NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300033164

3300033164: Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_12_05 R3



Overview

Basic Information
IMG/M Taxon OID3300033164 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0136119 | Gp0356210 | Ga0334894
Sample NameSludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_12_05 R3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size296536633
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium1
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin0091
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationNetherlands: Wageningen, Gelderland
CoordinatesLat. (o)51.9691Long. (o)5.6654Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031354Metagenome / Metatranscriptome182Y
F055749Metagenome / Metatranscriptome138N
F061390Metagenome / Metatranscriptome132Y
F072892Metagenome121N
F089495Metagenome / Metatranscriptome109N
F103496Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0334894_1009751All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium3718Open in IMG/M
Ga0334894_1012396All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin0093020Open in IMG/M
Ga0334894_1028536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1490Open in IMG/M
Ga0334894_1032355Not Available1343Open in IMG/M
Ga0334894_1047626Not Available973Open in IMG/M
Ga0334894_1105429Not Available511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0334894_1009751Ga0334894_10097516F072892LAQFKSIVSDLETNNTLDNREWAGELLNNLATELYYEANCLTDVLYPPRKEEKDETMFKIDGIIDAERNPMSEDEFFELFIKWAEENKLQFGGGIGAYREEEEDVLAGK
Ga0334894_1012396Ga0334894_10123961F055749MAKRAENPMNLIMIIAVGILTLTAIITVGPVVGGSIELAMPEVAADSPWNPSTNDNLPEGAATWTQLIPLVVLAV
Ga0334894_1028536Ga0334894_10285364F061390AQFGQRTVMEALEAKMMGNWSVIYFPDVDSWEVSDYGDRNFVIKDGGKCNCGKGFGKNGSCIHQVLVELKKWDLEDELGVE
Ga0334894_1032355Ga0334894_10323551F089495MGRPYLRKKHVTISLYDGTSTTPYTESITGYADVPELPEPVVDAPAEGYSPQGVFNSIEEGDDTITLPEFSITLDINDADVASGKYALDQWFNNHKESSGATALVSTNDGSAYLKKAIDGTTVSANLATDWFTIGMKVIFDTGGTGKAFGKNYKYVRPISASFSTSNKAQVTLRAQIVGAPTDIT
Ga0334894_1047626Ga0334894_10476262F031354MKTTFDISDILYPIINVTSVTSTIDGRVYRDKKPLNSELQDIVIIPLTNYNGDEIIQFPVYMVNCFCKNFDNGLPNITKLKTITDAVIKVIEDYSATSNYYVFEITNQTLMQDTDQISMSYVNLRINCYIEK
Ga0334894_1105429Ga0334894_11054292F103496MSINDSVRQMPLTKLIALCFTVFVCVLIVLDVTTLCPLTERSADLVKWLGSTIIVSYFGKSAYEHNVNVRKGEKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.