTAVILLAYAVSLYRRTERR* |
| Ga0066701_101265492 | 3300005552 | Soil | MADAPHNAGYMAAAYVATALILLAYAVSLYRRAARR* |
| Ga0066701_102022952 | 3300005552 | Soil | MPETFPHNAGYMIAAYTVAAVILVAYALSLYRRTRGL* |
| Ga0066701_102580503 | 3300005552 | Soil | VPDVPHNAGYMVAAYVTTALILLAYACSLYRRAAKR* |
| Ga0066701_102646482 | 3300005552 | Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRATRP* |
| Ga0066701_104085282 | 3300005552 | Soil | MPDVPQNAGYMVAAYIVTAVILLIYAISLHRRTAKP* |
| Ga0066701_105921182 | 3300005552 | Soil | MSEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0066701_107777932 | 3300005552 | Soil | MPEVPHNAGYMAAAYIVTAVILLGYAFSLYRRSTRR* |
| Ga0066701_109196931 | 3300005552 | Soil | MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKL* |
| Ga0066695_100209225 | 3300005553 | Soil | MSETFPQNAGYMVAAYTVAAVILVAYAVTLWRRTRGL* |
| Ga0066695_100333272 | 3300005553 | Soil | MPDVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP* |
| Ga0066695_100334581 | 3300005553 | Soil | NMADVPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL* |
| Ga0066695_101455493 | 3300005553 | Soil | MPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL* |
| Ga0066695_102111951 | 3300005553 | Soil | RSMPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKP* |
| Ga0066695_108319312 | 3300005553 | Soil | MSEVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP* |
| Ga0066695_108527111 | 3300005553 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKR* |
| Ga0066661_100271581 | 3300005554 | Soil | GAPMPDVPHNGGYMVAAYIVTAVILLGYAISLYRRTGKP* |
| Ga0066661_101156673 | 3300005554 | Soil | MADIPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL* |
| Ga0066661_102446832 | 3300005554 | Soil | MPEIIPQNAGYMTAAYIVAAAILLTYAGALWRRTRGR* |
| Ga0066692_100269245 | 3300005555 | Soil | VPEVPQNAGYLVAAYVVTAVILLGYTLSLYRRSSKG* |
| Ga0066692_101694883 | 3300005555 | Soil | VPDAPHNAGYMVAAYVTTALILLAYAFSLYRRTAKR* |
| Ga0066692_102214603 | 3300005555 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYAISLYRRTGKP* |
| Ga0066707_100268856 | 3300005556 | Soil | MPDVPQNGAYMVAAYIVTAVILLGYALSLYRRAKQP* |
| Ga0066704_106975272 | 3300005557 | Soil | VPEGVPANGGYMVAAYIVTAVILVTYTLLLYKRTGRL* |
| Ga0066704_107279011 | 3300005557 | Soil | RGTMLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP* |
| Ga0066698_100444123 | 3300005558 | Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSRS* |
| Ga0066698_108748062 | 3300005558 | Soil | MPDVPHNSGYMVAAYIVTAVILLGYALSLYRRTEKR* |
| Ga0066698_109780231 | 3300005558 | Soil | SVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP* |
| Ga0066698_111055052 | 3300005558 | Soil | MHLMPEGVPQNAGYLVAAYILVPTILIAYAVSLYRRTNKP* |
| Ga0066670_100098834 | 3300005560 | Soil | MSEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRGTRP* |
| Ga0066670_103614652 | 3300005560 | Soil | MPDVPHNSGYMVAAYIVTAAILVGYALSLYRRSEKR* |
| Ga0066699_101173263 | 3300005561 | Soil | MSEVPQNAGYLVAAYIMVPVILLAYAVSLYRRSARP* |
| Ga0066699_102452712 | 3300005561 | Soil | MSEVPRNAAYLVAAYIVVPVILLAYALSLYRRSTRP* |
| Ga0066699_106784092 | 3300005561 | Soil | CGAKPRRMAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTRP* |
| Ga0066693_101048092 | 3300005566 | Soil | MSEGLPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP* |
| Ga0066705_100029131 | 3300005569 | Soil | RGARMPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD* |
| Ga0066705_100649993 | 3300005569 | Soil | MSDAVPQNAGYMVAAYIVAAVILAAYAASLYRRTKGL* |
| Ga0066694_100100926 | 3300005574 | Soil | MPDVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP* |
| Ga0066694_100664263 | 3300005574 | Soil | MSEAVPQNAGYMVAAYIIAAVILVTYAISLFRRTRGL* |
| Ga0066694_101793223 | 3300005574 | Soil | RSPGRGRARKPAMSEGFPHNAGYMVAAYTVAAVILVAYAVTLWRRTRGL* |
| Ga0066694_102468072 | 3300005574 | Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAASLYRRSTRS* |
| Ga0066694_104279132 | 3300005574 | Soil | MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSARP* |
| Ga0066702_102748432 | 3300005575 | Soil | MAEGVPQNAAYLAAAYIVVPLILLAYAVSLYRRSTRP* |
| Ga0066708_101095732 | 3300005576 | Soil | MPEVPQNGGYAVAAYIVTAVILVSYALSLHRRTRR* |
| Ga0066708_102933181 | 3300005576 | Soil | GARRPAVSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0066708_109166972 | 3300005576 | Soil | MPDVPQNAGYMVAAYIVTAVILLAYALSLYRRTAKP* |
| Ga0066691_101567432 | 3300005586 | Soil | TMLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP* |
| Ga0066691_106645521 | 3300005586 | Soil | GTMLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP* |
| Ga0066706_102213081 | 3300005598 | Soil | MSDAVPQNAGYMVAAYIVAAVILVTYAVTLWRRTRGL* |
| Ga0066706_104537272 | 3300005598 | Soil | MSEAVPQNAGYMVAAYIVAAVILVTYAVTLFRRTRGL* |
| Ga0074470_105184662 | 3300005836 | Sediment (Intertidal) | MPVPDAVPRDAGYMIAAYIVAAVILLGYTIALARRARRRGR* |
| Ga0075290_10121933 | 3300005889 | Rice Paddy Soil | CGRPGRAWGGTMPEVPQNAGYTAAAYIVTAVILLGYAVSLYRRTTKP* |
| Ga0066651_103779292 | 3300006031 | Soil | MPDVPHNSGYMIAAYIVTAVILVGYAVSLYRRGEKR* |
| Ga0066656_100031984 | 3300006034 | Soil | VPEVPQNAGYLVAAYVVTAVILLGYTFSLYRRSSKG* |
| Ga0066656_101379483 | 3300006034 | Soil | MSDAPHNAGYMAAAYVATALILLAYAVSLYRRAARR* |
| Ga0066656_102972492 | 3300006034 | Soil | MGSVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP* |
| Ga0066656_104664602 | 3300006034 | Soil | MSEGFPQNAGYMVAAYAVAAVILVAYAVSLWRRTRGL* |
| Ga0066656_106855282 | 3300006034 | Soil | MPDVPQNAGYMVAAYVVTALILLVYAASLSRRADKP* |
| Ga0066656_107715921 | 3300006034 | Soil | PGRGRRPPMPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL* |
| Ga0066652_1000239794 | 3300006046 | Soil | MPEGFPQNAGYLVAAYTVAAVILIAYAVSLFRRTRGL* |
| Ga0066652_1000275214 | 3300006046 | Soil | MPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKP* |
| Ga0066652_1016980942 | 3300006046 | Soil | MSEGVPQNAGYLVAAYIVVPVILRAYAASLYRRSTRS* |
| Ga0075417_100279803 | 3300006049 | Populus Rhizosphere | MPDVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP* |
| Ga0070715_101726373 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSRRP* |
| Ga0070716_1000210905 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDVPQNAGYMVAAYVVTAVILVAYAISLYRRSYKS* |
| Ga0070712_1013401702 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDVPQNAGYMVAAYVVTAVILVAYAISLYRRSHKS* |
| Ga0079222_100007367 | 3300006755 | Agricultural Soil | MPDVPHNAGYMAAAYILTAVILLAYTISLYRRSDRR* |
| Ga0079222_100267305 | 3300006755 | Agricultural Soil | MDNAVPQNTGYLIAAYILVPTILIGYALSLYRRSLRP* |
| Ga0079222_100318774 | 3300006755 | Agricultural Soil | MGDTVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP* |
| Ga0079222_102281062 | 3300006755 | Agricultural Soil | MPEGIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR* |
| Ga0079222_105618052 | 3300006755 | Agricultural Soil | MDSGVPQNAGYLMAAYILVPTILIAYAVSLYRRSRRP* |
| Ga0079222_112261832 | 3300006755 | Agricultural Soil | MPEVPQNAGYMVAAYIVTAAILLGYALLLYRRSIMAR* |
| Ga0066653_100135891 | 3300006791 | Soil | MSEGFPHNAGYMVAAYTVAAVILVAYAVTLWRRTRGL* |
| Ga0066653_101645282 | 3300006791 | Soil | MSEVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP* |
| Ga0066653_102427212 | 3300006791 | Soil | MPEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0066653_103133142 | 3300006791 | Soil | MPDVPHNSGYMIAAYIVTAVILLGYAVSLYRRGEKR* |
| Ga0066658_100249164 | 3300006794 | Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSTRS* |
| Ga0066658_100253644 | 3300006794 | Soil | VPDTPHNAGYMIAAYITTALILVAYAFSLYRRAAKR* |
| Ga0066658_105113812 | 3300006794 | Soil | VSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0066665_115673672 | 3300006796 | Soil | MSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTGKP* |
| Ga0066659_103202902 | 3300006797 | Soil | MSEVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP* |
| Ga0066659_103617492 | 3300006797 | Soil | MAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTRP* |
| Ga0066659_108540821 | 3300006797 | Soil | VPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR* |
| Ga0066660_112840342 | 3300006800 | Soil | MPDVPHNGGYMIAAYIVTAVILVGYALSLYRRGEKR* |
| Ga0079221_100400313 | 3300006804 | Agricultural Soil | MPENIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR* |
| Ga0079221_100754072 | 3300006804 | Agricultural Soil | MAEVPQNAGYMVAAYIVTAVIVLGYAVSLVRRSRNL* |
| Ga0079221_114563082 | 3300006804 | Agricultural Soil | MADGVPQNAGYLAAAYVLVPTILIAYAVSLYRRSKR* |
| Ga0079220_100977512 | 3300006806 | Agricultural Soil | MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKQL* |
| Ga0079220_101624372 | 3300006806 | Agricultural Soil | MPEGIPQNAGYMVAAYIVTAVVLLAYTLSLYRRTRGR* |
| Ga0079220_104192572 | 3300006806 | Agricultural Soil | VSEAVPQNAGYLVAAYLVVPLILLAYAASLYRRDGRP* |
| Ga0079220_109080031 | 3300006806 | Agricultural Soil | RAGRRPSMDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSRRP* |
| Ga0079220_115927401 | 3300006806 | Agricultural Soil | RPSMDNAVPQNTGYLIAAYILVPTILIGYALSLYRRSLRP* |
| Ga0075433_1000011321 | 3300006852 | Populus Rhizosphere | MSDVPQNAGYMMAAYVVTAVILVAYAVSLYRRANKP* |
| Ga0075433_101483233 | 3300006852 | Populus Rhizosphere | MNGPPQNAAFMVAAYIATAVILVAYAVILIRRTRGL* |
| Ga0075433_106202072 | 3300006852 | Populus Rhizosphere | MADVPQNAGYMMAAYVVTAVILIAYAVSLYRRTRNL* |
| Ga0075425_1000624587 | 3300006854 | Populus Rhizosphere | MSEAVPQNAGYLVAAYIVVPLILLAYAASLYRRDTRP* |
| Ga0075425_1001103346 | 3300006854 | Populus Rhizosphere | MDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP* |
| Ga0075425_1006177982 | 3300006854 | Populus Rhizosphere | MPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP* |
| Ga0075425_1009295883 | 3300006854 | Populus Rhizosphere | MPENIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR* |
| Ga0075425_1021836462 | 3300006854 | Populus Rhizosphere | MPETIPQNAGYMVAAYIVTAIIVLGYALSLYRRSRGR* |
| Ga0075434_1011968362 | 3300006871 | Populus Rhizosphere | MPENIPQNAGYMVAAYIVTAIVILAYAASLYRRTRGR* |
| Ga0079217_101063432 | 3300006876 | Agricultural Soil | VRENAGYMVAAYIVTGAVYLIYFLRLLRRSRGLRE* |
| Ga0075426_100578383 | 3300006903 | Populus Rhizosphere | MSEALPQNAGYLVAAYIIVPLILLAYAASLYRRDTRP* |
| Ga0075436_1000300034 | 3300006914 | Populus Rhizosphere | MPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTNKP* |
| Ga0075435_1000036691 | 3300007076 | Populus Rhizosphere | ARRPAMPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP* |
| Ga0075435_1012671681 | 3300007076 | Populus Rhizosphere | PMSEALPQNAGYLVAAYIIVPLILLAYAASLYRRDTRP* |
| Ga0099793_100253785 | 3300007258 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNKS* |
| Ga0099793_101404562 | 3300007258 | Vadose Zone Soil | MPETFPHNAGYMIAAYTVAAVVLVVYAVSLYRRTKGL* |
| Ga0099793_105183072 | 3300007258 | Vadose Zone Soil | MLEVPQNGGYMVAAYVVTAAILLGYALSLYRRTTKP* |
| Ga0099794_100146364 | 3300007265 | Vadose Zone Soil | MTEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL* |
| Ga0066710_1007933602 | 3300009012 | Grasslands Soil | MPEAIPQNAGYMVAAYIVTAIVILAYAASLYRRTRGR |
| Ga0066710_1011357282 | 3300009012 | Grasslands Soil | MSDAVPQNAGYMVAAYIVAAVILVTYAVTLFRRTRGL |
| Ga0066710_1012232932 | 3300009012 | Grasslands Soil | MPEVPPNAGYAVAAYIVTAAILVGYALSLHRRTRRR |
| Ga0066710_1015267401 | 3300009012 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERR |
| Ga0066710_1021348662 | 3300009012 | Grasslands Soil | MPEGFPQNAGYMVAAYTVAAVILVAYAVSLFRRTRGL |
| Ga0066710_1038145182 | 3300009012 | Grasslands Soil | MPDVPQNAGYMVAAYVVTALILLVYAASLSRRADKP |
| Ga0066710_1039971532 | 3300009012 | Grasslands Soil | MPEVPQNGGYAVAAYIVTAAILLVYALTLHRRTRRR |
| Ga0099829_100270805 | 3300009038 | Vadose Zone Soil | MSDVPQNAGYLVAAYVVTAVILLAYAVSLYRRANKS* |
| Ga0099829_100346004 | 3300009038 | Vadose Zone Soil | VADVPQTGGYMVAAYVVTALILLAYALSLYRRTKRP* |
| Ga0099829_100379075 | 3300009038 | Vadose Zone Soil | VQPMAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKL* |
| Ga0099829_100400832 | 3300009038 | Vadose Zone Soil | MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSNL* |
| Ga0099829_113398272 | 3300009038 | Vadose Zone Soil | MPEVPQNAAYMVAAYVVTAAILLGYAYALYRRSTKP* |
| Ga0105106_101166232 | 3300009078 | Freshwater Sediment | MPELPQNGAYMVAAYIVTAVILMGYAVSLWMRSR* |
| Ga0099830_100310295 | 3300009088 | Vadose Zone Soil | MPDVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0099830_101927204 | 3300009088 | Vadose Zone Soil | MSESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR* |
| Ga0099828_110359402 | 3300009089 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNQS* |
| Ga0099827_1000093812 | 3300009090 | Vadose Zone Soil | MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF* |
| Ga0099827_100029067 | 3300009090 | Vadose Zone Soil | VPEVPQNAGYLVAAYIVTAVILLGYTFSLYRRSSKG* |
| Ga0099827_100210396 | 3300009090 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNKA* |
| Ga0099827_100678253 | 3300009090 | Vadose Zone Soil | MSETFPHNAGYMIAAYTVAAVILVAYAVLLYRRTRGL* |
| Ga0099827_101544583 | 3300009090 | Vadose Zone Soil | VSEVPHNGAYMVAAYIVTAGILLGYALALYRRTRKP* |
| Ga0099827_102747433 | 3300009090 | Vadose Zone Soil | MPEGVANGGYMVAAYIAAAVILVAYALFLYSRSRKL* |
| Ga0099827_102933203 | 3300009090 | Vadose Zone Soil | MPEVPHNAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0099827_113858392 | 3300009090 | Vadose Zone Soil | MSEGFPHNAGYMVAAYTVAAVILVAYAVSLFRRTRGL* |
| Ga0066709_1003567013 | 3300009137 | Grasslands Soil | MPDVPQNAGYMVAAYIGTAVLLLAYAVSLYRRTNKKP* |
| Ga0066709_1024912321 | 3300009137 | Grasslands Soil | MPDVPQNGGYMVAAYIVTAVILLGYALSLYRRTNKL* |
| Ga0066709_1026484411 | 3300009137 | Grasslands Soil | GKAMPEVPQNGGYAVAAYIVTAVILVSYALSLHRRTRR* |
| Ga0075423_109534071 | 3300009162 | Populus Rhizosphere | MADVPQNAGYMMAAYVVTAVILIGYAVSLYRRTSKP |
| Ga0075423_114916792 | 3300009162 | Populus Rhizosphere | MPEEVPLNGGYMVAAYIVTAVILLGYSIVLARRTRKY* |
| Ga0105063_10238802 | 3300009804 | Groundwater Sand | VLEVPENAGYLVAAYIVTAVILLGYALSLYRRTNKP* |
| Ga0105057_10858812 | 3300009813 | Groundwater Sand | MAEVPQNAEYMVAAYIVTAVILLGYALSLYRRTTKL* |
| Ga0105082_10452132 | 3300009814 | Groundwater Sand | MAEVPQNTEYMVAAYIVTAVILLGYALSLYRRTTKL* |
| Ga0126382_101192512 | 3300010047 | Tropical Forest Soil | MPEGVAENGGYMVAAYIVTAVILVAYTILLARRTGNKHN* |
| Ga0134082_100596202 | 3300010303 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILVGYAVSLYRRGEKR* |
| Ga0134088_100968442 | 3300010304 | Grasslands Soil | MADIPQNAGYMVAAYIVTGVILLGYAVSLGRRSRNL* |
| Ga0134088_102236393 | 3300010304 | Grasslands Soil | VPEVPQNAGYMVAAYVVTAVILVAYAVSLYRRISKP* |
| Ga0134088_102555702 | 3300010304 | Grasslands Soil | MPEGVPQNAGYLMAAYILVPTILIAYAVSLYRRTNKP* |
| Ga0134067_100100082 | 3300010321 | Grasslands Soil | MPDVPHNSGYMIAAYIVTAVILVGYALSLYRRGEKR* |
| Ga0134067_100343572 | 3300010321 | Grasslands Soil | VSEVPENAGYMMAAYIVTAVILIAYAVSLFRRTSKP* |
| Ga0134067_102959762 | 3300010321 | Grasslands Soil | MSEVPQNAGYLVAAYIMVPVILLAYAVSLYRLSARP* |
| Ga0134084_101756932 | 3300010322 | Grasslands Soil | MPEGIPHNAGYRAAAYVLVPLILLAYAVSLYRRSARP* |
| Ga0134064_100829402 | 3300010325 | Grasslands Soil | VSEVPENAGYMMAAYIVTPVILIAYAVSLYRRTSKP* |
| Ga0134065_104724192 | 3300010326 | Grasslands Soil | VSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTGKP* |
| Ga0134080_106645852 | 3300010333 | Grasslands Soil | DVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP* |
| Ga0134071_100007472 | 3300010336 | Grasslands Soil | VPEVPQNAGYLVAAYVVTAVILLGYAFSLYRRSSKG* |
| Ga0134071_100366962 | 3300010336 | Grasslands Soil | MSEGVPQNAGYMVAAYIVAAVILVAYAVTLFRRTRGL* |
| Ga0134071_102437462 | 3300010336 | Grasslands Soil | MPDVPQNAGYLAAAYIVTAVILLGYTVSLYRRGRTP* |
| Ga0134062_101741862 | 3300010337 | Grasslands Soil | RMPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKR* |
| Ga0134062_107820072 | 3300010337 | Grasslands Soil | MSEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP* |
| Ga0126370_105944292 | 3300010358 | Tropical Forest Soil | MPEGVAENGGYMVAAYIVTAVILVAYTMLLARRTRN* |
| Ga0134125_100466293 | 3300010371 | Terrestrial Soil | MSDVPHNAGYMVAAYVVTAVILVAYAVSLYRRSNKS* |
| Ga0136847_123419424 | 3300010391 | Freshwater Sediment | MGETPQNAGFMVAAYIVTAAILLGYAIALARRSRGR* |
| Ga0134126_116373872 | 3300010396 | Terrestrial Soil | MSDVPQNAGYMVAAYVVTAVILVAYTVSLYRRSHKS* |
| Ga0134123_105053703 | 3300010403 | Terrestrial Soil | MADVPHNAAYMVAAYVVTAVILVAYAISLYRRSHKS* |
| Ga0137392_101064031 | 3300011269 | Vadose Zone Soil | SARVQPMAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSNKL* |
| Ga0137391_106934572 | 3300011270 | Vadose Zone Soil | MAEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL* |
| Ga0137391_113640782 | 3300011270 | Vadose Zone Soil | MFESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR* |
| Ga0137393_100080525 | 3300011271 | Vadose Zone Soil | MSEGIPQNAGYMVAAYVVTAIVLLSYALSLYRRTRGR* |
| Ga0137333_10821752 | 3300011413 | Soil | DRVPHNEGYMVAAYIVAAVIVVGYAVSLYRRSRNR* |
| Ga0137389_116865942 | 3300012096 | Vadose Zone Soil | MPEAVAQNGGYMVAAYIVTAVILVAYTIVLARRTRNKHY* |
| Ga0137388_115176032 | 3300012189 | Vadose Zone Soil | EGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF* |
| Ga0137364_101069723 | 3300012198 | Vadose Zone Soil | MPDVPHNSSYMIAAYIVTAVILLGYAVSLYRRGEKR* |
| Ga0137383_100099835 | 3300012199 | Vadose Zone Soil | MPEVLQNGGYAVAAYIVTAAILLGYALSLHRRTRRR* |
| Ga0137383_100101408 | 3300012199 | Vadose Zone Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRGEKR* |
| Ga0137383_100677844 | 3300012199 | Vadose Zone Soil | MLDVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP* |
| Ga0137383_101545093 | 3300012199 | Vadose Zone Soil | MSEGFPQNAGYMVAAYAVAAVILVAYAVSLLRRTRGL* |
| Ga0137383_101549503 | 3300012199 | Vadose Zone Soil | MPEVPQNAGYMMAAYVVTAVILIAYAVSLYRRTSKP* |
| Ga0137383_109912351 | 3300012199 | Vadose Zone Soil | MPENIPQDAGYMVAAYVVTAIIVLAYAASLYRRTRGR* |
| Ga0137382_100366516 | 3300012200 | Vadose Zone Soil | MPDVPQNAGYMVAAYIVTAVILLAYAVSLHRRAAKP* |
| Ga0137382_101077252 | 3300012200 | Vadose Zone Soil | MPESIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR* |
| Ga0137382_103704162 | 3300012200 | Vadose Zone Soil | MSDAVPQNAGYMVAAYIVAAVILVTYAVTLFRRTRGL* |
| Ga0137382_108188832 | 3300012200 | Vadose Zone Soil | MSEVPQNAGYMMAAYIVTAVILLAYAVSLYRRTSKP* |
| Ga0137382_110171482 | 3300012200 | Vadose Zone Soil | MSEVIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR* |
| Ga0137365_101625063 | 3300012201 | Vadose Zone Soil | MPDVPQNAGYMMAAYAVTAVILITYAVSLYRRTSKP* |
| Ga0137365_109993022 | 3300012201 | Vadose Zone Soil | MSEGFPQNAGYMVAAYTVAAVILVAYAVTLFRRTRGL* |
| Ga0137399_101902093 | 3300012203 | Vadose Zone Soil | MPETFPHNAGYMIAAYTVAAVILVVYAVSLYRRTKGL* |
| Ga0137399_103713612 | 3300012203 | Vadose Zone Soil | MSDVPQNAGYMAAAYVVTAVILLVYAVSLYRRTNKP* |
| Ga0137399_107123362 | 3300012203 | Vadose Zone Soil | MLEVPQNGGYTVAAYVVTAAILLGYALSLYRRTTKP* |
| Ga0137374_100122197 | 3300012204 | Vadose Zone Soil | MPEGFPQNAGYMVAAYTVAAVILVAYAVSLFRRTRGL* |
| Ga0137374_100252014 | 3300012204 | Vadose Zone Soil | MPDVPQNAGYMVAAYIVTAVILLGYAVSLYRRTDKP* |
| Ga0137374_106126453 | 3300012204 | Vadose Zone Soil | VPEVPQNAGYMVAAYVVTAVVLVAYAVSLYRRSMKL* |
| Ga0137374_107220822 | 3300012204 | Vadose Zone Soil | VEDRVSEVPQNAGYMVAAYVVTAVILLGYAVSLYRRSMKL* |
| Ga0137374_109989262 | 3300012204 | Vadose Zone Soil | MPQNAGYMVAAYVVTAVILLAYAVSLYRRTNKPRL* |
| Ga0137362_101424074 | 3300012205 | Vadose Zone Soil | MPDVPQNAGYMVAAYIVTAVILLIYTISLHRRTAKP* |
| Ga0137380_1000001765 | 3300012206 | Vadose Zone Soil | VPDVPQDAGYMVAAYIVTAVILVAYAVSLYRRTEKP* |
| Ga0137380_100176483 | 3300012206 | Vadose Zone Soil | MSEGVPQNAGYLVAAYIVVPVILLTYALSLYRRATRP* |
| Ga0137380_101790492 | 3300012206 | Vadose Zone Soil | VPEVPQNGGYMVAAYIVTAVILLAYAFSLYRRTGKE* |
| Ga0137380_104137062 | 3300012206 | Vadose Zone Soil | MPDVPQNAGYMMAAYVVTAVILIAYAVSLYRRTSKP* |
| Ga0137380_112097922 | 3300012206 | Vadose Zone Soil | MPETIPQNAGYMVAAYIVTALVILAYAASLYRRTRGR* |
| Ga0137380_115961412 | 3300012206 | Vadose Zone Soil | MPEGVPQNAGYLVAAYILVPTILIAYAVSLYRRTNKP* |
| Ga0137380_117111722 | 3300012206 | Vadose Zone Soil | MSEGFPQNAGYMVAAYAVAAVVLVAYAVSLFRRTRGL* |
| Ga0137381_114434441 | 3300012207 | Vadose Zone Soil | VPEVPQNAGYMVAAYIVTAGILLAYAFSLYRRIGKE* |
| Ga0137376_100758602 | 3300012208 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRTNQS* |
| Ga0137379_109566432 | 3300012209 | Vadose Zone Soil | MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTGP* |
| Ga0137378_100314941 | 3300012210 | Vadose Zone Soil | DVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP* |
| Ga0137377_100575885 | 3300012211 | Vadose Zone Soil | VPEVPQNAGYMVAAYIVTAGILLAYAFSLYRRIGKL* |
| Ga0137377_102695182 | 3300012211 | Vadose Zone Soil | MAEGIPHNAGYLVAAYVVVPLILLAYAVSLYRRSTRP* |
| Ga0137377_110714262 | 3300012211 | Vadose Zone Soil | MPESIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR* |
| Ga0137377_119279501 | 3300012211 | Vadose Zone Soil | MPEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKL* |
| Ga0137370_100294932 | 3300012285 | Vadose Zone Soil | MPDVPRNAGYMVAAYIVTAVILLAYALSLYRRTAKP* |
| Ga0137387_100538662 | 3300012349 | Vadose Zone Soil | VPEVPQNAGYMVAAYIVTAVILLAYALSLYRRIGKL* |
| Ga0137372_100122107 | 3300012350 | Vadose Zone Soil | MPDAVPQNAGFMVAAYITTAVILVAYAVTLYRRTLKP* |
| Ga0137372_100456694 | 3300012350 | Vadose Zone Soil | LADVPQNAGYMVAAYVVTAVILLVYALSLYRRSNKP* |
| Ga0137372_100547842 | 3300012350 | Vadose Zone Soil | MPEGFPQNAGYMVAAYTVAAMILVAYAVSLFRRTRGL* |
| Ga0137372_104425322 | 3300012350 | Vadose Zone Soil | MPDVPQNAGYMVAAYIVTAVILLGYAVSLYRRADKP* |
| Ga0137386_100942402 | 3300012351 | Vadose Zone Soil | VPEVPQNGGYMVAAYIVTAVILLAYAFSLYRRIGKE* |
| Ga0137386_104514151 | 3300012351 | Vadose Zone Soil | MPETIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR* |
| Ga0137367_106201812 | 3300012353 | Vadose Zone Soil | VPEVPQNAGYMVAAYVVTAVILVAYAVSLYRRSTKL* |
| Ga0137366_101210994 | 3300012354 | Vadose Zone Soil | MPEVPQNAGYMMAAYAVTAVILIAYAVSLYRRTSKP* |
| Ga0137366_101692422 | 3300012354 | Vadose Zone Soil | LAEVPQNAGYMVAAYVVTAVILLVYALSLYRRGTKP* |
| Ga0137366_109639832 | 3300012354 | Vadose Zone Soil | MSETFPQNAGYMVAAYTVAAVILVAYAVTLFRRTRGL* |
| Ga0137369_100521152 | 3300012355 | Vadose Zone Soil | VPEVPQNAGYMVAAYVATAVILVAYAVSLYRRSMKL* |
| Ga0137369_102018152 | 3300012355 | Vadose Zone Soil | MSDVPHNAGYMVAAYVVTAVILVTYAVSLYRRTNKP* |
| Ga0137371_101815323 | 3300012356 | Vadose Zone Soil | MPEGFPQNAGYLVAAYTVAAVILIAYAVVLYRRTRGL* |
| Ga0137368_107617852 | 3300012358 | Vadose Zone Soil | MSDVPHNAGYMVVAYVVTAVILVTYAVSLYRRTNKP* |
| Ga0137385_103933372 | 3300012359 | Vadose Zone Soil | MPEVPQNAGYMMAAYVVTAVILIAYAVSLYRRTSRP* |
| Ga0137385_109163552 | 3300012359 | Vadose Zone Soil | VPEVPQNAGYMAAAYIVTAGILLAYAFSLYRRIGKL* |
| Ga0137361_100599064 | 3300012362 | Vadose Zone Soil | VPDVPQNAGYMVAAYVVTAVILLAYAISLHRRTAKP* |
| Ga0137361_103433332 | 3300012362 | Vadose Zone Soil | MSEVPQNASYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0134061_12059001 | 3300012399 | Grasslands Soil | MPEVPQNAGYMMAAYIVTGVILIAYAVSLYRRTSKP* |
| Ga0137358_100302864 | 3300012582 | Vadose Zone Soil | MAEGVPQNAAYLVAAYIAVPAILIAYAVSLYRRSKKL* |
| Ga0137398_100652022 | 3300012683 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRTNKS* |
| Ga0137398_101231714 | 3300012683 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVTYAVSLYRRTNQP* |
| Ga0137398_101685621 | 3300012683 | Vadose Zone Soil | MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSKP* |
| Ga0137397_1000628712 | 3300012685 | Vadose Zone Soil | MPENIPQNAGYMVAAYIVTAIIILAYAASLYRRTRGR* |
| Ga0137397_104817182 | 3300012685 | Vadose Zone Soil | MSEVPQNASYMVAAYVITAVILVGYAVSLYRRTNKP* |
| Ga0137396_102832371 | 3300012918 | Vadose Zone Soil | MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRRAKP* |
| Ga0137396_104078782 | 3300012918 | Vadose Zone Soil | MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRAAKP* |
| Ga0137394_100835625 | 3300012922 | Vadose Zone Soil | MSDVPHNAGYMVAAYVVTAMILVAYAVSLYRRSNKS* |
| Ga0137394_113328552 | 3300012922 | Vadose Zone Soil | MSEAVPQNAGYMVAAYIVAAVILVTYAISLYRRTRGL* |
| Ga0137413_118180392 | 3300012924 | Vadose Zone Soil | MPENIPQNAGYMVAAYIVTAVVLLTYALSLYRRTRGR* |
| Ga0137419_102382143 | 3300012925 | Vadose Zone Soil | MAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL* |
| Ga0137419_108634672 | 3300012925 | Vadose Zone Soil | MSDVPQNAGYMAAAYVVTAMILVAYAVSLYRRTTKP* |
| Ga0137419_109351822 | 3300012925 | Vadose Zone Soil | RVGGAPAMSDLPHNAGYMVAAYVVTAVILVAYAVSLYRRSSKS* |
| Ga0137416_101202823 | 3300012927 | Vadose Zone Soil | MPDVPQNAAYMAAAYVVTAVILVAYAVSLYRRTNKP* |
| Ga0137404_102655472 | 3300012929 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVVYAVSLYRRTNTP* |
| Ga0137404_108864781 | 3300012929 | Vadose Zone Soil | MPEGVPQNVGYLVAAYIAVPAILIAYAVSLYRRSKKL* |
| Ga0137404_117257681 | 3300012929 | Vadose Zone Soil | MPDVPQNAGYMVAAYIVTAVVLLTYALSLYRRTRGR* |
| Ga0153915_100522473 | 3300012931 | Freshwater Wetlands | MPEVPQNAGYTAAAYIVTAVILLGYAVSLYRRTTKP* |
| Ga0137410_106546272 | 3300012944 | Vadose Zone Soil | MSDVPQNAGYMAAAYVVTAVILFVYAVSLYRRTNKP* |
| Ga0134110_100035306 | 3300012975 | Grasslands Soil | MSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP* |
| Ga0134076_100112413 | 3300012976 | Grasslands Soil | MPEVPQNAGYMVAAYVVTAIILLAYAVSLYRRTGRP* |
| Ga0134076_101891752 | 3300012976 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLAYAVFLYRRTTHP* |
| Ga0134081_101452812 | 3300014150 | Grasslands Soil | MPDVPHNSGYMIAAYIVTAVILLGYALSLYRRTER* |
| Ga0134081_102014161 | 3300014150 | Grasslands Soil | MSQVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP* |
| Ga0134075_104159541 | 3300014154 | Grasslands Soil | PEVLQNGGYAVAAYIVTAAILLVYALTLHRRTRRR* |
| Ga0134078_101480322 | 3300014157 | Grasslands Soil | MSEVPQNAGYMTAAYIVTAVILIAYAVSLYRRTSKA* |
| Ga0134078_103490222 | 3300014157 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTNRP* |
| Ga0134078_105867232 | 3300014157 | Grasslands Soil | MPDVPRNAGYMVAAYVVTAVILVTYAVSLYRRSNQP* |
| Ga0137412_104737523 | 3300015242 | Vadose Zone Soil | AWVQPMAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL* |
| Ga0134073_100146473 | 3300015356 | Grasslands Soil | PDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD* |
| Ga0134089_100029021 | 3300015358 | Grasslands Soil | MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRTNKL* |
| Ga0134089_102510392 | 3300015358 | Grasslands Soil | MSDAVPQNAGYMVAAYIVAAVILVGYAVTLFRRTRGL* |
| Ga0134085_102382471 | 3300015359 | Grasslands Soil | ARRSPMPETFPHNAGYMVAAYTVAAVILVAYAVSLYRRTRNL* |
| Ga0132258_107360823 | 3300015371 | Arabidopsis Rhizosphere | LPEVPQNAGYMIAAYVVTAVILLAYVFLLGRRGRNL* |
| Ga0132258_111684141 | 3300015371 | Arabidopsis Rhizosphere | MPETVAQNGGYMVAAYIVTAVILVAYTIVLARRTGKKL* |
| Ga0132256_1005787613 | 3300015372 | Arabidopsis Rhizosphere | MPETVAQNGGYMVAAYIVTAVILVAYTIVLARRTGK |
| Ga0134112_100020143 | 3300017656 | Grasslands Soil | MPEVPQNAGYMVAAYVVTAIILLAYAVSLYRRTGRP |
| Ga0134074_10813812 | 3300017657 | Grasslands Soil | VPEGIPQNAGFMVAAYVTAAAILLGYALSLYRRTLKP |
| Ga0134083_100209973 | 3300017659 | Grasslands Soil | MGSVPAVPDVPKNAGYMVAAYVVTAVILLAYSISLYRRTGKP |
| Ga0134083_104368412 | 3300017659 | Grasslands Soil | VPEVPQNAGYMVAAYVVTAVILVAYAVSLYRRISKP |
| Ga0187779_105872911 | 3300017959 | Tropical Peatland | MAEGVPSNAGYMVAAYIAAAVILVGYALTLYRRSRHR |
| Ga0187776_104676962 | 3300017966 | Tropical Peatland | MPETIPQNGGYMVAAYIVAAVILVGYALSLYRRSR |
| Ga0184605_1000005814 | 3300018027 | Groundwater Sediment | VPDVPQNAGYMVAAYIVTAVILLVYAVSLSRRANRP |
| Ga0184634_100007569 | 3300018031 | Groundwater Sediment | MPEAGPANAGYMVAAYIAAAVILVSYAVLLYRRTRKL |
| Ga0184634_101977312 | 3300018031 | Groundwater Sediment | MPETVPANAGYMVAAYVVTAVILLSYAIALYRRTRKL |
| Ga0184634_102303502 | 3300018031 | Groundwater Sediment | MPETIPANGGYMVAAYVTVAVILVGYAVSLYRRTRKL |
| Ga0187765_107273111 | 3300018060 | Tropical Peatland | MAEGVPNNAGYMVAAYITAAVILVGYALSLYRRSRHR |
| Ga0184637_100072652 | 3300018063 | Groundwater Sediment | MPEAVPANAGYMVAAYIAAAVILVSYAVLLYRRTRKL |
| Ga0184618_100979983 | 3300018071 | Groundwater Sediment | MSDVPHNAGYMVAAYVVTAVILVAYAVSLYRRSNRS |
| Ga0184618_101656142 | 3300018071 | Groundwater Sediment | VPDVPQNGGYMVAAYIVTAVILLVYAVSLYRRANRP |
| Ga0184640_100747043 | 3300018074 | Groundwater Sediment | ASSWRRQGRWAMPETIPANGGYMVAAYVTVAVILVGYAVSLYRRTRKL |
| Ga0184640_102437622 | 3300018074 | Groundwater Sediment | MPETVPANAGYMVAAYVVTAAILLSYAIALYRRTRKL |
| Ga0066655_100005718 | 3300018431 | Grasslands Soil | MLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTKP |
| Ga0066655_100427734 | 3300018431 | Grasslands Soil | MPETFPHNAGYMVAAYTVAAVILVAYAVSLYLRSGNL |
| Ga0066655_100682583 | 3300018431 | Grasslands Soil | VPEVPQNAGYLVAAYVVTAVILLCYTFSLYRRSSKG |
| Ga0066655_100712822 | 3300018431 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRD |
| Ga0066655_100851221 | 3300018431 | Grasslands Soil | RRHMSEVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP |
| Ga0066655_102956333 | 3300018431 | Grasslands Soil | ATRSPGRGRRPPMPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL |
| Ga0066655_103664543 | 3300018431 | Grasslands Soil | MPDVPQNAGYMVAAYIVTAVILLIYAISLHRRTAKP |
| Ga0066655_104718032 | 3300018431 | Grasslands Soil | VPDVPHNAGYMVAAYVTTALILLAYACSLYRRAAKR |
| Ga0066655_113170791 | 3300018431 | Grasslands Soil | RGARMPDVPHNSGYMIAAYIVTAVILVGYAVSLYRRGEKR |
| Ga0066667_1000088715 | 3300018433 | Grasslands Soil | MPETFPHNAGYMVAAYTVAAVILVAYAVSLYRRTRNL |
| Ga0066667_100276633 | 3300018433 | Grasslands Soil | MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSARP |
| Ga0066667_100833633 | 3300018433 | Grasslands Soil | MADAPHNAGYMAAAYVATALILLAYAVSLYRRAARR |
| Ga0066667_102702322 | 3300018433 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTER |
| Ga0066667_103561632 | 3300018433 | Grasslands Soil | MSEVPQNAAYLVAAYIVVPVILLAYALSLYRRSTRP |
| Ga0066667_105358022 | 3300018433 | Grasslands Soil | MPESFPQNAGYMVAAYTVAAVILIAYAVSLFRRTRGL |
| Ga0066667_107603972 | 3300018433 | Grasslands Soil | MPDVPHNSGYMVAAYIVTAAILVGYALSLYRRSEKR |
| Ga0066667_110302072 | 3300018433 | Grasslands Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSTRP |
| Ga0066667_111377882 | 3300018433 | Grasslands Soil | MPDVPHNSGYMIAAYIVTAVILVGYAVSLYRRGEKR |
| Ga0066667_111844472 | 3300018433 | Grasslands Soil | MPDVPQNAGYMVAAYVVTAVILLVYAASLSRRSDKP |
| Ga0066662_100064197 | 3300018468 | Grasslands Soil | MGDQVPHNAGYLIAAYILVPTILIVYALSLYRRGQRP |
| Ga0066662_101272004 | 3300018468 | Grasslands Soil | MAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTRP |
| Ga0066662_101720113 | 3300018468 | Grasslands Soil | MSDAPHNAGYMAAAYVATALILLAYAVSLYRRAARR |
| Ga0066662_102355802 | 3300018468 | Grasslands Soil | VPEVPQNAGYLVAAYVVTAVILLGYTLSLYRRSSKG |
| Ga0066662_102964143 | 3300018468 | Grasslands Soil | VSEVPHNGAYMVAAYIVTAGILLGYALALYRRTRKP |
| Ga0066662_105513332 | 3300018468 | Grasslands Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRATRP |
| Ga0066662_112866422 | 3300018468 | Grasslands Soil | MSEVPQNSGYMMAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0066669_100018302 | 3300018482 | Grasslands Soil | MADIPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL |
| Ga0066669_100022033 | 3300018482 | Grasslands Soil | VPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP |
| Ga0066669_100996212 | 3300018482 | Grasslands Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSTRS |
| Ga0066669_101366462 | 3300018482 | Grasslands Soil | MPETFPHNAGYMVAAYTVAAVILVAYAVSRYRRTRNL |
| Ga0066669_101614282 | 3300018482 | Grasslands Soil | MSEAVPQNAGYMVAAYIIAAVILVTYAISLFRRTRGL |
| Ga0066669_102578183 | 3300018482 | Grasslands Soil | MPDVPQNAGYMVAAYIVTAVILLAYAVSLHRRTAKP |
| Ga0066669_118721752 | 3300018482 | Grasslands Soil | MSEVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP |
| Ga0137408_11880232 | 3300019789 | Vadose Zone Soil | MSEVPQNASYMMAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0193755_100022815 | 3300020004 | Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNQS |
| Ga0179594_100039804 | 3300020170 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSNKS |
| Ga0179594_100178373 | 3300020170 | Vadose Zone Soil | MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKL |
| Ga0179592_100258654 | 3300020199 | Vadose Zone Soil | MAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL |
| Ga0194121_101319453 | 3300020200 | Freshwater Lake | MNQEQATTGGYMVAAYLITAVILLGYFASLYRRGRR |
| Ga0215015_100393247 | 3300021046 | Soil | VPEVPQNAGYLAAAYVVTAVILLGYAVSLFRRLRRP |
| Ga0215015_101959472 | 3300021046 | Soil | MADVPQTGGYMVAAYVVTAVILLAYTLSLYLRTRRP |
| Ga0215015_107035777 | 3300021046 | Soil | VADVPQTGGYMVAAYVVTALILLAYALSLYRRTKRP |
| Ga0179596_100084033 | 3300021086 | Vadose Zone Soil | MAEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL |
| Ga0179596_102053312 | 3300021086 | Vadose Zone Soil | MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSNL |
| Ga0179596_102861462 | 3300021086 | Vadose Zone Soil | MSDVIPQNASYMVAAYIVTAIIVLAYAASLYRRTRGR |
| Ga0210408_104049161 | 3300021178 | Soil | MAEGVPQNAGYLIAAYIAVPAILIAYAVSLYRRSKKL |
| Ga0210409_102077722 | 3300021559 | Soil | MPEHIPQNAGYMVAAYIVTAIVLLTYAASLYRRTRGR |
| Ga0247669_10005427 | 3300024182 | Soil | MDSGVPQNAGYLIAAYILVPTILIAYAASLYRRSRRP |
| Ga0247680_10016137 | 3300024246 | Soil | MPENIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR |
| Ga0137417_11822353 | 3300024330 | Vadose Zone Soil | MRDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP |
| Ga0137417_13534561 | 3300024330 | Vadose Zone Soil | MSDLPHNAGYMVAAYVVTAVILVAYAVSLYRRSNKS |
| Ga0209619_102943562 | 3300025159 | Soil | MAEVPQNAGYMVAAYIATAVILVGYALSLYRRTTKL |
| Ga0209108_101813262 | 3300025165 | Soil | MVDGVPQNAGFMVAAYVVTAVILLAYAVSLYRRSRDS |
| Ga0207653_100274432 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP |
| Ga0207692_101524393 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSEVPQNAGYLIAAYILVPTILIAYAVSLYRRSRRP |
| Ga0207699_100200327 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDSGVPQNAGYLIAAYILVPTILIAYAVSLYRRSQRP |
| Ga0207684_100902534 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVPQNGGYAVAAYIVTAAILLGYALSLHRRRRR |
| Ga0207684_104027412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKQL |
| Ga0207646_112679042 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVLQNGGYMVAAYIVTAVILVAYAIVLARRTRNKHY |
| Ga0207646_114770282 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPESIPQNAGYMVAAYIVTAIIVLAYAASLYRRTRGR |
| Ga0207665_100129406 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDVPQNAGYMVAAYVVTAVILVAYAISLYRRSYKS |
| Ga0209350_10045352 | 3300026277 | Grasslands Soil | MAEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP |
| Ga0209350_10169352 | 3300026277 | Grasslands Soil | MPEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0209350_10248542 | 3300026277 | Grasslands Soil | VSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0209350_11556132 | 3300026277 | Grasslands Soil | MSEVPQNAGYLVAAYIMVPVILLAYAVSLYRRSARP |
| Ga0209350_11615261 | 3300026277 | Grasslands Soil | RGSTPTMPDVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP |
| Ga0209234_10018455 | 3300026295 | Grasslands Soil | MSEGVPQNAAYLAAAYIVVPLILLAYAVSLYRRSTRP |
| Ga0209234_10185282 | 3300026295 | Grasslands Soil | MSEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRSTRP |
| Ga0209234_10307153 | 3300026295 | Grasslands Soil | MSEGIPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP |
| Ga0209234_13073061 | 3300026295 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLAYAVSLYRRTERR |
| Ga0209234_13087212 | 3300026295 | Grasslands Soil | MPEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRSTRP |
| Ga0209235_100042216 | 3300026296 | Grasslands Soil | MPDVPQNGGYMVAAYIVTAVILLGYALSLYRRTNKL |
| Ga0209235_100044311 | 3300026296 | Grasslands Soil | VPDVPHNAGYMVAAYVTTALILLAYACSLYRRAAQR |
| Ga0209235_10045078 | 3300026296 | Grasslands Soil | VPEVPQNAGYLVAAYIVTAVILLGYTLSLYRRSSKG |
| Ga0209235_10046102 | 3300026296 | Grasslands Soil | MPDVPQNTGYMVAAYVVTAVILVAYAVSLYRRTNKP |
| Ga0209235_10383883 | 3300026296 | Grasslands Soil | MPDVPQNAGYMVAAYIVTAVILLVYAISLHRRTAKP |
| Ga0209235_10473343 | 3300026296 | Grasslands Soil | VPDAPHNAGYMVAAYITTALILVAYAFSLYRRAAKR |
| Ga0209235_10634644 | 3300026296 | Grasslands Soil | MTEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF |
| Ga0209235_11038752 | 3300026296 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKRD |
| Ga0209235_11159322 | 3300026296 | Grasslands Soil | VPDAPHNAGYMVAAYVTTALILLAYAFSLYRRTAKR |
| Ga0209235_11505272 | 3300026296 | Grasslands Soil | VPDAPHNAGYMVAAYVTTALILLAYACSLYRRAAKR |
| Ga0209235_11752052 | 3300026296 | Grasslands Soil | MAEGVPQNAGYLVAAYIAVPAILIAYAVSLYRRSKKF |
| Ga0209237_10073963 | 3300026297 | Grasslands Soil | VPEVPQNAGYLVAAYVVTAVILLGYTFSLYRRSSKG |
| Ga0209237_10130445 | 3300026297 | Grasslands Soil | MPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKL |
| Ga0209237_10305005 | 3300026297 | Grasslands Soil | MSEGVPQNAGYLVAAYIVVPVILLTYAVSLYRRATRP |
| Ga0209237_11183392 | 3300026297 | Grasslands Soil | MSEVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0209236_10173467 | 3300026298 | Grasslands Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTEKR |
| Ga0209238_10101355 | 3300026301 | Grasslands Soil | MGSTPIMPDVPRNAAYMVAAYIVTAVILLAYALSLYRRTAKP |
| Ga0209238_10311551 | 3300026301 | Grasslands Soil | MPDVPHNSGYMVAAYIVTAAILVGYAVSLYRRSNRP |
| Ga0209238_10372002 | 3300026301 | Grasslands Soil | MSEGLPQNAGYLVAAYVVVPLILLAYAVSLYRRSTRP |
| Ga0209238_11430142 | 3300026301 | Grasslands Soil | MPDVPHNGGYMIAAYIVTAVILLGYALSLYRRTARR |
| Ga0209238_11791682 | 3300026301 | Grasslands Soil | MSEGFPQNAGYMVAAYAVAAVILVAYAVSLWRRTRG |
| Ga0209238_12013882 | 3300026301 | Grasslands Soil | VPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR |
| Ga0209240_10417114 | 3300026304 | Grasslands Soil | VRLMAEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL |
| Ga0209688_10882352 | 3300026305 | Soil | MSEGVPQNAGYLVAAYIVVPVMLLAYAVSLYRRSTRS |
| Ga0209468_10024355 | 3300026306 | Soil | MSEGFPHNAGYMVAAYTVAAVILVAYAVTLWRRTRGL |
| Ga0209468_10047184 | 3300026306 | Soil | MPDVPQNGGYMVAAYIVTAVILLGYAVSLYRRTNKP |
| Ga0209468_10268714 | 3300026306 | Soil | MSEVPQNAGYMMAAYIVTAVILLAYAVSLYRRTSK |
| Ga0209468_11916852 | 3300026306 | Soil | SRAGARRPAMSEVPQNAGYMMAAYIVTAVILIGYAVSLYRRTSKP |
| Ga0209469_100069114 | 3300026307 | Soil | MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRAKQP |
| Ga0209469_11329242 | 3300026307 | Soil | MSEVPQNAGYMTAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0209055_100040526 | 3300026309 | Soil | MPDVPHNGGYMVAAYIVTAVILLAYAVSLYRRTERRD |
| Ga0209055_100077728 | 3300026309 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYAISLYRRTGKP |
| Ga0209055_11448492 | 3300026309 | Soil | MPEIIPQNAGYMTAAYIVAAAILLGYAGALWRRTRGR |
| Ga0209239_10649432 | 3300026310 | Grasslands Soil | MSEGIPQNAGYLAAAYVLVPLILLAYAVSLYRRGTRP |
| Ga0209239_11163182 | 3300026310 | Grasslands Soil | MADVPQNAGYMVAAYIVTAVILLGYAVSLGRRSRNL |
| Ga0209239_12152492 | 3300026310 | Grasslands Soil | MAEGVPQNAAYLAAAYIVVPLILLAYAVSLYRRSTRP |
| Ga0209153_10059655 | 3300026312 | Soil | MSEVPRNAAYLVAAYIVVPVILLAYALSLYRRSTRP |
| Ga0209761_12847012 | 3300026313 | Grasslands Soil | SRGSTPTMPDVPQNAGYMVAAYIVTAVILLIYAISLHRRTAKP |
| Ga0209268_10036859 | 3300026314 | Soil | MPDVPQNAGYMVAAYVVTAVILLAYAVSLDRRTAKP |
| Ga0209268_10707992 | 3300026314 | Soil | MRSRGRAKELNMSEAVPQNAGYMVAAYIIAAVILVTYAISLFRRTRGL |
| Ga0209268_11813512 | 3300026314 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTNRP |
| Ga0209154_11017123 | 3300026317 | Soil | VADAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR |
| Ga0209471_10454413 | 3300026318 | Soil | MPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP |
| Ga0209471_10468374 | 3300026318 | Soil | ADAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR |
| Ga0209471_10907151 | 3300026318 | Soil | RLPMSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSRS |
| Ga0209471_13106741 | 3300026318 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTERRG |
| Ga0209472_100107011 | 3300026323 | Soil | MSEVPQNAGYMMAAYIVTAVILLAYAVSLYRRTSKP |
| Ga0209470_11520612 | 3300026324 | Soil | MSEVPENAGYMMAAYIVTAVILIAYAVSLYRRTGKP |
| Ga0209470_12988921 | 3300026324 | Soil | MLEVPQNGGYMVAAYVVTAVILLGYALSLYRRTTK |
| Ga0209152_100863193 | 3300026325 | Soil | VPDTPHNAGYMIAAYITTALILVAYAFSLYRRAAKR |
| Ga0209801_10250691 | 3300026326 | Soil | GSVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP |
| Ga0209802_100017339 | 3300026328 | Soil | MPEVPHNAGYMAAAYIVTAVILLGYAFSLYRRSTRR |
| Ga0209802_10168152 | 3300026328 | Soil | VPDVPQNAGYMVAAYVVTAVILLAYAISLHRRTAKP |
| Ga0209375_10074582 | 3300026329 | Soil | MSETFPQNAGYMVAAYTVAAVILVAYAVTLWRRTRGL |
| Ga0209375_10143351 | 3300026329 | Soil | MSEGFPHNAGYMVAAYTVAAVILVAYAVTLFRRTRGL |
| Ga0209803_12358502 | 3300026332 | Soil | MPDVPHNGGYMVAAYIVTAVILLGYALSLYRRTQR |
| Ga0209804_11164411 | 3300026335 | Soil | ISAVVPDAPHNAGYMVAAYVTTALILVAYAFSLYRRTAKR |
| Ga0209804_12567191 | 3300026335 | Soil | MPETFPHNAGYMIAAYTVAAVILVAYALSLYRRTRG |
| Ga0257166_10177702 | 3300026358 | Soil | MPEVVAQNGGYMVAAYIVTAVILVAYTIVLARRTRNKHY |
| Ga0209808_10042738 | 3300026523 | Soil | MPDVPHNGAYMVAAYIVTAVILLGYALSLYRRANKP |
| Ga0209690_10004016 | 3300026524 | Soil | MPDVPHNGGYMVAAYIVVTAVILLGYALSLYRRTERR |
| Ga0209059_11091942 | 3300026527 | Soil | MPDVPHNGGYMIAAYMVTAVILVGYALSLYRRGEKR |
| Ga0209378_10211556 | 3300026528 | Soil | MPDVPQNGAYMVAAYIVTAVILLGYALSLYRRAKQP |
| Ga0209157_10929163 | 3300026537 | Soil | MQLMPEGVPQNAGYLMAAYILVPTILIAYAVSLYRRTNKP |
| Ga0209157_10938403 | 3300026537 | Soil | MPEVPQNGGYAVAAYIVTAVILVSYALSLHRRTRR |
| Ga0209056_1000021810 | 3300026538 | Soil | MSDGVPQNAGYLVAAYIVVPVILLAYAVSLYRRATRP |
| Ga0209376_10226034 | 3300026540 | Soil | MSEGVPQNAGYLVAAYIVVPVILLAYAVSLYRRSRS |
| Ga0209376_11335243 | 3300026540 | Soil | MGSVPAVPDVPQNAGYMVAAYVVTAVILLAYSISLYRRTGKP |
| Ga0209161_102498692 | 3300026548 | Soil | MSDAVPQNAGYMVAAYIVAAVILVTYAVTLWRRTRGL |
| Ga0209648_100084699 | 3300026551 | Grasslands Soil | VPEVPQNAGYLAAAYMVTAAILLGYAWSLYRRARQP |
| Ga0209648_100140294 | 3300026551 | Grasslands Soil | MADVPLTGGYMVAAYVVTAVILLAYTLSLYLRTRRP |
| Ga0209648_100253404 | 3300026551 | Grasslands Soil | VADVPQTGGYMVAAYVVTALILLAYAVSLYRRAKRP |
| Ga0209648_100595532 | 3300026551 | Grasslands Soil | MPDVPQNAGYMMAAYIVTAIILIAYAVSLYRRTSKP |
| Ga0209648_101470483 | 3300026551 | Grasslands Soil | VAEVPQNAGYLAAAYVVTAVVLVAYAVSLYRRLRRP |
| Ga0209648_101561322 | 3300026551 | Grasslands Soil | MPESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR |
| Ga0209648_103983582 | 3300026551 | Grasslands Soil | MAEGVPQNAGYLLAAYTAVPAILIAYAVSLYRRSKKL |
| Ga0209577_107282412 | 3300026552 | Soil | MAEGVPQNAGYLVAAYSVVPVILLAYAVSLYRRSTR |
| Ga0179587_101036833 | 3300026557 | Vadose Zone Soil | VQPMAEGVPQNVGYLVAAYIVVPAILIAYAVSLYRRSKKL |
| Ga0209845_10342692 | 3300027324 | Groundwater Sand | MAEVPQNTEYMVAAYIATAVILLGYALSLYRRTTKL |
| Ga0209213_10436172 | 3300027383 | Forest Soil | TMPDVPQNAGYMAAAYIVTAVILLGYAISLYRRTAKP |
| Ga0209220_100008232 | 3300027587 | Forest Soil | MPETVPANAGYMVAAYTAAALILVGYAVLLYRRTRKL |
| Ga0208988_11039092 | 3300027633 | Forest Soil | MSDVPQNAGYMVAAYIVTAVILLAYAVSLYRRTEKP |
| Ga0209076_10384873 | 3300027643 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILVAYAVSLYRRSSKS |
| Ga0209076_11511072 | 3300027643 | Vadose Zone Soil | MPETFPHNAGYMIAAYTVAAVVLVVYAVSLYRRTKGL |
| Ga0209588_10194263 | 3300027671 | Vadose Zone Soil | MTEGVPQNAGYLLAAYIAVPAILIAYAVSLYRRSKKL |
| Ga0209178_10915532 | 3300027725 | Agricultural Soil | MAEVPQNAGYMVAAYIVTAVIVLGYAVSLVRRSRNL |
| Ga0209178_10923882 | 3300027725 | Agricultural Soil | MPDVPHNAGYMAAAYILTAVILLAYTISLYRRSDRR |
| Ga0209178_12141552 | 3300027725 | Agricultural Soil | MGDTVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP |
| Ga0209178_12363822 | 3300027725 | Agricultural Soil | MGDTVPQNAGYLMAAYILVPTILIAYAVSLYRRSRNP |
| Ga0209689_100037018 | 3300027748 | Soil | MPETFPHNAGYMIAAYTVAAVILVAYALSLYRRTRGL |
| Ga0209074_101578121 | 3300027787 | Agricultural Soil | MPEGIPQNAGYMVAAYIVTAIIVLVYAASLYRRTRGR |
| Ga0209074_101579032 | 3300027787 | Agricultural Soil | MDSGVPQNAGYLMAAYILVPTILIAYAVSLYRRSRRP |
| Ga0209180_100212615 | 3300027846 | Vadose Zone Soil | MSDVPQNAGYMVAAYVVTAVILLAYAVSLYRRANKS |
| Ga0209701_100283346 | 3300027862 | Vadose Zone Soil | VPDAPHNAGYMVAAYVTTALILLAYACSLYRRAAKH |
| Ga0209701_103463312 | 3300027862 | Vadose Zone Soil | MPDVPQNAGYMMAAYIVTAVILIAYAVSLYRRTSKP |
| Ga0209814_100015753 | 3300027873 | Populus Rhizosphere | MPDVPQNAGYMMAAYIVTAVILLGYAVSLYRRTSKP |
| Ga0209465_103689351 | 3300027874 | Tropical Forest Soil | LNETVPQTGSYMVAAYIVTAVILVAYAILLARRTGNRHN |
| Ga0209283_100083617 | 3300027875 | Vadose Zone Soil | VADVPQTGGYMVAAYVVTALILLAYAVSLYRRTKRP |
| Ga0209590_100013067 | 3300027882 | Vadose Zone Soil | VPEVPQNAGYLVAAYIVTAVILLGYTFSLYRRSSKG |
| Ga0209590_100346284 | 3300027882 | Vadose Zone Soil | MSETFPHNAGYMIAAYTVAAVILVAYAVLLYRRTRGL |
| Ga0209488_111203241 | 3300027903 | Vadose Zone Soil | MSESIPQNAGYMVAAYIVTAIVLLSYALSLYRRTRGR |
| Ga0209858_10143741 | 3300027948 | Groundwater Sand | MAEVPQNAEYMVAAYIATAVILLGYALSLYRRTTKL |
| Ga0137415_100179103 | 3300028536 | Vadose Zone Soil | MPETFPHNAGYMIAAYTVAAVILVVYAVSLYRRTKGL |
| Ga0137415_101405152 | 3300028536 | Vadose Zone Soil | VGSAPAMSDVPQNAGYMAAAYVVTAVILVAYAVSLYRRTNKP |
| Ga0307504_102076642 | 3300028792 | Soil | MPDLPQNAGYMVAAYVLTAVILIAYAVSLYRRSKQH |
| Ga0299907_106527732 | 3300030006 | Soil | MPEGVPQNAGYMIAAYIVASTLLVAYAVSLYIRIRNLR |
| Ga0307501_100330822 | 3300031152 | Soil | MPDVPQNSGYMVAAYIVTAVILLAYAVSLYRRTEKP |
| Ga0308194_100375372 | 3300031421 | Soil | VPDVPQNAGYMVAAYIVTAVILLVYAVSLYRRANRP |
| Ga0307469_1000054118 | 3300031720 | Hardwood Forest Soil | MGDQVPQNAGYLMAAYILVPTILIAYAVSLYRRSKGP |
| Ga0307469_100036564 | 3300031720 | Hardwood Forest Soil | MSDVPHNAGYMVAAYVVTAVILVTYAVSLYRRTNKP |
| Ga0307469_100565214 | 3300031720 | Hardwood Forest Soil | MGDSVPQNAGYLIAAYILVPTILIAYAVSLYRRSRNP |
| Ga0307469_100805781 | 3300031720 | Hardwood Forest Soil | LRMSPEVVPQNAGYMVAAYIVAAVILVAYAVTLWRRTRGL |
| Ga0307469_103001651 | 3300031720 | Hardwood Forest Soil | MDSGVPQNAGYLIAAYILVPTILITYAVSLYRRSRRP |
| Ga0307469_105065062 | 3300031720 | Hardwood Forest Soil | MAEGPANGGYMVAAYVAAAVILVAYALILYNRTRNL |
| Ga0307469_107718503 | 3300031720 | Hardwood Forest Soil | MSPDAVPQNAGYMVAAYIVAAVILVAYAVTLWRRTRG |
| Ga0307469_111771202 | 3300031720 | Hardwood Forest Soil | MSDVPQNAGYMMAAYIVTAIILIAYVVSLYRRTRNL |
| Ga0307469_114652272 | 3300031720 | Hardwood Forest Soil | MAEGVPQNTGYLVAAYIAVPAILIAYAVSLYRRSKQL |
| Ga0307468_1004258162 | 3300031740 | Hardwood Forest Soil | MGDSVPQNAGYLMAAYILVPTILIAYAVSLYRRSRNP |
| Ga0307477_103942113 | 3300031753 | Hardwood Forest Soil | MPDVPQNAGYMMAAYIVTAIILIAYVVSLYRRTRNL |
| Ga0307473_100703002 | 3300031820 | Hardwood Forest Soil | MAEGVPQNAGYLVAAYIAVPAILLAYAVSLYRRSKQL |
| Ga0214473_100387057 | 3300031949 | Soil | VTPEIVPATGSYMVAAYIVAAVILVVYAIVLSRRSRRD |
| Ga0307479_102127952 | 3300031962 | Hardwood Forest Soil | MAEVPQNAGYMAAAYVVTATILLGYALSLYRRARRP |
| Ga0307479_104031202 | 3300031962 | Hardwood Forest Soil | MAEGVPQNAGYLVAAYSLVPVILLAYAVSLYRRSTRP |
| Ga0307479_106859392 | 3300031962 | Hardwood Forest Soil | MGDVPQTGGYMVAAYIVTAGILLGYAISLYRRTQRL |
| Ga0307471_1007094263 | 3300032180 | Hardwood Forest Soil | MSPDAVPQNAGYMVAAYIVAAVILVAYAVTLWRRTRGL |
| Ga0307471_1016480892 | 3300032180 | Hardwood Forest Soil | MDNAVPQNTSYLIAAYILVPTILIGYALSLYRRSLRP |
| Ga0307471_1020192512 | 3300032180 | Hardwood Forest Soil | MSDVPHNAGYMVAAYVVTAVILVAYAVSLYRRSNKS |
| Ga0315286_120915401 | 3300032342 | Sediment | SDAVPQTGSYMVAAYIAAAAILLGYAIVLARRARRS |
| Ga0335085_1000113226 | 3300032770 | Soil | MPDTMPQNGAYMVAAYIDAAVILLVYALFLFRRSRRSS |
| Ga0335085_100018124 | 3300032770 | Soil | MPDAIPQNGGYMVAAYVVAAVILVVYALSLYRRSR |
| Ga0335085_105404732 | 3300032770 | Soil | MPEAVPQNGAYMVAAYIDAAVILLVYALTLFRRSRRPS |
| Ga0335078_101703083 | 3300032805 | Soil | MPEGVPANSGYMVAAYIVAAVILVGYALLLARRSGKL |
| Ga0335078_108344993 | 3300032805 | Soil | MPEGVPANGGYMVAAYIVAAVILVSYALFLARRSGKF |
| Ga0335070_101636632 | 3300032829 | Soil | MAEGVPNNAGYMVAAYIMAAVILVGYALSLYRRSRHR |
| Ga0335084_102308262 | 3300033004 | Soil | MPETVPQNGAYMVAAYIDAAVILLVYALTLFRRSRRPS |
| Ga0214472_104681253 | 3300033407 | Soil | VEPVPEIVPANAGYMVAAYIVTAVILLSYTVAMLRRGSASKH |
| Ga0214472_108039212 | 3300033407 | Soil | MPETVPANAGYMIAAYTVAAVILLSYAVLLFRRTRKL |
| Ga0314862_0039464_773_889 | 3300033803 | Peatland | MPETMPQNGAFMVAAYIDAAVILLVYALFLFRRSRRSS |
| Ga0314867_128123_1_111 | 3300033808 | Peatland | AEGVPSNAGYMVAAYIAAAVILVGYALTLYRRSRHR |
| ⦗Top⦘ |