| Basic Information | |
|---|---|
| Family ID | F002262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 577 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VFFFWLVVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Number of Associated Samples | 330 |
| Number of Associated Scaffolds | 577 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.28 % |
| % of genes near scaffold ends (potentially truncated) | 1.56 % |
| % of genes from short scaffolds (< 2000 bps) | 3.12 % |
| Associated GOLD sequencing projects | 309 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (95.147 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (18.024 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.156 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.953 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 14.29% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 577 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 3.12 |
| PF01872 | RibD_C | 1.91 |
| PF00171 | Aldedh | 1.56 |
| PF04672 | Methyltransf_19 | 1.56 |
| PF00196 | GerE | 1.04 |
| PF00441 | Acyl-CoA_dh_1 | 1.04 |
| PF03176 | MMPL | 1.04 |
| PF13671 | AAA_33 | 1.04 |
| PF07883 | Cupin_2 | 1.04 |
| PF01243 | Putative_PNPOx | 1.04 |
| PF13088 | BNR_2 | 0.87 |
| PF08240 | ADH_N | 0.87 |
| PF00106 | adh_short | 0.87 |
| PF13561 | adh_short_C2 | 0.69 |
| PF01636 | APH | 0.69 |
| PF03704 | BTAD | 0.69 |
| PF06441 | EHN | 0.69 |
| PF00903 | Glyoxalase | 0.69 |
| PF13466 | STAS_2 | 0.69 |
| PF08897 | DUF1841 | 0.69 |
| PF00933 | Glyco_hydro_3 | 0.69 |
| PF07366 | SnoaL | 0.69 |
| PF03551 | PadR | 0.52 |
| PF00144 | Beta-lactamase | 0.52 |
| PF02518 | HATPase_c | 0.52 |
| PF13193 | AMP-binding_C | 0.52 |
| PF00085 | Thioredoxin | 0.52 |
| PF13546 | DDE_5 | 0.52 |
| PF12697 | Abhydrolase_6 | 0.52 |
| PF05977 | MFS_3 | 0.52 |
| PF00732 | GMC_oxred_N | 0.52 |
| PF02826 | 2-Hacid_dh_C | 0.52 |
| PF04978 | DUF664 | 0.52 |
| PF00248 | Aldo_ket_red | 0.52 |
| PF01047 | MarR | 0.52 |
| PF02627 | CMD | 0.35 |
| PF04993 | TfoX_N | 0.35 |
| PF12680 | SnoaL_2 | 0.35 |
| PF13602 | ADH_zinc_N_2 | 0.35 |
| PF01522 | Polysacc_deac_1 | 0.35 |
| PF02771 | Acyl-CoA_dh_N | 0.35 |
| PF01740 | STAS | 0.35 |
| PF00005 | ABC_tran | 0.35 |
| PF00801 | PKD | 0.35 |
| PF01850 | PIN | 0.35 |
| PF00067 | p450 | 0.35 |
| PF04909 | Amidohydro_2 | 0.35 |
| PF01053 | Cys_Met_Meta_PP | 0.35 |
| PF01545 | Cation_efflux | 0.35 |
| PF08281 | Sigma70_r4_2 | 0.35 |
| PF04542 | Sigma70_r2 | 0.35 |
| PF00557 | Peptidase_M24 | 0.35 |
| PF00012 | HSP70 | 0.35 |
| PF11774 | Lsr2 | 0.35 |
| PF12840 | HTH_20 | 0.35 |
| PF00198 | 2-oxoacid_dh | 0.35 |
| PF02909 | TetR_C_1 | 0.35 |
| PF07859 | Abhydrolase_3 | 0.35 |
| PF00440 | TetR_N | 0.35 |
| PF12647 | RNHCP | 0.35 |
| PF00486 | Trans_reg_C | 0.35 |
| PF08031 | BBE | 0.35 |
| PF13692 | Glyco_trans_1_4 | 0.35 |
| PF07858 | LEH | 0.35 |
| PF13649 | Methyltransf_25 | 0.35 |
| PF00753 | Lactamase_B | 0.35 |
| PF12172 | DUF35_N | 0.35 |
| PF07690 | MFS_1 | 0.35 |
| PF03773 | ArsP_1 | 0.35 |
| PF01609 | DDE_Tnp_1 | 0.35 |
| PF13581 | HATPase_c_2 | 0.35 |
| PF07676 | PD40 | 0.35 |
| PF04545 | Sigma70_r4 | 0.35 |
| PF02913 | FAD-oxidase_C | 0.35 |
| PF00501 | AMP-binding | 0.17 |
| PF13412 | HTH_24 | 0.17 |
| PF00850 | Hist_deacetyl | 0.17 |
| PF13439 | Glyco_transf_4 | 0.17 |
| PF00155 | Aminotran_1_2 | 0.17 |
| PF13472 | Lipase_GDSL_2 | 0.17 |
| PF07704 | PSK_trans_fac | 0.17 |
| PF00578 | AhpC-TSA | 0.17 |
| PF00156 | Pribosyltran | 0.17 |
| PF13545 | HTH_Crp_2 | 0.17 |
| PF06071 | YchF-GTPase_C | 0.17 |
| PF13087 | AAA_12 | 0.17 |
| PF01494 | FAD_binding_3 | 0.17 |
| PF02371 | Transposase_20 | 0.17 |
| PF00392 | GntR | 0.17 |
| PF02668 | TauD | 0.17 |
| PF04023 | FeoA | 0.17 |
| PF05988 | DUF899 | 0.17 |
| PF03575 | Peptidase_S51 | 0.17 |
| PF00480 | ROK | 0.17 |
| PF08241 | Methyltransf_11 | 0.17 |
| PF12893 | Lumazine_bd_2 | 0.17 |
| PF00291 | PALP | 0.17 |
| PF07927 | HicA_toxin | 0.17 |
| PF14310 | Fn3-like | 0.17 |
| PF01425 | Amidase | 0.17 |
| PF03358 | FMN_red | 0.17 |
| PF03029 | ATP_bind_1 | 0.17 |
| PF11258 | DUF3048 | 0.17 |
| PF00561 | Abhydrolase_1 | 0.17 |
| PF04149 | DUF397 | 0.17 |
| PF00756 | Esterase | 0.17 |
| PF05239 | PRC | 0.17 |
| PF02579 | Nitro_FeMo-Co | 0.17 |
| PF08545 | ACP_syn_III | 0.17 |
| PF00805 | Pentapeptide | 0.17 |
| PF13305 | TetR_C_33 | 0.17 |
| PF13302 | Acetyltransf_3 | 0.17 |
| PF00270 | DEAD | 0.17 |
| PF02698 | DUF218 | 0.17 |
| PF02583 | Trns_repr_metal | 0.17 |
| PF13714 | PEP_mutase | 0.17 |
| PF13377 | Peripla_BP_3 | 0.17 |
| PF00890 | FAD_binding_2 | 0.17 |
| PF12706 | Lactamase_B_2 | 0.17 |
| PF03243 | MerB | 0.17 |
| PF13460 | NAD_binding_10 | 0.17 |
| PF04679 | DNA_ligase_A_C | 0.17 |
| PF08352 | oligo_HPY | 0.17 |
| PF13601 | HTH_34 | 0.17 |
| PF13281 | MAP3K_TRAF_bd | 0.17 |
| PF03881 | Fructosamin_kin | 0.17 |
| PF14378 | PAP2_3 | 0.17 |
| PF13802 | Gal_mutarotas_2 | 0.17 |
| PF13191 | AAA_16 | 0.17 |
| PF00293 | NUDIX | 0.17 |
| PF00676 | E1_dh | 0.17 |
| PF05199 | GMC_oxred_C | 0.17 |
| PF14333 | DUF4389 | 0.17 |
| PF13659 | Obsolete Pfam Family | 0.17 |
| PF03992 | ABM | 0.17 |
| PF03069 | FmdA_AmdA | 0.17 |
| PF00355 | Rieske | 0.17 |
| PF13344 | Hydrolase_6 | 0.17 |
| PF00227 | Proteasome | 0.17 |
| PF02687 | FtsX | 0.17 |
| PF01988 | VIT1 | 0.17 |
| PF04073 | tRNA_edit | 0.17 |
| PF13669 | Glyoxalase_4 | 0.17 |
| PF09445 | Methyltransf_15 | 0.17 |
| PF04248 | NTP_transf_9 | 0.17 |
| PF10415 | FumaraseC_C | 0.17 |
| PF12802 | MarR_2 | 0.17 |
| PF00534 | Glycos_transf_1 | 0.17 |
| PF01475 | FUR | 0.17 |
| PF14417 | MEDS | 0.17 |
| PF05598 | DUF772 | 0.17 |
| PF13483 | Lactamase_B_3 | 0.17 |
| PF16124 | RecQ_Zn_bind | 0.17 |
| PF13180 | PDZ_2 | 0.17 |
| PF08922 | DUF1905 | 0.17 |
| PF04226 | Transgly_assoc | 0.17 |
| PF02720 | DUF222 | 0.17 |
| PF04229 | GrpB | 0.17 |
| PF01695 | IstB_IS21 | 0.17 |
| PF13229 | Beta_helix | 0.17 |
| PF07077 | DUF1345 | 0.17 |
| PF13751 | DDE_Tnp_1_6 | 0.17 |
| PF06197 | DUF998 | 0.17 |
| PF08433 | KTI12 | 0.17 |
| PF10604 | Polyketide_cyc2 | 0.17 |
| PF01039 | Carboxyl_trans | 0.17 |
| COG ID | Name | Functional Category | % Frequency in 577 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.12 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.91 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.91 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.56 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.56 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.56 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.39 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 1.04 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 1.04 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.69 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.69 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.69 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.69 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.69 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.69 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.52 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.52 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.52 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.52 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.52 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.52 |
| COG3631 | Ketosteroid isomerase-related protein | General function prediction only [R] | 0.35 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.35 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.35 |
| COG4308 | Limonene-1,2-epoxide hydrolase LimA/EphG | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.35 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.35 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.35 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 0.35 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.35 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.35 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.35 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.35 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.35 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.35 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.35 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.35 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.35 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.35 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.35 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.35 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.35 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.35 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.35 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.35 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.35 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.35 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.35 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.35 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.35 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.35 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.35 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.35 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.35 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.35 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.17 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 0.17 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.17 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.17 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.17 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.17 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.17 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.17 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.17 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.17 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.17 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.17 |
| COG4088 | tRNA uridine 5-carbamoylmethylation protein Kti12 (Killer toxin insensitivity protein) | Translation, ribosomal structure and biogenesis [J] | 0.17 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.17 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.17 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.17 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.17 |
| COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.17 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.17 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.17 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.17 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.17 |
| COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.17 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.17 |
| COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.17 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.17 |
| COG3001 | Fructosamine-3-kinase | Carbohydrate transport and metabolism [G] | 0.17 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.17 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.17 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.17 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.17 |
| COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.17 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.17 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.17 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.17 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.17 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.17 |
| COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.17 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 95.15 % |
| All Organisms | root | All Organisms | 4.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003659|JGI25404J52841_10000268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6611 | Open in IMG/M |
| 3300005327|Ga0070658_10509780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1040 | Open in IMG/M |
| 3300005329|Ga0070683_100081047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3038 | Open in IMG/M |
| 3300005332|Ga0066388_107131629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 562 | Open in IMG/M |
| 3300006028|Ga0070717_10504146 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300006059|Ga0075017_100036596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3254 | Open in IMG/M |
| 3300009090|Ga0099827_10015992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 5062 | Open in IMG/M |
| 3300009148|Ga0105243_12343799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300009698|Ga0116216_10222318 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300010046|Ga0126384_10204984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1564 | Open in IMG/M |
| 3300010152|Ga0126318_11112821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300010358|Ga0126370_10018910 | All Organisms → cellular organisms → Bacteria | 3919 | Open in IMG/M |
| 3300010361|Ga0126378_10138148 | Not Available | 2465 | Open in IMG/M |
| 3300010361|Ga0126378_10481386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1356 | Open in IMG/M |
| 3300010371|Ga0134125_10925342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 957 | Open in IMG/M |
| 3300010376|Ga0126381_100000200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 66372 | Open in IMG/M |
| 3300010398|Ga0126383_10462192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 1321 | Open in IMG/M |
| 3300011107|Ga0151490_1067539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1792 | Open in IMG/M |
| 3300012199|Ga0137383_10280255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1221 | Open in IMG/M |
| 3300012210|Ga0137378_10064751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3310 | Open in IMG/M |
| 3300013306|Ga0163162_13002256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 542 | Open in IMG/M |
| 3300013307|Ga0157372_13398197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 506 | Open in IMG/M |
| 3300021374|Ga0213881_10000367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 30780 | Open in IMG/M |
| 3300021560|Ga0126371_11944467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans → Jatrophihabitans telluris | 707 | Open in IMG/M |
| 3300027846|Ga0209180_10018119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3704 | Open in IMG/M |
| 3300027846|Ga0209180_10475848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300028800|Ga0265338_10000765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 54848 | Open in IMG/M |
| 3300031778|Ga0318498_10129216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1149 | Open in IMG/M |
| 3300032067|Ga0318524_10229790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 952 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 18.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.21% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.21% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.04% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.04% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.69% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.35% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.35% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.35% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.35% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.35% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.35% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.35% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.35% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.35% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.35% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.35% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.17% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.17% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.17% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.17% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.17% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.17% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.17% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.17% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.17% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.17% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.17% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.17% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.17% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012374 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012479 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.yng.030610 | Environmental | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012493 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 | Environmental | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030840 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 8 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031671 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-1 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032739 | Forest Soil Metatranscriptomics Site 2 LB Combined Assembly | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00750690 | 2170459010 | Grass Soil | VFFFWLVVVILVIILLAYIVHWAGGAVLHLRLGHFDMDVGFT |
| N57_09130000 | 2170459013 | Grass Soil | VFFFWLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT |
| 2PV_03920800 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFQLNVGFT |
| FD1_00059030 | 2170459024 | Grass Soil | VFFFWVVVVILVIILLAFIVHWAGGGGLNLRLGHFNLNVGFT |
| FD1_07145640 | 2170459024 | Grass Soil | VPGIVVFFFWLVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| 2222044759 | 2209111022 | Grass Soil | VFFFWLVVTILVIILLAFIVHWAGGGLLNLRLGHFV |
| JGI1027J12803_1022370961 | 3300000955 | Soil | FFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT* |
| JGI12635J15846_100022836 | 3300001593 | Forest Soil | LVVLAIIVLAFIVHWAGGGALNLRLGHFYLNVGVT* |
| JGI12635J15846_100761803 | 3300001593 | Forest Soil | VFFFWLVVIILVIILLAFIVHWAGGGSADLRLGHFFLNVGFT* |
| JGIcombinedJ26739_1002977012 | 3300002245 | Forest Soil | VFFFWLVVVILAIIFLAFIVHWAGGGLLDLRLGHFILNVG |
| C688J35102_1209720857 | 3300002568 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFELNVGFT* |
| soilH1_102925014 | 3300003321 | Sugarcane Root And Bulk Soil | MFFFWLVAVILAIILLAFIVHWAGGAAFDLRLGHFNMNVGFT* |
| JGI25404J52841_100002683 | 3300003659 | Tabebuia Heterophylla Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMNVGFT* |
| Ga0062384_1010961492 | 3300004082 | Bog Forest Soil | VFFFWLVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0062389_1008781872 | 3300004092 | Bog Forest Soil | VFFFWVVIVVLAIILLAAVVHWAGGGALNLRLGHFALDVGFT* |
| Ga0066396_100021401 | 3300004267 | Tropical Forest Soil | VVFFFWVVVVILAIMLLAFLVHRAGGGVLNLRLGHFVLNVGFT* |
| Ga0066673_106643652 | 3300005175 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFQLNVGFT* |
| Ga0066679_108819092 | 3300005176 | Soil | VFFFWLVVTILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0066690_101848392 | 3300005177 | Soil | VFFFWLVVTILIIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0066684_102327072 | 3300005179 | Soil | VFFFWLVVIILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0066684_106204022 | 3300005179 | Soil | VFFFWVVIVVLAIILLASIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0066684_107815791 | 3300005179 | Soil | VFFFWVVVVILAIILLASIVHWAGGGVLHLRVGHFVLDVGFT* |
| Ga0070658_105097802 | 3300005327 | Corn Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT* |
| Ga0070683_1000810472 | 3300005329 | Corn Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGAVLHLRLGHFDMDVGFT* |
| Ga0066388_1000333894 | 3300005332 | Tropical Forest Soil | VFFFWLVIVILAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0066388_1002537935 | 3300005332 | Tropical Forest Soil | VFFFWVVVVILAIILLGAIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0066388_1006011943 | 3300005332 | Tropical Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGGVLTLRLGHFELNVGFT* |
| Ga0066388_1037650462 | 3300005332 | Tropical Forest Soil | MGWLVLIILAIIVLAWIVHWAGGGIAHIKLGHFILQIGFT* |
| Ga0066388_1047411441 | 3300005332 | Tropical Forest Soil | VFFFWVVVVILAIILLAFIVHWAGGGALNLRLGHFGLNVGFS* |
| Ga0066388_1060001982 | 3300005332 | Tropical Forest Soil | VVFFFWVVVVILAIILLAFIVHWAGGGLLNLRLGHFILNVGFT* |
| Ga0066388_1067653072 | 3300005332 | Tropical Forest Soil | IVFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0066388_1071316292 | 3300005332 | Tropical Forest Soil | VFCFWLVVVILAIILLAYIVHWAGGGAMNLRLGHFFLNVG |
| Ga0008090_151960381 | 3300005363 | Tropical Rainforest Soil | VFFFWVVAIILAIILLAFIVHWAGGGVLNLRLGHFNLDVGFT* |
| Ga0070709_101212772 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFFLNVGFT* |
| Ga0070709_102378192 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVITILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0070709_110857781 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0070714_1005039881 | 3300005435 | Agricultural Soil | FFFWLVVVILAIILLAFIVHWAGGGQLNLRLGHFVLDVGFT* |
| Ga0070714_1016626211 | 3300005435 | Agricultural Soil | VFFFWVVVVILVIILLASIVHWAGGGVLNLRLGHLHLNVGFT* |
| Ga0070711_1003513521 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FFLWLVVVILVIILLAFIVHWAGGGQLNLRLGHFILDVGFT* |
| Ga0070708_1000216294 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILAIILLAYIVHWAGGGVLNLRVGHFVLNIGFT* |
| Ga0070708_1000318744 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILAIILLAFVVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0070708_1000403142 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWVVVVILVIILLASIVHWAGGGVLNLRLGHFHLNVGFT* |
| Ga0070706_1000214216 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0070706_1000453626 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VWFFVWLVLIVLAIILLAWIVHWAGGGIARIRLGHFILDVGFT* |
| Ga0070706_1001238744 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FVWLVLIVLAIILLAWIVHWAGGGIARIRLGHFILDVGFT* |
| Ga0070707_1000614391 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVAILVIILLAFIVHWAGGGALNLRLGHFFLNVGFT* |
| Ga0070698_1000278306 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0070698_1000651567 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0070698_1018145831 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FFFWLVVVILVIILLAFIVHWAGGGALNLRFGHFVLNVGFT* |
| Ga0070741_102823002 | 3300005529 | Surface Soil | VFFFWLVVVILAIILLAYIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0070734_101991022 | 3300005533 | Surface Soil | VFFFWVVIVVLAIILLAAIVHWAGGGTLNLRLGHFDLDVGFT* |
| Ga0070697_1009761671 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILVIILLAYVVHWAGGGVLHLRLGHFDMNVGFT* |
| Ga0070730_100656013 | 3300005537 | Surface Soil | MLFFWLVVVILAIILLAVVVHWAGGGFLNLRLGHFVLNIGFT* |
| Ga0070730_101085893 | 3300005537 | Surface Soil | VVAILAIILLAFIVHWAGGGALNIRLGHFVLDVGFT* |
| Ga0070730_101288592 | 3300005537 | Surface Soil | VFFFWVVVVILVIRFLAFIVQWAGGGVLDLRLGHFHLDVGFA* |
| Ga0068853_1006358571 | 3300005539 | Corn Rhizosphere | VFFFWLVVTILVIILLAFIVHWAGGGALNLRLGHFILDVGFT* |
| Ga0066707_104538502 | 3300005556 | Soil | IPGIVVFFFWLVVTILAIILLAFIVHWAGGGILNLRLGHFVLNVGFT* |
| Ga0066708_103745651 | 3300005576 | Soil | VFFFWLVVVILVIILLAYIVRWAGGGVLHLRLGHFDLNVGFT* |
| Ga0068857_1017689361 | 3300005577 | Corn Rhizosphere | WLVVVILAIILLAYIVHRAGGGVLNVKLGHFVLNVGFT* |
| Ga0066691_103542552 | 3300005586 | Soil | VFFFWVVVVLAIILLASTVHWAGGGALDLRLGHFVLKVGFT* |
| Ga0070761_100514892 | 3300005591 | Soil | MFFIWVVLVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT* |
| Ga0070761_101514971 | 3300005591 | Soil | VFFFWLVVVILAIILLAYIVHWAGGGTLDLRLGHFVLDVGFT* |
| Ga0070762_102454152 | 3300005602 | Soil | VFFFWVVIVILAIILLAAVVHWAGGGALSVRLGHFDLDVGFT* |
| Ga0070763_102018953 | 3300005610 | Soil | WLVVAILAIILLAFIVHWAGGAVLNLRLGHFVLNVGFT* |
| Ga0070763_102048623 | 3300005610 | Soil | VFFFWLVIVILAIILLAFIVHWAGGGQLDLRLGHFVLDVGFT* |
| Ga0070763_107498061 | 3300005610 | Soil | FWLVVVILVIILLAFIVHWAGGGALNLRLGHFFLNVGFT* |
| Ga0066905_1003350181 | 3300005713 | Tropical Forest Soil | VFFFWVVVVILAIILLAFIVHWAGGGALNLRLGHFGLNVGFT* |
| Ga0066903_1000719967 | 3300005764 | Tropical Forest Soil | VFFFWVVVVILAIILLAFIVHWAGGGLLNLRLGHFILNVGFT* |
| Ga0068858_1013857631 | 3300005842 | Switchgrass Rhizosphere | WLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT* |
| Ga0068860_1010717202 | 3300005843 | Switchgrass Rhizosphere | VVIVAIILLAFIVHWAGGAALNLRLGHFHLIVGFT* |
| Ga0075269_100168691 | 3300005905 | Rice Paddy Soil | IVVFFFWMVVAILAIIVLAFLVHWAGGGVLNLRLGHFVLKVGFT* |
| Ga0070717_103143871 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FFWLVVIVLAIILLAFIAHWAGGAQLNLRLGHFVLDVGFT* |
| Ga0070717_104162523 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLDVGFT* |
| Ga0070717_104743512 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FFWMVIVILAIVLLAYIVHRAGGGVFNLRLGHFVLNVGFT* |
| Ga0070717_105041461 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VLIILLIILLAFIVHWAGGGQMNLRLGHFFLNVGFT* |
| Ga0070717_107515142 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDLNVGFT* |
| Ga0070717_111970501 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVIVAIILLAFIVHWAGGAALNLRLGHFHLVVGFT* |
| Ga0070717_120943072 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVILAIILLAFIVHWAGGGLLSLRLGHFVLNVGFT* |
| Ga0075017_1000365964 | 3300006059 | Watersheds | VFFLWLVVAILAIILLAFVVHWAGGGVLNLRLGHFVLNSDT* |
| Ga0070715_102341571 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVIILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0070716_1013257341 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT* |
| Ga0070765_1000253665 | 3300006176 | Soil | VFFFWVVIVVLAIILLAAIVHWAGGGALNLRLGHFDLDVGFT* |
| Ga0070765_1001032326 | 3300006176 | Soil | VFFFWVVVVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT* |
| Ga0070765_1016854981 | 3300006176 | Soil | VVVILVIILLAFIVHWAGGGALNLRLGHFFLNVGFT* |
| Ga0079222_124956511 | 3300006755 | Agricultural Soil | VVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0079220_119496962 | 3300006806 | Agricultural Soil | VTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0075425_1019021071 | 3300006854 | Populus Rhizosphere | VFFFWLVVVILVIILLAYVVHWAGGGVMHLRLGHFDLDVGFT* |
| Ga0075424_1023961662 | 3300006904 | Populus Rhizosphere | VILAIILLAFIVHWAGGGVLNLRLGHFNLDVGFT* |
| Ga0075436_1003282972 | 3300006914 | Populus Rhizosphere | VFFFWVVVVIVAIILLAFIVHWAGGAALNLRLGHFHLIVGFT* |
| Ga0075435_1014045641 | 3300007076 | Populus Rhizosphere | VLFFVWFVLIILAIILLAWIVHWAGGGIARIRLGHFILDVGFT* |
| Ga0099794_100229901 | 3300007265 | Vadose Zone Soil | VFFFWLVAVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0105251_100924813 | 3300009011 | Switchgrass Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0099829_100645391 | 3300009038 | Vadose Zone Soil | MPSPAFVAFFWVVVVILAIILLAFIVHWVGGGVLKLRLGDFVLNVGFT* |
| Ga0099829_112104781 | 3300009038 | Vadose Zone Soil | LFFAWLVLIILAIILLAWIVHWAGGGIAHIRLGHFILDVGFT* |
| Ga0099830_100304592 | 3300009088 | Vadose Zone Soil | VVVVILAIILLAFIVHWVGGGVLKLRLGDFVLNVGFT* |
| Ga0099828_103253691 | 3300009089 | Vadose Zone Soil | VFFFWVVAVILAIILLAFIVHWAGGGELNLRIGHFVLKVGFT* |
| Ga0099827_100124164 | 3300009090 | Vadose Zone Soil | VFFFWVVVVILAIILLAFIVHWAGGGVLHIRLGHFTLNVGFT* |
| Ga0099827_100159926 | 3300009090 | Vadose Zone Soil | VLFFVWLVLIILAIILLAWIVHWAGGGIAHVRLGHFILKVGFT* |
| Ga0099827_100853153 | 3300009090 | Vadose Zone Soil | MVVILAIILLAFIVHWAGGAVLNLRLGHFQLNVGFT* |
| Ga0105245_108676583 | 3300009098 | Miscanthus Rhizosphere | FWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0066709_1032374371 | 3300009137 | Grasslands Soil | VLFFWVVVVILAIIVLAAIVHWAGGGVLNLRLGHFVLNIGFT* |
| Ga0105243_103035203 | 3300009148 | Miscanthus Rhizosphere | VFFFWLVVVILVIILLAFIIHWAGGGALNLRLGHFVLNVGFT* |
| Ga0105243_123437992 | 3300009148 | Miscanthus Rhizosphere | VVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0105237_104695303 | 3300009545 | Corn Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0105237_110138352 | 3300009545 | Corn Rhizosphere | VFFFWLVVVILVIILLAYVVHWAGGGVLHLRLGHFDLNVGFT* |
| Ga0105237_114384892 | 3300009545 | Corn Rhizosphere | VFFFWLVIVILVIILLAFIVHWAGGGALNLRLGHFVLDVGFT* |
| Ga0116125_11961792 | 3300009628 | Peatland | VFFFWLVVVILAIILLAYIVHWAGGAVLDLRLGHFILNVGFT* |
| Ga0116135_12881642 | 3300009665 | Peatland | VFFFWLVVVILAIILLAYIVHWAGGAVLNLRLGHFVLDVGFT* |
| Ga0116216_102223182 | 3300009698 | Peatlands Soil | VFFFWVVIVVLDIILLAAIVHWAGGGALNLRLGHFDLDVGFT* |
| Ga0116216_104443401 | 3300009698 | Peatlands Soil | VLFFVWLVLIILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT* |
| Ga0126374_100295882 | 3300009792 | Tropical Forest Soil | VFFFWLVVVILAIIMLAFIVYWPGGGVLKLRLGHFALNVGFT* |
| Ga0126374_100592762 | 3300009792 | Tropical Forest Soil | VFFFWVVVAILAIILLAFIVHWAGGGALNLRLGHFGLNVGFS* |
| Ga0126374_100996212 | 3300009792 | Tropical Forest Soil | VFFFWLVVVILVIILLAFIVHWAGGGVMNLRLGHFVLNVGFT* |
| Ga0126374_106240832 | 3300009792 | Tropical Forest Soil | VFFFWVVIVVLAIILLAFIVHWAGGGLLNLRLGHFVLNLGFN* |
| Ga0126374_109708092 | 3300009792 | Tropical Forest Soil | FFWVVVVILAIILLAFIVHWAGGGALNLRLGHFGLNVGFS* |
| Ga0123355_111360662 | 3300009826 | Termite Gut | MFFFWVMVVVLVIILVGFVVHWAGGATLDLRLGHFTLDIGFS* |
| Ga0123355_118374662 | 3300009826 | Termite Gut | VFFFWVVVVILAVILLAFIVHWAGGGVLNLRIGHFVLNVGFT* |
| Ga0130087_10290141 | 3300009828 | Host-Associated | VFFFWLVVIILAIILLAFIVHWAGGAAFALRLGHFNMNVGFT* |
| Ga0126380_100824442 | 3300010043 | Tropical Forest Soil | VVFFFWIVLIILAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0126380_101006683 | 3300010043 | Tropical Forest Soil | VILAIILLAFIVHWAGGGALNLRLGHFGLNVGFT* |
| Ga0126380_103317621 | 3300010043 | Tropical Forest Soil | VWFVAWLVLIVLAIILLAWIVHWAGGGIAHIRIGHFILNVGFT* |
| Ga0126380_103534191 | 3300010043 | Tropical Forest Soil | VVILAIVLLAFVVHWAGGGVLNLRLGHFALNVGFT* |
| Ga0126380_107728632 | 3300010043 | Tropical Forest Soil | VVVVILAIILLASIVHWAGGGVLHLRVGHFVLDVGFT* |
| Ga0126380_117904731 | 3300010043 | Tropical Forest Soil | VFFFWLVVVILVIILLAYIVHGAGGGVLHLRLGHFDMNVGFT* |
| Ga0126384_100602012 | 3300010046 | Tropical Forest Soil | VLFFVWLVLIVLGIILLAWIVHWAGGGVAHIRLGHFILEVGFT* |
| Ga0126384_102049842 | 3300010046 | Tropical Forest Soil | VIGAILAIILLAFIVHWACGGVLNLRLGHFVLNIGFT* |
| Ga0126384_102410482 | 3300010046 | Tropical Forest Soil | VLLFAWLVLIVLGIILLAWIVHWAGGGIAHIRLGHFILDVGFT* |
| Ga0126384_109726921 | 3300010046 | Tropical Forest Soil | VFFFWVIVAILAIILLAYIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0126382_100516312 | 3300010047 | Tropical Forest Soil | VVVVILAIILLAFIVHWAGGGVLKFRLGDFVLNVGFT* |
| Ga0126382_102919732 | 3300010047 | Tropical Forest Soil | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFGLNVGFT* |
| Ga0126382_103213662 | 3300010047 | Tropical Forest Soil | VFFFWLVIVILAIILLAFIVHWAGGGVLHLRLGHFNLDVGFT* |
| Ga0126382_104902093 | 3300010047 | Tropical Forest Soil | VLAVLAIILLAFIVHLAGGGVLNLRLGHFILKIGFT* |
| Ga0126382_105920102 | 3300010047 | Tropical Forest Soil | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT* |
| Ga0126382_118377561 | 3300010047 | Tropical Forest Soil | VAWLVLIVLAIILLAWIVHWAGGGIAHIRIGHFILNVGFT* |
| Ga0126373_100335415 | 3300010048 | Tropical Forest Soil | VFFFWVVVAILAIILLAFIVHWAGGGVLHLRLGHFILTVGFT* |
| Ga0126373_100400823 | 3300010048 | Tropical Forest Soil | VVIAILAIILLAFILHWADGRVLHLRLGYFLLNVGFT* |
| Ga0126373_100426495 | 3300010048 | Tropical Forest Soil | VFFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0126373_105474792 | 3300010048 | Tropical Forest Soil | VFFFWVVIVILAIILLAFIVHWAGGGVLNLRLGHFMLNVGFT* |
| Ga0126373_105960953 | 3300010048 | Tropical Forest Soil | VFFFWVVVVILAIMLLAFLVHRAGGGVLNLRLGHFVLNVGFT* |
| Ga0126373_106193243 | 3300010048 | Tropical Forest Soil | VFFFWVVVAILIIILLAFIVHWAGGGLLNVRLGHFVLNVGFT* |
| Ga0126373_106233353 | 3300010048 | Tropical Forest Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0126373_108793411 | 3300010048 | Tropical Forest Soil | VWFFAWLVLIVLAIILLAWIVHWAGGGIAHIRLGHFVLDVGFT* |
| Ga0126373_111190261 | 3300010048 | Tropical Forest Soil | VFCFWLVVVILAIILLAYIVHWAGGGAMNLRLGHFFLNVGFT* |
| Ga0126373_112637781 | 3300010048 | Tropical Forest Soil | VFFFWMVVVILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT* |
| Ga0126373_112749011 | 3300010048 | Tropical Forest Soil | VVFFFWIVVVIVAIILLAWLVHLAGGGVLNLRVGHFVLNVGFT* |
| Ga0126373_116153811 | 3300010048 | Tropical Forest Soil | VVVVIMAIIVLAYIVHWAGGGVLNLRIGHFVLNVGFT* |
| Ga0126373_116683461 | 3300010048 | Tropical Forest Soil | VLFFVWLVLTILAIILLAFIVRWAGGGVLHLRFGHFILNVGFA* |
| Ga0126373_119827432 | 3300010048 | Tropical Forest Soil | MFFAWIVLIILAIILLAWVVHWAGGGFLNLKLGHFMLKVGFS* |
| Ga0126373_127352592 | 3300010048 | Tropical Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFTLNVGFN* |
| Ga0126373_131797201 | 3300010048 | Tropical Forest Soil | VLFFVWLALIILVIILLAFIVHWAGGGLLSLRLGHFILNVGFT* |
| Ga0123356_106152022 | 3300010049 | Termite Gut | VFFLWLVAIILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT* |
| Ga0123356_138847462 | 3300010049 | Termite Gut | FFWVVVVILAVILLAFIVHWAGGGVLNLRIGHFVLNVGFT* |
| Ga0126318_101110051 | 3300010152 | Soil | VWFFIWLVVVILAICLLAFIVHWAGGALLNLRLGHFVLNVGFT* |
| Ga0126318_111128211 | 3300010152 | Soil | GIAVFFFWLVVIILVIILLASVVHWAGGGVLHLRLGHFVLNVGFT* |
| Ga0134082_100296024 | 3300010303 | Grasslands Soil | VFFFWLVVIILVIILLAFIVHWAGGGVMNLRLGHFVLNVGFT* |
| Ga0134109_104522261 | 3300010320 | Grasslands Soil | FFFWVVVVILAIIFLAFIVHWAGGAVLHLRLGDFVLNVGFT* |
| Ga0126370_100189105 | 3300010358 | Tropical Forest Soil | VFFFWVVAAILAIILLAFIVHWAGGRGLNLRLGHFVLNVSFP* |
| Ga0126370_100197945 | 3300010358 | Tropical Forest Soil | VLFFPWLVLIIFPIILLAWIVHWAGGGIAHIRLGHFILHIGFT* |
| Ga0126370_107648841 | 3300010358 | Tropical Forest Soil | VLFFAWLALIILAIILLAWIVHWAGGGIAHIRLGHFILQIGFT* |
| Ga0126370_110251132 | 3300010358 | Tropical Forest Soil | VFFFWVVIVVLAIILLAFIVHWAGGGLLNLRLGHF |
| Ga0126376_101538212 | 3300010359 | Tropical Forest Soil | VLFFAWLALIILAIILLAWIVHWAGGGIAHIRLGHFILHIGFT* |
| Ga0126376_106026541 | 3300010359 | Tropical Forest Soil | VLFFVWLVLIVLGIILLAWIVHWAGGGIAHIRLGHFILEVG |
| Ga0126376_111064082 | 3300010359 | Tropical Forest Soil | VIVAIILLAFVVHWAGGGALSLRLGHFVLNVGFT* |
| Ga0126376_120437801 | 3300010359 | Tropical Forest Soil | VLFFAWLVLIILAIILLAWIVHWAGGGIAHIRLGHFILDVGFT* |
| Ga0126372_102129713 | 3300010360 | Tropical Forest Soil | VAILAIILLAFIVHWAGGGVLHLRLGYFLLNVGFT* |
| Ga0126372_104603023 | 3300010360 | Tropical Forest Soil | MGWLVLIILAIIVLAWIVHWGGGGIAHIKLGHFILQIGFT* |
| Ga0126372_120385851 | 3300010360 | Tropical Forest Soil | VWFFAWLVLIVLAIILLAWIVHWAGGGIAHIRIGHFILNVGFT* |
| Ga0126372_123841502 | 3300010360 | Tropical Forest Soil | MVIVILAIILLAFIVHWAGGGLLNLRLGHFILNVGFT* |
| Ga0126372_125742372 | 3300010360 | Tropical Forest Soil | VLFFAWLVLIILAIILLAWIVHWAGGGIAHIRLGHFILHIGFT* |
| Ga0126372_131326061 | 3300010360 | Tropical Forest Soil | VVVVILAIILLAFIVHCPGGGVLKLRLGHFVLNVGFT* |
| Ga0126378_100806233 | 3300010361 | Tropical Forest Soil | FFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFALRVGFT* |
| Ga0126378_101381482 | 3300010361 | Tropical Forest Soil | VLFFAWLALIILAIILLAWIVHWAGGGIAHIKLGHFILDVGFT* |
| Ga0126378_104813864 | 3300010361 | Tropical Forest Soil | PRAVPPLRSFLCWVIGAILAIILLAFIVHWACGGVLNLRLGHFVLNIGFT* |
| Ga0126378_108971721 | 3300010361 | Tropical Forest Soil | WVVVAILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT* |
| Ga0126378_111323132 | 3300010361 | Tropical Forest Soil | VVVVIVAIILLAFIVHWAGGGALSLRLGHFVLNVGFT* |
| Ga0126378_111422031 | 3300010361 | Tropical Forest Soil | VFFFWVVMVILAIILLAFIVHWAGGGVLNLRLGHFNLDVGFT* |
| Ga0126378_113552062 | 3300010361 | Tropical Forest Soil | VVVFCFWLVVVILAIILLAFMVHWAGGAALELRLGHFTLNVGFN* |
| Ga0126378_125171842 | 3300010361 | Tropical Forest Soil | FFWVVIVILAVILLAFLVHLAGGGVLHLRLGHFILDVGFT* |
| Ga0126378_125303632 | 3300010361 | Tropical Forest Soil | IVWFFFWLVVVILAIILLAAIVHWAGGGLLNLKAGHFVLNIGFT* |
| Ga0126379_100672072 | 3300010366 | Tropical Forest Soil | VFFFWVVVVILAIMLLAFLVHRAGGEVLNLRLGHFVLNVGFT* |
| Ga0126379_102323624 | 3300010366 | Tropical Forest Soil | LFFIWMVIVILAIILLAFIVHWAGGGLLYLRLGHFILNVGFT* |
| Ga0126379_104929381 | 3300010366 | Tropical Forest Soil | AILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0126379_118415441 | 3300010366 | Tropical Forest Soil | VIVAILAIILLAFIVHWAGGGVLNLRLGHFALNVGFT* |
| Ga0126379_119181421 | 3300010366 | Tropical Forest Soil | VLFFAWLALIILAIILLAWIVHWAGGGIAHIRLGHFILQLGFT* |
| Ga0126379_138676591 | 3300010366 | Tropical Forest Soil | VILAIILLAFIVHWVGGGVLTLRLGHFILNVGFT* |
| Ga0134125_109253422 | 3300010371 | Terrestrial Soil | VFFFWLVVVILVIILLAYIVHWAGGGVLRLRLGHFDMDVGFT* |
| Ga0134128_107011963 | 3300010373 | Terrestrial Soil | WMVVIILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0134128_114249931 | 3300010373 | Terrestrial Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFRLDVGFT* |
| Ga0134128_128451052 | 3300010373 | Terrestrial Soil | FFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0126381_1000002004 | 3300010376 | Tropical Forest Soil | VWFFIWLVVAILVIILLAFIVHWAGGGALNLRLGHFVLDVGVT* |
| Ga0126381_1000922873 | 3300010376 | Tropical Forest Soil | VVFFFWVVIVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0126381_1002665962 | 3300010376 | Tropical Forest Soil | VVIAILAIILLAFIVHWADGRVLHLRLGYFLLNVGFT* |
| Ga0126381_1003918321 | 3300010376 | Tropical Forest Soil | VFFFWLVVTILAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0126381_1005620572 | 3300010376 | Tropical Forest Soil | VLFFAWLVLIILVIILLAFIVHWAGGGLLSLRLGHFILNVGFT* |
| Ga0126381_1006524312 | 3300010376 | Tropical Forest Soil | VFFIWLVVVILAIILLAFIVHWAGGGLLNVRLGHFVLNVGFT* |
| Ga0126381_1007598732 | 3300010376 | Tropical Forest Soil | VFFFWVVIAILAIILLAFIVHWAGGGVLHLRLGHFILTVGFT* |
| Ga0126381_1012796501 | 3300010376 | Tropical Forest Soil | VFFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0126381_1018304462 | 3300010376 | Tropical Forest Soil | LFFIWMVIVILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT* |
| Ga0126381_1019745653 | 3300010376 | Tropical Forest Soil | WLVVAILIIILLAFIVHWAGGGLLNVRLGHFTLSVGFT* |
| Ga0126381_1023038732 | 3300010376 | Tropical Forest Soil | VFFFWLVVVILVIILLAFIVHWAGGGALDLRLGHFSLNVGFT* |
| Ga0126381_1023288811 | 3300010376 | Tropical Forest Soil | VFFFWLVVAILIIILLAFIVHWAGGGLLNVRLGHFVLNVGFT* |
| Ga0126381_1023399971 | 3300010376 | Tropical Forest Soil | VFFFWVVIVILAIILLAFIVHWAGGGILRLRLGHFNLDVGFT* |
| Ga0126381_1023441682 | 3300010376 | Tropical Forest Soil | VVVILAIILLASIVHWAGGGVIHLRVGHFVLDAGFT* |
| Ga0136449_1001667385 | 3300010379 | Peatlands Soil | VILVIILLAFIVHWAGGGSLNLHLGHFVLDVGFT* |
| Ga0136449_1023997852 | 3300010379 | Peatlands Soil | VVFFFWLVVVILAIILLAFIVHWAGGGSLNLRLGHFFLNVGFT* |
| Ga0134126_1000250414 | 3300010396 | Terrestrial Soil | VFFFWVVVVIVAIILLAFIVHWAGGGELRLRLGHFVLNVGFT* |
| Ga0134126_100883441 | 3300010396 | Terrestrial Soil | VFFFWLVITILVIILLAFIVHWAGGGVLNLRLGHFELN |
| Ga0134126_106983621 | 3300010396 | Terrestrial Soil | IFFFWVVVVILAIILLAFIVHWAGGGVLHIRLGHFTLNVGFT* |
| Ga0134126_110685672 | 3300010396 | Terrestrial Soil | FFFWLVVVGLHHMLVAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0126383_100464144 | 3300010398 | Tropical Forest Soil | VFFFWVVVVILAIILLAFIVHWAGGGVLSLRLGHFALNVGFT* |
| Ga0126383_104621923 | 3300010398 | Tropical Forest Soil | FFWVVVIILAIILLAFIVHWAGGGVLNLRLGHFGLNVGFT* |
| Ga0126383_104753021 | 3300010398 | Tropical Forest Soil | VFFFWVVVAILAIILLAFIVHWAGGGALILRLGHFGLNVGFS* |
| Ga0126383_105500962 | 3300010398 | Tropical Forest Soil | MLGITSPLTFVLGTIAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0126383_114489961 | 3300010398 | Tropical Forest Soil | MVIVILAIILLAFIVHWAGGGVLNLRLGHFILNVG |
| Ga0126383_120059411 | 3300010398 | Tropical Forest Soil | FWVVVVILAIILLASIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0126383_130673952 | 3300010398 | Tropical Forest Soil | FFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFGLNVGFT* |
| Ga0126383_134789542 | 3300010398 | Tropical Forest Soil | VVIVAIILLAFIVHWAGGGVLHLRLGHFNLDVGFT* |
| Ga0134122_106215242 | 3300010400 | Terrestrial Soil | WLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0126359_11291742 | 3300010869 | Boreal Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFILNVGFN* |
| Ga0126356_100776632 | 3300010877 | Boreal Forest Soil | VLFFFWLVVVILAIFLLAALVHWAGGGLLHLRLGHFVLNVGFT* |
| Ga0126356_101966382 | 3300010877 | Boreal Forest Soil | VVFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFILNVGFN* |
| Ga0126350_106597602 | 3300010880 | Boreal Forest Soil | VVLAIILLAAVVHWAGGGALNLRLGHFDLDVGFT* |
| Ga0126350_121199311 | 3300010880 | Boreal Forest Soil | VILVIILLAFIVHWAGGGVLNLRLGHFELNVGFT* |
| Ga0126350_123271911 | 3300010880 | Boreal Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGAQLNLRLGHFALDVGFT* |
| Ga0126350_123403651 | 3300010880 | Boreal Forest Soil | IWVVLAILAIILLAYIVHWAGGGSLNVRLGHFFLNVGFT* |
| Ga0137776_11018881 | 3300010937 | Sediment | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFNLDVGFT* |
| Ga0137776_11937951 | 3300010937 | Sediment | VFFFWLVVVILAIILLAFIVHWAGGAALNLRLGHFDLNVGFT* |
| Ga0151490_10675391 | 3300011107 | Soil | VFFFWLVVVILVIILLAYIVHWAGGGVLHLGLGHFDMNVGFT* |
| Ga0150983_126366613 | 3300011120 | Forest Soil | VFLFWVVVAILAIVVLGAIAHWAGGGSLDMHIGHFVLDVGFT* |
| Ga0137393_110150651 | 3300011271 | Vadose Zone Soil | VFFFWVVVVILAIILLAFIVHWAGGGELNLRIGHFVLKVGFT* |
| Ga0137383_102802551 | 3300012199 | Vadose Zone Soil | LRLVVVVILAIILLASIVHWAGGGVLHLRVGHFVLDVGFT* |
| Ga0137383_108983081 | 3300012199 | Vadose Zone Soil | VFFFWVLVVILVIILLAFIVHWAGGGVLNLRLGHFNLNVGFT* |
| Ga0137383_109181591 | 3300012199 | Vadose Zone Soil | VFFFWLVVVILAIILLAFIVHWAGGGFLNLRLGHFVLNVGFT* |
| Ga0137365_100120723 | 3300012201 | Vadose Zone Soil | VFFFWLVVIILVIILLAYIVHWAGGGVLHLRLGHFDLNVGFT* |
| Ga0137365_101650802 | 3300012201 | Vadose Zone Soil | VLFFVWLVVIILAIILLAWIVHWAGGGIAHVRLGHFILEVGFT* |
| Ga0137365_101660902 | 3300012201 | Vadose Zone Soil | VCFLWLGVGILAIVLLAYIVHWAGGGLLNLRLGHFVLTVGFT* |
| Ga0137365_104222912 | 3300012201 | Vadose Zone Soil | LFFIWVVIVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0137363_105720172 | 3300012202 | Vadose Zone Soil | VFFFWLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVAFT* |
| Ga0137363_109286771 | 3300012202 | Vadose Zone Soil | IVLAIILLAWIVHWAGGGVLNLRLGHFELNVGFT* |
| Ga0137363_117677862 | 3300012202 | Vadose Zone Soil | VFFFWVVLVILAIILLAFIVHSAGGGLLNLRVGHFVLNVGFT* |
| Ga0137399_116997722 | 3300012203 | Vadose Zone Soil | VVFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFILNVGFT* |
| Ga0137380_103350364 | 3300012206 | Vadose Zone Soil | VVILAIILLAFIVHWAGGGVLHLRLGHFDLNVGFT* |
| Ga0137380_113825211 | 3300012206 | Vadose Zone Soil | LRLVVVVILAIILLASIVHWAGGGVLHLRVGHFVLDVG |
| Ga0137376_102990942 | 3300012208 | Vadose Zone Soil | VFFFWLVVIILIIILLASIVHWAGGGVLHLRLGHFVLNVGFT* |
| Ga0137379_100891551 | 3300012209 | Vadose Zone Soil | FFWLVVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0137379_108491392 | 3300012209 | Vadose Zone Soil | VILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0137378_100647517 | 3300012210 | Vadose Zone Soil | VFFFWVVVVILVIILLAYIVHWAGGGVLNLRLGHFHLNVGFT* |
| Ga0137378_101293152 | 3300012210 | Vadose Zone Soil | VFFFWVVVVILAIILLAFIVHWAGGGFLNLRLGHFVLNVGFT* |
| Ga0137378_102091682 | 3300012210 | Vadose Zone Soil | VFFFWLVVTILAIILLAFIVHWAGGGILNLRLGHFVLNVGFT* |
| Ga0137378_106055952 | 3300012210 | Vadose Zone Soil | FWLVVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0137377_102944052 | 3300012211 | Vadose Zone Soil | VLFFVWLVLIILAIILLAWIVHWAGGGIAHVRLGHFILEVGFT* |
| Ga0137377_113239982 | 3300012211 | Vadose Zone Soil | FWVVVVVLTIILLAFIVHWAGGGVLNLRLGHFALNVGFT* |
| Ga0150985_1164622312 | 3300012212 | Avena Fatua Rhizosphere | VWFFIWLVVIILAICLLAFIVHWAGGALLNLRLGHFVLNVGFT* |
| Ga0137372_102934582 | 3300012350 | Vadose Zone Soil | VFFFWLVVTILAIILLAFIVHRAGGGVLNVRLGHFVLNVGFT* |
| Ga0137384_102570211 | 3300012357 | Vadose Zone Soil | VFFFWVVVVILAINMLAFIVHWAGGGVLHLRLGHFDLNVGFT* |
| Ga0137384_105027612 | 3300012357 | Vadose Zone Soil | VVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT* |
| Ga0137384_110966332 | 3300012357 | Vadose Zone Soil | VVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0137384_114787651 | 3300012357 | Vadose Zone Soil | VFFFWLVVVILVIILLAFIVHWAGGGLLNLRLGHFILNV |
| Ga0137361_110413502 | 3300012362 | Vadose Zone Soil | VFFFWLVAVILAIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0137390_111770462 | 3300012363 | Vadose Zone Soil | MFFAWLVLIILAVILLAWIVHWAGGGLLDLRLGHFKLDVGFT* |
| Ga0137390_116265801 | 3300012363 | Vadose Zone Soil | VILAIILLAFIVHWAGGGVLNLRLGHFALNVGFT* |
| Ga0134039_10559772 | 3300012374 | Grasslands Soil | VILAIVLLAFIVHWAGGAVLNLRIGHFTLNVGFT* |
| Ga0134045_12575351 | 3300012409 | Grasslands Soil | VFFFWLVVIILVIILLAFIVHWAGGGVMTLRLGHFVLNVGFT* |
| Ga0157348_10107761 | 3300012479 | Unplanted Soil | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMN |
| Ga0157346_10312322 | 3300012480 | Arabidopsis Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVMHLRLGHFDMDVGFT* |
| Ga0157355_10117351 | 3300012493 | Unplanted Soil | VFFFWLVIVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0157341_10111292 | 3300012494 | Arabidopsis Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVL |
| Ga0137398_101388401 | 3300012683 | Vadose Zone Soil | LFFFWLVVAILAIILLAFIVHWAGGGQLDLRLGHFILNVGFN* |
| Ga0157303_103215131 | 3300012896 | Soil | VFFFWLVVVILVIILLAYVVHWAGGGVMHLRLGHFDMDVGFT* |
| Ga0137419_104572781 | 3300012925 | Vadose Zone Soil | VFFFWLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVG |
| Ga0137416_110809882 | 3300012927 | Vadose Zone Soil | IPGIVVFFFWLVVTILAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT* |
| Ga0137404_101396583 | 3300012929 | Vadose Zone Soil | VFFFWLMVVILAIILLAFIVHWAGGAVLNLRLGHFLLNVGFT* |
| Ga0137404_106777531 | 3300012929 | Vadose Zone Soil | VVFFFWLVVVILAIFLLAFIVHWAGGGVLHLRLGHFILNVGFT |
| Ga0137404_121881032 | 3300012929 | Vadose Zone Soil | VVFFFWLVVVILAIILLAFIVHWAGGGELNLRLGHFILDVGFT* |
| Ga0137410_103224072 | 3300012944 | Vadose Zone Soil | FFFWLVVVILVIILLAFIVHWAGGGLLDLRLGHFVLNVGFN* |
| Ga0137410_121330301 | 3300012944 | Vadose Zone Soil | VVFFFWLVVVILAIILLAFIVHWAGGGVLHLRLGHFILNVGFN* |
| Ga0126375_120524891 | 3300012948 | Tropical Forest Soil | WVVVIILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT* |
| Ga0164298_111833552 | 3300012955 | Soil | VFCFWLVVTILVINLLAFIVHFAGGGLLNLRLGHFVLNVGFT* |
| Ga0164303_103968352 | 3300012957 | Soil | VFFFWLGVTILVIILVAFIVHWAGGGILNLRRGHF |
| Ga0126369_102225431 | 3300012971 | Tropical Forest Soil | VLFFAWLALIILAIILLAWIVHWAGGGIAHVRLGHFILQIGFT* |
| Ga0126369_103022971 | 3300012971 | Tropical Forest Soil | LFFIWMVIVILAIILLAFIVHWAGGGLLNLRLGHFILNVGFT* |
| Ga0126369_103176563 | 3300012971 | Tropical Forest Soil | VIVAIILLAFIVHWAGGGVLHLRLGHFNLDVGFT* |
| Ga0126369_113533681 | 3300012971 | Tropical Forest Soil | MVVFFFWVVVVILENILLASIVHWAGGGVLHLRVGHFVLDVGFT* |
| Ga0164309_110666911 | 3300012984 | Soil | VFFFWLVVTILVIILLAFIVHWAGGGVMNLRLGHFELNVGFT* |
| Ga0164308_116622292 | 3300012985 | Soil | FFFWVVVVIVAIILLAFIVHWAGGAALNLRLGHFHLIVGFT* |
| Ga0164305_101581384 | 3300012989 | Soil | VILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0157370_121430351 | 3300013104 | Corn Rhizosphere | VWFFIWLVVVIRAFCLLAFIVHWAGGALLNLRLGHFVLNVGFT* |
| Ga0157369_101894102 | 3300013105 | Corn Rhizosphere | MFFFWLVAVILAIILLAFIVHWAGGAAFDRRLGHFKMNVGFT* |
| Ga0157369_119619871 | 3300013105 | Corn Rhizosphere | VFFIWLVLVILAIILLAFIVHWAGGGLLNVRLGHFILNVGFT* |
| Ga0157369_121979462 | 3300013105 | Corn Rhizosphere | FWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT* |
| Ga0157378_127990181 | 3300013297 | Miscanthus Rhizosphere | VFLFWLVVVILVIILLAYIVHWAGGAVLHLRLGHFDMDVGFT* |
| Ga0163162_115825922 | 3300013306 | Switchgrass Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGALSLRLGHFVLNVGFT* |
| Ga0163162_130022562 | 3300013306 | Switchgrass Rhizosphere | WLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0157372_118922031 | 3300013307 | Corn Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNV |
| Ga0157372_133981972 | 3300013307 | Corn Rhizosphere | FFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT* |
| Ga0181537_100346494 | 3300014201 | Bog | VFFFWLVVVILAIILLAFIVHWAGGAQLNLRLGHFVLDVGFT* |
| Ga0182024_101691501 | 3300014501 | Permafrost | VWFFIWVVVVILAIILLAAVVHWAGGGALDLRLGHFFLNVGFT* |
| Ga0181525_106866982 | 3300014654 | Bog | VIVILAILLLAFIVNWAGGAVMNLRIGHFILDVGFT* |
| Ga0157379_111203811 | 3300014968 | Switchgrass Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGF |
| Ga0137409_108296022 | 3300015245 | Vadose Zone Soil | VVFFFWLVVVILAIILLAFIVHWAGGGDLNLRLGHFVLNVGFN* |
| Ga0134073_103874742 | 3300015356 | Grasslands Soil | IILVIILLAFIVHWAGGGVMNLRLGHFVLNVGFT* |
| Ga0132258_110015911 | 3300015371 | Arabidopsis Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGLLHLRLGHFDLNVGFT* |
| Ga0132258_115213402 | 3300015371 | Arabidopsis Rhizosphere | VFFFWVVVVILAIILLAAIVHWAGGALLHLRLGHFVLNVGFT* |
| Ga0132256_1019253841 | 3300015372 | Arabidopsis Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGF |
| Ga0132256_1031600472 | 3300015372 | Arabidopsis Rhizosphere | FLWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT* |
| Ga0132257_1038647361 | 3300015373 | Arabidopsis Rhizosphere | VVILAIILRAAIVHWAGGALLHLRLGHFVLNVGFT* |
| Ga0182035_115310812 | 3300016341 | Soil | MFFFWLVVAILAIILLAFIVHRAGGGVLNLRLGHFVLNVGFT |
| Ga0182034_101689772 | 3300016371 | Soil | VFFFWLVVAILAIILLGFIVHRAGGGVLNLRLGHFVLNVGF |
| Ga0182039_102742313 | 3300016422 | Soil | VFFFWVVVVILAIILLAFIVHWAGGGALDLRLGHFELNVGFN |
| Ga0182039_104589682 | 3300016422 | Soil | VFFFWLVVVILAIILLAVIVHWVGGGVLNLRLGHFVLNVGFT |
| Ga0182039_106234262 | 3300016422 | Soil | VVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFR |
| Ga0182038_100320812 | 3300016445 | Soil | VCFFWLVVVILALILLAFIVHWAGGAALNLRLGHFTLNVGFT |
| Ga0187807_10122592 | 3300017926 | Freshwater Sediment | VFFFWVVIVVLAIILLAAIVHWAGGGALNLRLGHFDLDVGFT |
| Ga0187807_10477641 | 3300017926 | Freshwater Sediment | VVFFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0187801_105197661 | 3300017933 | Freshwater Sediment | MVVVILAIIVLAFIVHWAGGGVLNLRLGHFGLSVGFT |
| Ga0187809_100214653 | 3300017937 | Freshwater Sediment | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT |
| Ga0187809_100859022 | 3300017937 | Freshwater Sediment | VFFFWLVVAILVIILLAFIVHWAGGGVLNLRLGHFQLNVGF |
| Ga0187809_102792272 | 3300017937 | Freshwater Sediment | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFELNVGFT |
| Ga0187847_101230262 | 3300017948 | Peatland | VFFFWLVVVILAIILLAYIVHWAGGAVLDLRLGHFILNVGFT |
| Ga0187776_103080833 | 3300017966 | Tropical Peatland | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT |
| Ga0187783_100176603 | 3300017970 | Tropical Peatland | MFFIWIVLVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0187783_103820942 | 3300017970 | Tropical Peatland | MFFFWIVVAILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0187783_104938242 | 3300017970 | Tropical Peatland | VVVVILAIIFLAFIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0187823_102716002 | 3300017993 | Freshwater Sediment | VFFFWLVVVILVIILLAFIVHWAGGGSLNLRLGHFFLNVGFT |
| Ga0187863_101708012 | 3300018034 | Peatland | VFFFWLVVVILAIILLAYIVHWAGGAVLNLRLGHFVLDVGFT |
| Ga0187863_106690502 | 3300018034 | Peatland | FFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFELNVGFT |
| Ga0187890_107550391 | 3300018044 | Peatland | IWVVLVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0187766_102768852 | 3300018058 | Tropical Peatland | VVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0066667_108310282 | 3300018433 | Grasslands Soil | MRGTVVFFFWLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT |
| Ga0193729_11064112 | 3300019887 | Soil | VLFFFWLVVVILAIFLLAALVHWAGGGVLHLRLGHFVLNLGFT |
| Ga0193730_10336801 | 3300020002 | Soil | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMNVGFT |
| Ga0197907_104923202 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LVAVILAIILLAFIVHWAGGAAFDLRLGHFNMNVGFT |
| Ga0206356_100347292 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT |
| Ga0206355_13939083 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | FFFWLVAVILAIILLAFIVHWAGGAAFDLRLGHFNMNVGFT |
| Ga0206352_111092901 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | PGIVMFFFWLVAVILAIILLAFIVHWAGGAAFDLRLGHFNMNVGFT |
| Ga0206350_112651541 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | PVILGIILLAFIVHWAGGAALNLRLGHFILQVGFT |
| Ga0179590_11190452 | 3300020140 | Vadose Zone Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFILNVGFN |
| Ga0210403_107162322 | 3300020580 | Soil | VFFFWVVIVILAIILLAAVVHWAGGGALSVRLGHFDLDVGFT |
| Ga0210395_100153085 | 3300020582 | Soil | MFFIWVVLVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0210395_104150012 | 3300020582 | Soil | FFWLVVIILAIILLAFIVHWAGGGALNLRLGHFILDVGFT |
| Ga0210401_101324032 | 3300020583 | Soil | VFFFWVVIVILAIILLAAVVHWAGGGALNVRLGHFDLDVGFT |
| Ga0179596_100082354 | 3300021086 | Vadose Zone Soil | VFFFWLVVVILAIILLAYIVHLAGGGDVNLRLGHFILNVGFT |
| Ga0210400_104346412 | 3300021170 | Soil | VFFFWLVVAILIIILLAFIVHWAGGGVLNLRLGHFILNIGFT |
| Ga0210400_107421441 | 3300021170 | Soil | VIVLAIILLAWIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0210400_110129802 | 3300021170 | Soil | WLVVVILAIILLAFIVHWAGGAALDLRLGHFILNVGFN |
| Ga0210405_100138604 | 3300021171 | Soil | VVFFFWLVVVILAIILLAFIVNWAGGGALDLRLGHFFLNVGFT |
| Ga0210408_100767442 | 3300021178 | Soil | VFFFWLVIVILVIILLAYIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0210396_100552573 | 3300021180 | Soil | VFFFWLVVAILAIILLAFIVHWAGGGVMNLRLGHFVLNVGFT |
| Ga0210396_103175202 | 3300021180 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGQLDLRLGHFVLDVGFT |
| Ga0210396_104209572 | 3300021180 | Soil | VFFFWVVIVILAIILLAAIVHWAGGGALNVRLGHFDLDVGFT |
| Ga0210396_110753851 | 3300021180 | Soil | MFFIWLVVVILAIFLLAALVHWAGGGVLTLRLGHFHLNVGFT |
| Ga0210388_105441591 | 3300021181 | Soil | VLFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFILNVGFN |
| Ga0213881_100003677 | 3300021374 | Exposed Rock | VFFFWLVVVILAIILLAFIVHWAGGGALNLRLGHFVLDVGFT |
| Ga0213881_100024799 | 3300021374 | Exposed Rock | VFFFWLVVVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0210393_108163671 | 3300021401 | Soil | MFFIWVVLVILAIILLAAIVHWAGGGALNIRLGHFFLNVGFT |
| Ga0210385_101195912 | 3300021402 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGSLDLHLGHFVLDVGFT |
| Ga0210385_107692651 | 3300021402 | Soil | FFFWVVVVILAIILLAFIVHWAGGGVLNLRVGHFILNVGFT |
| Ga0210385_109303391 | 3300021402 | Soil | VFFFWLVVAIIAIILLARVVNWAGGGEMHLRIGHFSLS |
| Ga0210389_106632821 | 3300021404 | Soil | WLVVVILAIFLLAAIVHWAGGGVLNLRLGHFILNVGFN |
| Ga0210387_100447782 | 3300021405 | Soil | VFFFWLVVAILAIILLAFIVHWAGGGALNVRLGHFVLNVGFT |
| Ga0210387_101883852 | 3300021405 | Soil | VFFFWLVVVILAIIFLAFIVHWAGGGLLDLRLGHFILNVGFN |
| Ga0210387_110098252 | 3300021405 | Soil | LVITILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT |
| Ga0210387_113116731 | 3300021405 | Soil | PGIVVFFFWLVVVILAIILLAAVVHWAGGGSLDLRLGHFVLDVGFT |
| Ga0210386_112990652 | 3300021406 | Soil | IVFFFWVVIVILAIILLAAIVHWAGGGALNVRLGHFDLDVGFT |
| Ga0210383_105961981 | 3300021407 | Soil | FWLVVVILAIILLAYIVHWAGGGQLDLRLGHFVLDVGFT |
| Ga0210384_114958691 | 3300021432 | Soil | FFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0210392_101058681 | 3300021475 | Soil | GGYAIPAIVVLFFWLVVVILLAFIVHWAGGGALNLRLGHFVLNVGFT |
| Ga0210392_102183902 | 3300021475 | Soil | VVAILIIILLAFIVHWAGGGTLNLRLGHFILDVGFT |
| Ga0210398_113326101 | 3300021477 | Soil | VFFFWLVVVILAIILLAFIVNWAGGAVMNLRLGHFILNVGFT |
| Ga0210402_106173032 | 3300021478 | Soil | WLVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0210410_104992123 | 3300021479 | Soil | FWLVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0210410_114761392 | 3300021479 | Soil | VFFWVVIVVLAIILLAAIVHWAGGGALNLRLGHFDLDVGFT |
| Ga0210409_100914632 | 3300021559 | Soil | MFFFWVVVVILAIIVLAFLVHWAGGGVLNLRLGHFILNVGFT |
| Ga0126371_101695574 | 3300021560 | Tropical Forest Soil | VVFFFWIVLIILAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT |
| Ga0126371_101801694 | 3300021560 | Tropical Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFTLNVGFN |
| Ga0126371_102349402 | 3300021560 | Tropical Forest Soil | VVIAILAIILLAFILHWADGRVLHLRLGYFLLNVGFT |
| Ga0126371_102658092 | 3300021560 | Tropical Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0126371_106412903 | 3300021560 | Tropical Forest Soil | VLFFAWLALIVLAIILLAWIVHWAGGGVAHVRIGHFILQIGFT |
| Ga0126371_111201132 | 3300021560 | Tropical Forest Soil | VVVVILAIILLAFIVHWAGGGVLNLRLGHFNLDVGFT |
| Ga0126371_111565682 | 3300021560 | Tropical Forest Soil | IVVFFFWMVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0126371_119444672 | 3300021560 | Tropical Forest Soil | VVVILAIILLAFIVHWAGGGVLNLRLGHFNLDVGFT |
| Ga0126371_125036841 | 3300021560 | Tropical Forest Soil | MFFFWLVVVILAIILLAFVIHWAGGASLDLHLGHFTLNVGFT |
| Ga0126371_132675572 | 3300021560 | Tropical Forest Soil | FFFWVVVVILAIILLASIVHWAGGGILHLRVGHFVLDVGFT |
| Ga0126371_133576171 | 3300021560 | Tropical Forest Soil | WVVVIILAIILLAFIVHWAGGGVLNLRLGHFVLNIGFT |
| Ga0224712_100325821 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFFWLVAVILAIILLAFIVHWAGGAAFDLRLGHFNMNVGFT |
| Ga0242671_10225091 | 3300022714 | Soil | VFFFWLVVAILIIILLAKVVNWAGGGEMHLRLGHFSLNAGFT |
| Ga0224549_10448042 | 3300022840 | Soil | VFFFWLVVVILAIILLAYIVHWAGGAILNLRLGHFALSVGFT |
| Ga0247693_10063801 | 3300024181 | Soil | VVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT |
| Ga0224568_10102952 | 3300024220 | Plant Litter | LVVLAIIVLAFIVHWAGGGALNLRLGHFYLNVGVT |
| Ga0247691_10580231 | 3300024222 | Soil | VVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT |
| Ga0247677_10670551 | 3300024245 | Soil | VVVILVIILLAYIVHWAGGAVLHLRLGHFDMDVGFT |
| Ga0247661_10105781 | 3300024254 | Soil | FWLVVVILVIILLAFIVHWAGGGALNLRLGHFVLNVGFT |
| Ga0179589_100663342 | 3300024288 | Vadose Zone Soil | LVVVILVIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0179589_100680652 | 3300024288 | Vadose Zone Soil | VFFFWVVVVILVIILLASIVHWAGGGVLNLRLGHFHLNVGFT |
| Ga0247660_10097121 | 3300024317 | Soil | VVIVAIILLAFIVHWAGGAALNLRLGHFHLIVGFT |
| Ga0137417_13056413 | 3300024330 | Vadose Zone Soil | VVVILAIFLLAFIVHWAGGGVLHLRLGHFILNVGFT |
| Ga0179591_11983352 | 3300024347 | Vadose Zone Soil | VFFFWLVVTILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0207653_104479281 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | FWVVIVILAIILLAYIVHRAGGGVLNLRLGHFVLNVGFT |
| Ga0207692_102013501 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VVFFFWLVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0207699_101591631 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | FFWLVVVILVIILLAFIVHWAGGGQLNLRLGHFVLDVGFN |
| Ga0207699_101951552 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVIILAIILLAFIVHWAGGAAFALRLGHFNMNIGFT |
| Ga0207699_102233493 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0207643_110285441 | 3300025908 | Miscanthus Rhizosphere | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHF |
| Ga0207684_100357192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVVILAIILLAYIVHWAGGGVLNLRVGHFVLNIGFT |
| Ga0207684_102598421 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLFFAWLVLIVLAIILLAWIVHWAGGGIAHIRLGHFILDVGFT |
| Ga0207684_116171922 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT |
| Ga0207693_100098538 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | WVVVVIVAIILLAFIVHWAGGAALNLRLGHFHLIVGFT |
| Ga0207693_100949853 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | WVVVVIVAIILLAFIVHWAGGAALNLRLGHFHLVVGFT |
| Ga0207693_107750402 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVAILAIILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0207663_100159991 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | WMVVIILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0207652_117958601 | 3300025921 | Corn Rhizosphere | FFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDMDVGFT |
| Ga0207646_101170566 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVAILVIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0207646_102871982 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VFFFWLVVTILAIILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0207706_101026321 | 3300025933 | Corn Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDM |
| Ga0207711_120672901 | 3300025941 | Switchgrass Rhizosphere | VFFFWLVVVILVIILLAYIVHWAGGGVLHLRLGDFDMDVGFT |
| Ga0207658_109511871 | 3300025986 | Switchgrass Rhizosphere | VVILVIILLAYIVHWAGGAVLHLRLGHFDMDVGFT |
| Ga0209473_11513661 | 3300026330 | Soil | VFFFWLVVIILVIILLAFIVHWAGGGVMNLRLGHFVL |
| Ga0257147_10281702 | 3300026475 | Soil | VFFFWLVVTILAIILLAFIVHWAGGGLLNLRLGHFVLNVGFT |
| Ga0257160_10183101 | 3300026489 | Soil | VFFFWVVVVILVIILLASIVHWAGGGVLNLRLGHFHLNVGF |
| Ga0257160_10990061 | 3300026489 | Soil | FFLWVVVVILAIIVLAFLVHWAGGGVLNLRLGHFILNVGFT |
| Ga0257156_10400142 | 3300026498 | Soil | FWVVLVILAIILLAFIVHSAGGGLLNLRVGHFVLNVGFT |
| Ga0209156_103064761 | 3300026547 | Soil | VFFFWLVVIILVIILLAFIVHWAGGGVMNLRLGHFVLNVGFT |
| Ga0179593_10079312 | 3300026555 | Vadose Zone Soil | VFFFWLVVVILAIILLAFIVHWAGGAVLNLRLGHFMLNVGFT |
| Ga0179593_10138833 | 3300026555 | Vadose Zone Soil | VFFFWLVVVILAIILLAFVVHSAGGGLLNLRLGHFVLNVGFN |
| Ga0208730_10098702 | 3300027047 | Forest Soil | VFFFWVVIVILAIILLAAIVHWAGGGALNVRLGHFDLNVGFT |
| Ga0208099_10179692 | 3300027096 | Forest Soil | VFFFWVVIVILAIILLAFIVHWAGGGELNLRLGHFILDVGFT |
| Ga0209418_10052131 | 3300027371 | Forest Soil | VFFFWVVIVILAIILLAAVVHWAGGGALNVRLGHFDLD |
| Ga0209008_10784432 | 3300027545 | Forest Soil | VFFFWVVIVILAIILLAAVVHWAGGGALNLRLGHFDLDVGFT |
| Ga0209626_10124142 | 3300027684 | Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGGLLDLRLGHFILNVGFN |
| Ga0209178_11906701 | 3300027725 | Agricultural Soil | FWLVVVILVIILLAYIVHWAGGGVLHLRLGHFDLNVGFT |
| Ga0209060_101040832 | 3300027826 | Surface Soil | VFFFWVVIVVLAIILLAAIVHWAGGGTLNLRLGHFDLDVGFT |
| Ga0209180_100181192 | 3300027846 | Vadose Zone Soil | MPSPAFVAFFWVVVVILAIILLAFIVHWVGGGVLKLRLGDFVLNVGFT |
| Ga0209180_104758481 | 3300027846 | Vadose Zone Soil | VFFFWLVVVILAIILLAFIVHWAGGGVLNLRLGHFTLNVGFT |
| Ga0209693_100327681 | 3300027855 | Soil | WLVVAILAIILLAFIVHWAGGAVLNLRLGHFVLNVGFT |
| Ga0209693_102922221 | 3300027855 | Soil | MFFIWVVVVILAIILLAFIVHWAGGGALDLRLGHFFLNVGFT |
| Ga0209166_100287053 | 3300027857 | Surface Soil | VFFFWVVIVVLAIILLAAIVHWAGGGALNLRLGHFDLNVGFT |
| Ga0209166_103752381 | 3300027857 | Surface Soil | VVVLAIILLAAIVHWAGGGVLNLRLGHFTLDVGFT |
| Ga0209590_101088822 | 3300027882 | Vadose Zone Soil | MVVILAIILLAFIVHWAGGAVLNLRLGHFQLNVGFT |
| Ga0209590_102626253 | 3300027882 | Vadose Zone Soil | FWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT |
| Ga0209275_101867332 | 3300027884 | Soil | LVVCIVAIILLARLVHWAGGGVGNVRLGHFFLNVGFT |
| Ga0209380_105878702 | 3300027889 | Soil | VVVLVIILLAFIVHWAGGGDLNLKLGHFVLNVGFT |
| Ga0209624_100318743 | 3300027895 | Forest Soil | VFFFWLVVVILVIILLAFIVHWAGGGALSLRLGHFFLNVGFT |
| Ga0209488_105242542 | 3300027903 | Vadose Zone Soil | VLFFIWLVVVVLAIILLAFIVHWAGGGLLDLRLGHFV |
| Ga0209006_100845573 | 3300027908 | Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGGRLDLRLGHFVLDVGFT |
| Ga0209006_114844132 | 3300027908 | Forest Soil | VFFFWLVVVILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0209168_103912112 | 3300027986 | Surface Soil | LVVVILVIILLAFIVHWAGGGQLNLRLGHFILDVGFT |
| Ga0265322_100033705 | 3300028654 | Rhizosphere | VVFFFWLVVVILAIILLAFIVHWAGGAQLNLRLGHFVLDVGF |
| Ga0307311_101856231 | 3300028716 | Soil | VFFFWLVVVILVIILLAYVVHWAGGGVLHLRLGHFDMNVGFT |
| Ga0302232_105344312 | 3300028789 | Palsa | VVFFFWLVVVILAIILLAYIVHWAGGAVLNLRLGHFVLDVGFT |
| Ga0265338_1000076513 | 3300028800 | Rhizosphere | VFFFWLVVVIVAIFLLAFIVHWAGGGLLDAKLGHFFLNVGFN |
| Ga0302226_102622181 | 3300028801 | Palsa | VFFFWLVVAILAIILLAFIVHWAGGGELNLRLGHFVLNVGFT |
| Ga0302228_103852151 | 3300028808 | Palsa | VWFFIWVVICILAILLLAFIVNWAGGGQLDLRLGHFFLNVGFN |
| Ga0311340_100894902 | 3300029943 | Palsa | VLFFWLVVVILAIILLAYIVHWAGGAVLNLRLGHFVLDVGFT |
| Ga0311340_102694663 | 3300029943 | Palsa | VFFFWLVIVILAIILLAFIVHWAGGGQLDLRLGHFVLDVGFT |
| Ga0311340_105428932 | 3300029943 | Palsa | VFFFWLVVVILAIILLAYIVHWAGGAVLNLRLGDFALSVGFT |
| Ga0311352_102320073 | 3300029944 | Palsa | VFFFWLVVVILAIILLAAVVHWAGGGSLDLRLGHFVLDVGFT |
| Ga0311339_114326102 | 3300029999 | Palsa | VFFFWLVVAILAIILLAFIVHWAGGGDMDLRLGHFVLNVGFT |
| Ga0302178_104881642 | 3300030013 | Palsa | VVFFFWLVVAILAIILLAFIVNWAGGAILNLRLGHFVLNVGFT |
| Ga0311344_114169301 | 3300030020 | Bog | VFFFWLVIVILAIIVLAFIVHWAGGAVLDLRLGHFHLDVGFT |
| Ga0311372_102036763 | 3300030520 | Palsa | VFFFWVVVAIIVIILLAKVVNWAGGGEMRLHIGHFILNAGFN |
| Ga0311372_106908922 | 3300030520 | Palsa | VFLFWLVVAILAIILLAYVVHWAGGGVLDLRLGHFTLNVGFT |
| Ga0311372_114972702 | 3300030520 | Palsa | VVFFFWLVVVILAIILLAAVVHWAGGGELNLRLGHFVLDVGFT |
| Ga0311372_130265211 | 3300030520 | Palsa | LVAVIVVIFILAAIVHWAGGGLLNAKLGHFYLNVGFT |
| Ga0311357_116564251 | 3300030524 | Palsa | LVVVILAIILLAYIVHWAGGAVLNLRLGHFVLDVGFT |
| Ga0311354_103399223 | 3300030618 | Palsa | LVVCIVAIILLARLVHWAGGGVGNIKLGHFFLNVGFT |
| Ga0302311_109178911 | 3300030739 | Palsa | FIWLVVVILAIILLAFIVHWAGGGQLDLRLGHFILDVGFT |
| Ga0074020_111234821 | 3300030840 | Soil | FFIWLVVVILAIILLAFIVHWAGGGQLDLRLGHFILDVGFT |
| Ga0265753_10083911 | 3300030862 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGALNLRLGHFFLNV |
| Ga0075386_119926931 | 3300030916 | Soil | VFFFWVVVVVLAIILLAWIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0170834_1065071811 | 3300031057 | Forest Soil | VFFFWLVVVILAIVLLAFIVHEAGGGVLNLRLGHFVLNLGFT |
| Ga0170824_1164166532 | 3300031231 | Forest Soil | VFFLWVVVVILAIIVLAFLVHWAGGGVLNLRLGHFILNIGFT |
| Ga0170824_1185446902 | 3300031231 | Forest Soil | VVVLAIILLAWIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0170824_1219703612 | 3300031231 | Forest Soil | WVVVVILAIIVLAFLVHWAGGAVLNLRLGHFILNVGFS |
| Ga0302325_112206261 | 3300031234 | Palsa | VFFFWLVVAILAIILLAYVVHWAGGGVLDLRLGHFTLNVGFT |
| Ga0302325_112833031 | 3300031234 | Palsa | ICILAILLLAFIVNWAGGGQLDLRLGHFFLNVGFN |
| Ga0170819_143060391 | 3300031469 | Forest Soil | VLFFAWLVLIILAIIQLAWIVHWAGRGIAHIRLGHFILDVGFT |
| Ga0170818_1097903422 | 3300031474 | Forest Soil | FFWVVVVILAIIVLAFLVHWAGGAVLNLRLGHFILNVGFS |
| Ga0318516_101149272 | 3300031543 | Soil | VFFFWLVVVILAIILLAFIVHWAGGAALNLRLGHFTLNVGFT |
| Ga0318516_102955101 | 3300031543 | Soil | VFFFWLVVAILAIILLAFIVHRAGGGVLNLRLGHFVLNVGFT |
| Ga0318534_101103082 | 3300031544 | Soil | MVFFFWVVVIILAIILLAFIVHWAGGGVLNLRLGHFGLNVGFT |
| Ga0318541_106950041 | 3300031545 | Soil | MVFFFWVVVIILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0318528_100579831 | 3300031561 | Soil | VVVVILAIILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0318573_101916532 | 3300031564 | Soil | VFFFWLVVAILAIILLGFIVHRAGGGVLNLRLGHFVLNVGFT |
| Ga0318515_100923331 | 3300031572 | Soil | VVVILAIILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0310915_105213441 | 3300031573 | Soil | VVVIMAIILLAYIVHWAGGGVLNLRIGHFVLNVGFT |
| Ga0318555_105822491 | 3300031640 | Soil | FFFWVVVIILAIILLAFIVHWAGGGVLNLRLGHFGLNVGFT |
| Ga0318542_103612561 | 3300031668 | Soil | MVFFFWVVVVILAIILLASIVHWAGGGVLHLRVGHFVLDVGF |
| Ga0318542_104169862 | 3300031668 | Soil | VFFFWVVVVILAIILLAFIVHWAGGGVLSLRLGHFAMNVGFT |
| Ga0318542_106274541 | 3300031668 | Soil | FWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLDVGFT |
| Ga0307372_102277981 | 3300031671 | Soil | WVVVAILAIILLAFIVHWAGGGELNLRLGHFFLNVGFT |
| Ga0318574_108208602 | 3300031680 | Soil | VFFFWVVIVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT |
| Ga0318572_102724801 | 3300031681 | Soil | WVIVAILAAILLALIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0310686_1042001701 | 3300031708 | Soil | VVVVILAIILLGAIVHWAGGGELNLHIGHFVLDVGFT |
| Ga0310686_1050704022 | 3300031708 | Soil | WLVVVILAIILLAFIVHKVGGAVMDLRLGHFILNVGFN |
| Ga0310686_1065039162 | 3300031708 | Soil | VAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0310686_1068926682 | 3300031708 | Soil | IVVLAIILLAAIVHWAGGGALNLRLGHFDLDVGFT |
| Ga0310686_1078159081 | 3300031708 | Soil | VFFFWVVVVILAIILLAFIVHWAGGGVLNLRVGHFILNVGFT |
| Ga0310686_1118789291 | 3300031708 | Soil | MFFIWDVVVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0310686_1149293232 | 3300031708 | Soil | VFFFWLVVVILAIILLAYIVHWAGGAVLNLRLGHFVLNVGFT |
| Ga0310686_1178277626 | 3300031708 | Soil | VFFFWLVVVILIIILLAFIVHWAGGGALNLRLGHFFLDVGFT |
| Ga0306917_102926672 | 3300031719 | Soil | VAILAAILLALIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0306917_108430743 | 3300031719 | Soil | VVILAIILLASIVHWAGGGVLHLRVGHFVLDVGFS |
| Ga0318500_101265851 | 3300031724 | Soil | FFFWLVVVILAIILLAFIVHWAGGAALNLRLGHFTLNVGFT |
| Ga0318501_105943311 | 3300031736 | Soil | IVLAIILLAFIVHWAGGGALNLRLGHFVLDVASPDRRG |
| Ga0318502_100325584 | 3300031747 | Soil | IPGIVVFFFWVVVVILGIMLLASIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0307477_103871901 | 3300031753 | Hardwood Forest Soil | LFFIWLVAVVLVIILLAYIVHWAGGGLLNLRLGHFVLDVGVN |
| Ga0318535_100180873 | 3300031764 | Soil | VAILAIILLAYIVHWAGGGVLNLRLGHFVLNVGFS |
| Ga0318554_104553282 | 3300031765 | Soil | FFWVVVIILAIILLAFIVHWAGGGVLNLRLGHFGLNVGFT |
| Ga0318526_100603633 | 3300031769 | Soil | VFFFWLVVVILAIILLAFIVHWAGGAALNLRLGHFTLN |
| Ga0318526_100937502 | 3300031769 | Soil | IAILAIILLAFIVHWAGGGALNLKLGHFALNVGFT |
| Ga0318526_104244611 | 3300031769 | Soil | VVFFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFR |
| Ga0318546_107168931 | 3300031771 | Soil | FFWLVVVILAIILLAFIVHWAGGAALDLRLGHFTLNVGFN |
| Ga0318546_109851332 | 3300031771 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGALNLRLGHFF |
| Ga0318498_101292162 | 3300031778 | Soil | VFFFWVVVVIVAIILLAFIVHWAGGGALSLRLGHFVLNVGFT |
| Ga0318547_108646731 | 3300031781 | Soil | IPGIVVFFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFR |
| Ga0318503_102579462 | 3300031794 | Soil | VFFFWVVVVIVAIILLAFIVHWAGGGALSLRLGHFVLNV |
| Ga0318557_104127791 | 3300031795 | Soil | FWVVVVILAIILLASIVHWAGGGVLHLRVGHFVLDVGFT |
| Ga0318523_100735871 | 3300031798 | Soil | FFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFR |
| Ga0318497_107463512 | 3300031805 | Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFNMNVG |
| Ga0307478_106856831 | 3300031823 | Hardwood Forest Soil | FFWVVVVILAIILLAAVVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0307478_110466141 | 3300031823 | Hardwood Forest Soil | FWLVVVILAIILLAYIVHWAGGGTLDLRLGHFVLDVGFS |
| Ga0310917_100617922 | 3300031833 | Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFTLNVGFT |
| Ga0318517_103662252 | 3300031835 | Soil | VAGYAIPGIAVFFFWLVVVILAIILLAFIVHWAGGGALNLRLGHFVLTVGFT |
| Ga0318495_104163183 | 3300031860 | Soil | FFFWVVIVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT |
| Ga0306919_112090911 | 3300031879 | Soil | IVFFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0306925_109846211 | 3300031890 | Soil | FWVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFR |
| Ga0318536_106724851 | 3300031893 | Soil | VVVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT |
| Ga0318551_104050121 | 3300031896 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGALNLRLGHF |
| Ga0318520_105331052 | 3300031897 | Soil | VFFFWLVVVILAIILLAFIVHWAGGAALDLRLGHFNMNVGFT |
| Ga0310910_111052021 | 3300031946 | Soil | FWVVVVILAIILLASIVHWAGGGVLHLRAGHFVLNVGFT |
| Ga0306926_100482591 | 3300031954 | Soil | VFFFWVVVVILACILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0306926_115505372 | 3300031954 | Soil | VVVILAIMLLAFIVHWAGGGVLDLRLGHFVLNIGFT |
| Ga0307479_100955483 | 3300031962 | Hardwood Forest Soil | VFFFWLVVVILAIILLAFVVHWAGGGVLNLRLGHFVLNIGFT |
| Ga0307479_108879381 | 3300031962 | Hardwood Forest Soil | FWLVVTILVIILLAFIVHWAGGGLLNLRLGHFVLNVGFT |
| Ga0318531_102968421 | 3300031981 | Soil | FFWVVVVILGIMLLASIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0318531_103347051 | 3300031981 | Soil | WVVVVILAIILLAFIVHWAGGGALDLRLGHFVLNVGFN |
| Ga0306922_105346443 | 3300032001 | Soil | WVVVAILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFR |
| Ga0306922_122894171 | 3300032001 | Soil | VVILAIILLAFIVHWAGGGALDLRLGHFNLNVGFT |
| Ga0318563_102837932 | 3300032009 | Soil | VFFFWLVVAILAIILLAFIVHRAGGGVLNLRLGHFV |
| Ga0318563_104206202 | 3300032009 | Soil | VVVVILACILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0318569_104730541 | 3300032010 | Soil | FFWVVVVILAIILLAFIVHWAGGGALDLRLGHFELNVGFN |
| Ga0318559_104795442 | 3300032039 | Soil | VVVIVAIILLAFIVHWAGGGALSLRLGHFVLNVGFT |
| Ga0318558_103244171 | 3300032044 | Soil | FFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLDVGFT |
| Ga0318505_103306772 | 3300032060 | Soil | VVILAIMLLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0318504_100481643 | 3300032063 | Soil | VIAILAIILLAFIVHWAGGGALNLKLGHFALNVGFT |
| Ga0318504_105980461 | 3300032063 | Soil | FFFWVVVVILAIILLAFIVHWAGGGVLNLRLGHFDLDVGFT |
| Ga0318514_105915552 | 3300032066 | Soil | VVIVILAIILLAFIVHWAGGGVLNLRLGHFDLNVGFT |
| Ga0318524_102297903 | 3300032067 | Soil | VFFFWLVAVILAIILLAFIVHWAGGGVLSLRLGHFVLNVGFT |
| Ga0308173_100740872 | 3300032074 | Soil | VFFFWLVVIILAIILLAFIVHWAGGAAFALRLGHFNMNVGFT |
| Ga0308173_103218441 | 3300032074 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFQ |
| Ga0318577_104669961 | 3300032091 | Soil | GVFFFWVVVVILGIMLLASIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0311301_102598701 | 3300032160 | Peatlands Soil | VLFFVWLVLIILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0311301_111051834 | 3300032160 | Peatlands Soil | IPGIVVFFFWLMVTIVAIILLAYIVHWAGGGQLDLRLGHFVLDVGFT |
| Ga0306920_1002177661 | 3300032261 | Soil | IIEFFFWVVVVIVAIILLAFIVHWAGGGALSLRLGHFVLNVGFT |
| Ga0315741_118573081 | 3300032739 | Forest Soil | PGVIVFFFWLVVVILAIILLAWVVNWAGGGSMDLRLGHFFLNVGFT |
| Ga0335085_101505501 | 3300032770 | Soil | VFFFWLVAVILAIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0335082_101276401 | 3300032782 | Soil | VFFFWVVVPILAIILLAFIVHWAGGGVLNLRLGHFNLNVGFT |
| Ga0335079_100104487 | 3300032783 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGVMNLRLGHFVLNVGFT |
| Ga0335079_100188875 | 3300032783 | Soil | VFFFWLVVAILAIILLAWIVHKAGGGVLTLRLGHFVLNVGFT |
| Ga0335078_100312099 | 3300032805 | Soil | VFFFWLVAVILAIILLAFIVHWAGGGALNLRLGHFFLNVGFT |
| Ga0335080_100215113 | 3300032828 | Soil | VFFFWLVVVILVIILPAYIVHWAGGGVLHLRLGHFDLNVGFT |
| Ga0335080_119518001 | 3300032828 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFVLNVGFT |
| Ga0335081_101852352 | 3300032892 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGALDLRLGHFFMNVGFT |
| Ga0335081_120530591 | 3300032892 | Soil | MFFIWLVLAILAIILLAFIVHRAGGGVLNLRLGHFVLNVGFT |
| Ga0335074_100594642 | 3300032895 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGVLDLRLGHFVLNVGFT |
| Ga0335074_102641642 | 3300032895 | Soil | MFFFWVVVAILAIILLAFIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0335075_101705202 | 3300032896 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGVLNLRLGHFILNVGFT |
| Ga0335075_101732642 | 3300032896 | Soil | VFFFWLVIAILAIIVLAFVVHWAGGAALSLHLGHFSLNVGFS |
| Ga0335075_105388001 | 3300032896 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGVLDLRLGHFILN |
| Ga0335075_108919952 | 3300032896 | Soil | VFFFWLVIVILAIILLAFIVHWAGGGAMDLRLGHFFLDVGFT |
| Ga0335072_100239224 | 3300032898 | Soil | VFFFWLVIAILAIIVLAFVVHWAGGAALSLRLGHFSLNVGFS |
| Ga0335072_102145602 | 3300032898 | Soil | VFFFWLVVVILVIILLAFIVHWAGGGALDLRLGHFFLNVGFT |
| Ga0335073_100073563 | 3300033134 | Soil | VFFFWLVVVILAIILLAFIVHWAGGGMLDVRLGHFVLNVGFT |
| Ga0335073_119244371 | 3300033134 | Soil | VFFFWLVIAILAIIVLAFVVHWAGGAALSLRLGHFSLNVGFT |
| Ga0335077_100015351 | 3300033158 | Soil | MVFFFWLVVVILAIILLAFIVHWAGGGALDLRLGHFFMNVGFT |
| Ga0310914_101391991 | 3300033289 | Soil | VFFFWVVVVILAIILLAFIVHWAGGGALDLRLGHFVLNVGFN |
| Ga0310914_117598301 | 3300033289 | Soil | MVFFFWVVVIILAIILLAFIVHWAGGGVLNLRLGHFGLNV |
| ⦗Top⦘ |