NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029451

3300029451: Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001823-33



Overview

Basic Information
IMG/M Taxon OID3300029451 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0133130 | Gp0283246 | Ga0244069
Sample NameHuman fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001823-33
Sequencing StatusPermanent Draft
Sequencing CenterBeijing Genomics Institute (BGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size55279509
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Shanghai Jiao Tong University, China
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Shanghai Jiao Tong University, China

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationChina: Shanghai
CoordinatesLat. (o)31.2123446Long. (o)121.4684853Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026592Metagenome / Metatranscriptome197Y
F080163Metagenome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0244069_102670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae2267Open in IMG/M
Ga0244069_103195All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae1849Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0244069_102670Ga0244069_1026706F026592RTASPQGIAALAAQGGVATLTERSDETFSVGQFSSADRE
Ga0244069_103195Ga0244069_1031952F080163MKTIKFLQESFETKEKFQQEISFKYSYNLDTVESIDFRINRCNIRYFYEAMQNFENSLVDEFKEKKTNFCNANQFLESINDFDKILFVIITYMKTYFDFCKDYSKISFHVHLVQFDFTISVLIQGFYNYSHSDLSFSTKLESEVLDSEIELLQEKLDLIREEICELIGVDPNLEKQGHEDNYIFNLNIDSDNQIGFFLQATEL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.