Basic Information | |
---|---|
IMG/M Taxon OID | 3300029454 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133130 | Gp0283357 | Ga0244180 |
Sample Name | Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001938-25 |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 86593610 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | China: Shanghai | |||||||
Coordinates | Lat. (o) | 31.2123446 | Long. (o) | 121.4684853 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029444 | Metagenome | 188 | Y |
F062845 | Metagenome | 130 | N |
F068855 | Metagenome | 124 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0244180_101335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | 10441 | Open in IMG/M |
Ga0244180_101544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 8752 | Open in IMG/M |
Ga0244180_103441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3435 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0244180_101335 | Ga0244180_1013352 | F068855 | VPTVEAKGPQVRKSLAPQGLQAEKERENANVQNAGWLHSFDADYHYRGSDLHYHVNVSAALSEGGAAW |
Ga0244180_101544 | Ga0244180_1015445 | F029444 | MEVSEQLTGFEPEDLMSWTVSNLQSPFREDFSLEISGIIAEKESQIFGRRFVGFDS |
Ga0244180_103441 | Ga0244180_1034412 | F062845 | MTTKWTEKGDSMKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLNAVPSRSCA |
⦗Top⦘ |