NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029891

3300029891: Groundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2158



Overview

Basic Information
IMG/M Taxon OID3300029891 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133313 | Gp0288075 | Ga0246100
Sample NameGroundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2158
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of California, Berkeley
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size179595433
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGroundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biomeplanetary subsurface zonegroundwater
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationJapan: Horonobe URL
CoordinatesLat. (o)45.045278Long. (o)141.859444Alt. (m)N/ADepth (m)250
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000060Metagenome / Metatranscriptome2944Y
F081380Metagenome / Metatranscriptome114Y
F083668Metagenome / Metatranscriptome112Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0246100_113346All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2180Open in IMG/M
Ga0246100_133406Not Available769Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0246100_100498Ga0246100_1004986F000060MATKLNSEFNYRYQVMGETTWEKIKHLKNFLEGRKRAAVLEEVQKLKTAAKLSKLKHLKEHLGLEHEILELEAEIIEAQSFEADQTECWELNRQEIVILEKLLAELYEIAEPLRIKGYTDEQMFEANAANEFTVMIGKEILAELIANGRPSAAKIRNAMSNPVTWNALIQCGLIPQGNETLMFSNDPQHIKLSLPDAPNIVKKIKDAKK
Ga0246100_113346Ga0246100_1133462F081380MKSAPEYLNNPDGKRMWFQDFRPHFNYLVLDPIKRFPLKMDDMLIGFVFMSCCIDYLSGFWWGENRELGMSRQAYVGFINEYFRPRGRYNAKGLYDSLRNGLVHLFTIKNKMYELTFDEPERHLTLSRIGYTVLDAGSFRKDLIDAANLYFDEVEKNPQLLNKAFERYERDGFVHWID
Ga0246100_133406Ga0246100_1334063F083668MKKWSPDKITAVILIVGCFGLLFTGIDGEVKAILTIAAGYLFGTSIIERKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.