Basic Information | |
---|---|
IMG/M Taxon OID | 3300033157 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0141816 | Gp0395101 | Ga0369856 |
Sample Name | Human adult male fecal microbial communities from Ikoma, Japan - F1-S |
Sequencing Status | Permanent Draft |
Sequencing Center | The University of Tokyo |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 38008638 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Ikoma, Japan |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Adult Male Fecal → Human Fecal Microbial Communities From Ikoma, Japan |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Japan: Ikoma | |||||||
Coordinates | Lat. (o) | 34.7321 | Long. (o) | 135.7306 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078693 | Metagenome | 116 | N |
F092227 | Metagenome | 107 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0369856_100940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 3254 | Open in IMG/M |
Ga0369856_117995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1137 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0369856_100940 | Ga0369856_1009403 | F078693 | MVFAPMRGAERFFIKADCSLLMSKENQKSTSDFDALDPRERGYSPLSDPEGVVEAQKC |
Ga0369856_117995 | Ga0369856_1179952 | F092227 | MKEEKRKRILRVGCLILAGIFVLSMLGSVVMMLLV |
⦗Top⦘ |