Basic Information | |
---|---|
IMG/M Taxon OID | 3300029525 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133133 | Gp0283565 | Ga0244942 |
Sample Name | Human fecal microbial communities from Shanghai, China - P045V6 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 36215200 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Shanghai, China |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2112312 | Long. (o) | 121.4647709 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047125 | Metagenome / Metatranscriptome | 150 | N |
F068811 | Metagenome | 124 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0244942_100028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 126151 | Open in IMG/M |
Ga0244942_103683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1350 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0244942_100028 | Ga0244942_100028105 | F047125 | MDVVLLLMVLGVMLSDFWAADALDHMRKEILRQEGKRRGWWS |
Ga0244942_103683 | Ga0244942_1036833 | F068811 | MDKMDQDGSEHNICSNREGLCPGKKQHGASGWKKIFQHGKEPLRSKDSVSQYCNKKVAVSLILNENV |
⦗Top⦘ |