NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032888

3300032888: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032888 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330582 | Ga0314728
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size27984871
Sequencing Scaffolds18
Novel Protein Genes19
Associated Families16

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum3
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2
Not Available6
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3951Long. (o)-85.3736Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001705Metagenome / Metatranscriptome648Y
F007513Metagenome / Metatranscriptome349Y
F009114Metagenome / Metatranscriptome322Y
F012944Metagenome / Metatranscriptome275Y
F023769Metagenome / Metatranscriptome208Y
F032517Metagenome / Metatranscriptome179Y
F034039Metagenome / Metatranscriptome175Y
F042712Metagenome / Metatranscriptome157Y
F047420Metagenome / Metatranscriptome149Y
F049431Metagenome / Metatranscriptome146N
F062397Metagenome / Metatranscriptome130Y
F067332Metagenome / Metatranscriptome125N
F069562Metagenome / Metatranscriptome123Y
F069582Metagenome / Metatranscriptome123N
F070755Metagenome / Metatranscriptome122Y
F074257Metagenome / Metatranscriptome119Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314728_100487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2259Open in IMG/M
Ga0314728_101761All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1575Open in IMG/M
Ga0314728_106619All Organisms → cellular organisms → Bacteria929Open in IMG/M
Ga0314728_107580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum872Open in IMG/M
Ga0314728_111208Not Available707Open in IMG/M
Ga0314728_111605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays694Open in IMG/M
Ga0314728_111644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima692Open in IMG/M
Ga0314728_111806Not Available687Open in IMG/M
Ga0314728_112083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum679Open in IMG/M
Ga0314728_112098All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae678Open in IMG/M
Ga0314728_114537Not Available612Open in IMG/M
Ga0314728_117119All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
Ga0314728_117536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum548Open in IMG/M
Ga0314728_117824Not Available543Open in IMG/M
Ga0314728_117930Not Available541Open in IMG/M
Ga0314728_119436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae516Open in IMG/M
Ga0314728_120363Not Available503Open in IMG/M
Ga0314728_120422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314728_100487Ga0314728_1004872F001705VTWDESVERDLKVWNIFKEIALDMSAWKLAINVPEP
Ga0314728_101761Ga0314728_1017611F032517MNLSLSSSSFDKIINPYYEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPVTNLMMPLMVTPYCTH
Ga0314728_106619Ga0314728_1066191F047420VNIAEKDLADLAFNGLRSHIKERLEGYDFFTVTQVHQKVFAIESRSKKPQESHRHHRSSVHILECNSDCSDDESKDVYAAEFAWPSQAKPFTCSALKPIQKNR
Ga0314728_107580Ga0314728_1075802F007513VVVTVLQRVVALPVVLLVVFSTAMDHETEALEEVLRLHAFLVVVFVSHAVDGMGDTLCLVLLTLL
Ga0314728_111208Ga0314728_1112081F069582FIGIACLLSVINIRTTDGVVFDIMTLCETPSVLMNLLRSRCVVALVKFLNVLATCRKYGT
Ga0314728_111605Ga0314728_1116052F042712MEYLFDESGRQKFLQLLADRPALELVEASQALLHRLGVGSDIKRVLGDLPRYARHVRGAPRKDICVGAEEIDEHHFLFVVEGGADLQHLAVGVARVE
Ga0314728_111644Ga0314728_1116441F049431HMTTGRINQVTILSPSAEAHERTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSTSTLQLPEGGQHRASRKESPSPK
Ga0314728_111806Ga0314728_1118061F067332MPPSIHVYCHIIMLANFGEDEIRRACIIISSCVEFLVVFLVHSILTRSLRAYIAVLKFCAALLSIQLLAIQIIFLEKLDYEKDMRNYRFTYYRNFNDLRGMFIWISRLNLALDPVPSMLIVTTQ
Ga0314728_112083Ga0314728_1120831F007513MEVRETVVVTVLQRVVALPAVLLVIFSTAMDHRTEALEEVLRLHAFLAVVIVSLPVDGTGDMLCLTLHTLL
Ga0314728_112098Ga0314728_1120981F023769KETLLTWSMPCADLHKNAFQRSSSRVAHVTRPVDNSTSGSTVKRCRDCLRGERDTKETIHNGLLLLRVRYGLPYAELPDCGPGDLSRFLSFLLLQGKERTSVAFPRRQRPGENGLCTMQRLCRRDRWALAHGCSSIKRNLPKGCFRHTPSVFAAWEAAALSQPPPLTSGYIEHVRRVVTGIFQPGWDKNYRSFVGSHVPNPSARACMTRADVLWRRRRDEFFTATT
Ga0314728_114537Ga0314728_1145371F009114MVPFQMYSSFKFYLSNEVSNELLPETKVVDLEILNNF
Ga0314728_117119Ga0314728_1171192F069562MGNYLTNLPLIALLLLDLLNSNLGPQLCESNAPKWLGEDVPKLSSCLDILELDLSTVDAITDEVILGVDVLAPVVVDMVLC
Ga0314728_117536Ga0314728_1175361F074257MGGVRIPVLFHWRESAEYDRAEFFSPKGKRVGVGSEKDKFSISLAISGRRISAELISPSCSRRAVSVLAGSIRWLEKPPDPLAMQTHEPNTKVVPALITGKLNSKDAIEFFC
Ga0314728_117824Ga0314728_1178241F062397MCMNGLRINMVLGPFFGLWPSSFSVLALDHGPRHFMLKNRPKTCKNEVPPKYMCKCENDQ
Ga0314728_117930Ga0314728_1179302F034039VQCLKVLGLNLRDPAVVVPDGVQVVANTTLDSVVVFHLTALADHVSPLVVIAFLKWDLACLVFFLTLFQGI
Ga0314728_119258Ga0314728_1192581F070755VAAPTSSAHSAEAPEIWLPLEVVGTKVVYIPSGAVLTYNLTAVAEADMWSDTVLVGTPADADKAHEGVRPESDETSD
Ga0314728_119436Ga0314728_1194361F001705VKRGRGRPKLTWDESFKRDLKDWNISKKIALDRSAWRLAINVSEP
Ga0314728_120363Ga0314728_1203631F069582SFVGIACLLSVINIRTTDWVVFDIMTSCETPSVLMNLLRSRCVVVLVKFLKVLVTCRKYGTRQA
Ga0314728_120422Ga0314728_1204221F012944EIEAKLEDNSSSTRTMIIFKPKPTRVGTLLAQPVFGLHNSSSAYKQMIGSIYENSLDHLLCGKNHSVTASREAPIFDIYPDPVESSQDSLDFITNALVKIQLESCESHTLAELLDNLRKVASIDDLPFQHSTPLVTERETRSGGTILADYESDMESFSPERLVPVII

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.