NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 7000000327

7000000327: Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159207311



Overview

Basic Information
IMG/M Taxon OID7000000327 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052855 | Ga0027997
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit 2, subject 159207311
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size18872291
Sequencing Scaffolds4
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip21
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F101357Metagenome / Metatranscriptome102N
F103436Metagenome101Y
F105375Metagenome100N
F105380Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
C1182858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus909Open in IMG/M
C1185494All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctHip21270Open in IMG/M
C1187897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii2458Open in IMG/M
C1188823All Organisms → cellular organisms → Bacteria4260Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
C1182858C1182858__gene_29667F103436MIVASKKSWCDKSESEIFDGLRDWILTCDLKYPKDDALGKIARASALWGGADYVTAVHLLDENEPYFKK
C1185494C1185494__gene_31588F105380LQTAITNGLTITGLASEFKMKHYSFWVPDLYFISYSSFNPNSDLYIAYRSKDAKKICLTNIWSGSGNVDFYSPNGSRLVYNRLCKGRMMDDISADDYEAWKRTPVNRASNFVNKFISARGNSDLDFISNSIRSNVANNIKGYAEFLASITKEQENVNTYEEFIEWTKNTNWLK
C1187897C1187897__gene_33659F105375MKNNETFQTTQHLDKLVTNLGLQIQELFSLDLEEILNYSNNLMNLLVNAYVENQCLALSAMISKQDGFAIYSFLFQTPDTSNGAADALVNFAMNFTDGEANIKSINRISSSIMQITFTV
C1187897C1187897__gene_33662F101357MNLNNIATALKTGITIYQYEQWQNTGSVNLMQKESHMLSKVWLKTNIHNPDSLDKPFIQLSATFTSESDIQEYNEWLASNQYKLYPLLLDILKISLKDGFHNYANTSNTHYEGGKFPSMLTIQLFNLEF
C1188823C1188823__gene_34721F032312MARIKDYDEDLSAPKLLKERARDNKGRFIKKDLPPYLGAEQVLKPKNYYHFDSHGNYKGSSMNFDAMVCLGFTWFKLLGVALMMLLWPIVFIYALHDGIEGYPFKKYAIPYIFILVAWFIIFLYGLVS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.