Basic Information | |
---|---|
IMG/M Taxon OID | 3300033554 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133511 | Gp0348944 | Ga0326735 |
Sample Name | Glacier ice microbial communities from Ngari, Tibet, China - 37_GP2_109.2 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 365686799 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Extreme Environments Viral Communities From Various Locations |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Freshwater → Ice → Glacier → Ice → Extreme Environments Viral Communities From Various Locations |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | aquatic biome → glacier ice field → ice |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Ngari, Tibet | |||||||
Coordinates | Lat. (o) | 35.2833 | Long. (o) | 81.4833 | Alt. (m) | N/A | Depth (m) | 109 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038578 | Metagenome / Metatranscriptome | 165 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0326735_1085577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 892 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0326735_1085577 | Ga0326735_10855772 | F038578 | MSEELVVLRGGSRDGESTRVQDGVRRILAASDAPGLLDVYEANGETAELAGNDELALVMIHVGQEPAGDDPGLPRGLE |
⦗Top⦘ |