7000000334: Human stool microbial communities from NIH, USA - visit 1, subject 764143897

Overview

Basic Information

• IMG/M Taxon OID: 7000000334
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063646 | Gp0052872 | Ga0030487
• Sample Name: Human stool microbial communities from NIH, USA - visit 1, subject 764143897
• Sequencing Status: Permanent Draft
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 162323102
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076190	Metagenome	118	Y
F099269	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
C2298504	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella	799
C2310778	All Organisms → cellular organisms → Bacteria	900

Sequences

Scaffold ID	Protein ID	Family	Sequence
C2298504	C2298504__gene_193151	F099269	MQKEASAAMRKPPFFVHGVLLSVQVGELLLLDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCAPV
C2310778	C2310778__gene_198653	F076190	WNGRSSWVRTAGGSITISVKNVFTAASRVSGRVWSLVRITVPNDLKFVGIRVEKPQNNSLYSYFQREPL