NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029905

3300029905: Fecal microbial communities from Fat line chicken in Harbin, China - MGJ17



Overview

Basic Information
IMG/M Taxon OID3300029905 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133372 | Gp0289966 | Ga0247327
Sample NameFecal microbial communities from Fat line chicken in Harbin, China - MGJ17
Sequencing StatusPermanent Draft
Sequencing CenterInner Mongolia Agricultural University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size235732452
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1
All Organisms → Viruses1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China
TypeHost-Associated
TaxonomyHost-Associated → Birds → Digestive System → Fecal → Unclassified → Fecal → Fecal Microbial Communities From Lean And Fat Line Chickens In Harbin, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationChina: Harbin
CoordinatesLat. (o)45.73Long. (o)126.73Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047755Metagenome149Y
F053097Metagenome / Metatranscriptome141Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0247327_1029964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales1415Open in IMG/M
Ga0247327_1055416All Organisms → Viruses850Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0247327_1029964Ga0247327_10299641F047755GNLNMENEKVKYLINMINDMDIKNKLRLAICMSKSEWSGLIYNTKENYEKFDNMLKSIDEEYRTTLINFGKYKLVMFAMAKLMEMQATEQNQVALFLFNDVNTIIAKEKYYTG
Ga0247327_1055416Ga0247327_10554162F053097MFDIKGSKIVFSTEDLAIPPFRDFYNNAKDKNLAKKQLEYVIWTYKWNSPYEAYPENERPQRVAQDVFGTDYEPDADVKELIKRFNEF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.