NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029928

3300029928: Baboon gut microbial communities from fecal samples in Kenya - M03



Overview

Basic Information
IMG/M Taxon OID3300029928 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118445 | Gp0134443 | Ga0116643
Sample NameBaboon gut microbial communities from fecal samples in Kenya - M03
Sequencing StatusPermanent Draft
Sequencing CenterDuke University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size135534183
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBaboon Gut Microbial Communities From Fecal Samples In Kenya
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
Location
CoordinatesLat. (o)2.717Long. (o)37.1Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032286Metagenome / Metatranscriptome180Y
F053097Metagenome / Metatranscriptome141Y
F063247Metagenome / Metatranscriptome129Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0116643_1000016All Organisms → Viruses152832Open in IMG/M
Ga0116643_1000070All Organisms → Viruses90074Open in IMG/M
Ga0116643_1000126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae63590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0116643_1000016Ga0116643_100001611F063247MKKYPRTSTIEIDCDPCTGMGRQQNHYEAICKLLNVKPEPRISAFFGCWEWPITYKTAEDEAKAKEFLTDLYNSGLCRYASW
Ga0116643_1000070Ga0116643_100007011F053097MFDIVNNKIQLSTEDLAIPPFRDFYNNAKDKQDALKKIEFIVWRYKWNSPYEAYPEKERTWRVAKDVLND
Ga0116643_1000126Ga0116643_100012652F032286MVKWICQTVTLIRHRALIFDVRLFTGNAADDTLVTGSTFRFCRLVCLCVKRRNIILNSKRRSLLNSFLFRADNRTEQKTISPFSLALIFTFDFAALSERRSCPGLSPRRFVLLDALDAALRQRTYPVRTVMQFSRFRCDCKTILAKNIALSRISKRSENAPKNANFHAYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.