Basic Information | |
---|---|
Taxon OID | 3300009679 Open in IMG/M |
Scaffold ID | Ga0115105_10623034 Open in IMG/M |
Source Dataset Name | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 532 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 33.2898 | Long. (o) | -129.427 | Alt. (m) | Depth (m) | 100 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004250 | Metatranscriptome | 446 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115105_106230342 | F004250 | GGCGG | MVVYKHFTDDQGGDPTKQFLALIAIQMLPLVFLEMKILSCPDPVGMLSRFGTKVLLMHGCFLALRVCAWPLLEIGLGFCNVLALAGVCVALRWGFRFRCSSISAHWDICGLLLIAIAGAFFTEILDFHRQANLLECTIFTASSYME |
⦗Top⦘ |