NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300031482

3300031482: Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R4 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300031482 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0132857 | Gp0330675 | Ga0314813
Sample NameMetatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - STER_R4 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10045722
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomelandbiofilm material
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Pennsylvania
CoordinatesLat. (o)40.7997Long. (o)-77.8629Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022207Metagenome / Metatranscriptome215Y
F051771Metagenome / Metatranscriptome143Y
F098404Metagenome / Metatranscriptome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314813_13625Not Available625Open in IMG/M
Ga0314813_14151All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff560Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314813_11644Ga0314813_116441F051771MQGNMTDGPSHLEPVDDQAVPKPGRRWTWDRLGPHASRVALELFIVFVGVSAAFAVENYRDARQQDLRRLAVYRALDRELTQMAETHGPVFQRQMTEQLTVWDQAVAKGEHPLPPTFRMPRAERPPTGVWDAAVATGSIELIDPELFFELARLYNRAESAGDLYQRYATSAQADVWARLD
Ga0314813_13625Ga0314813_136252F022207GRTALGGIALQPVRLVLLLLVGPREGENDFLEFPSVEEAVAYARELYGERRFQLEGIEDRSGRSVVSYDVLHDRCRAPDRIQERRFG
Ga0314813_14151Ga0314813_141511F098404MRSFLVCVVLALAIACAAAQQTRPKLSETFESKGFVQIKHNGTLFFGEGWYHVSQPDGKALEAYAFGGAEHLNVYELQRFDKGKAFEVIHVAKDKTPVCHTKSLTGKMPQLWDWVEKADYVRNFTANGSKFDLWGYKTAGITLEVAVPVGYPDILAYFGRFSAGNEFSYYIEQWKTDKPHSTWFEI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.