Basic Information | |
---|---|
IMG/M Taxon OID | 3300029437 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133095 | Gp0281942 | Ga0242826 |
Sample Name | Human feces microbial communities from a patient in hospital, Baltimore, Maryland, USA - 015_6_4_stool_2 |
Sequencing Status | Permanent Draft |
Sequencing Center | Institute for Genome Sciences, University of Maryland School of Medicine |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 252700959 |
Sequencing Scaffolds | 6 |
Novel Protein Genes | 6 |
Associated Families | 6 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From A Patient In Hospital, Baltimore, Maryland, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Baltimore | |||||||
Coordinates | Lat. (o) | 39.28846264 | Long. (o) | -76.62594594 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026489 | Metagenome | 197 | N |
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F056682 | Metagenome | 137 | Y |
F070093 | Metagenome | 123 | N |
F076189 | Metagenome | 118 | N |
F081354 | Metagenome | 114 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0242826_1002463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 15020 | Open in IMG/M |
Ga0242826_1005975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 6004 | Open in IMG/M |
Ga0242826_1012376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | 2741 | Open in IMG/M |
Ga0242826_1023205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Blautia → Blautia obeum | 1400 | Open in IMG/M |
Ga0242826_1033198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 967 | Open in IMG/M |
Ga0242826_1045514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 698 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0242826_1002463 | Ga0242826_100246318 | F026489 | NQKSASDFDALEPRKRGCTPLLTPKQWATPEKTEDSRLFGVKIF |
Ga0242826_1005975 | Ga0242826_10059752 | F081354 | LVRENQQSSAHNFVKDFSSIYPESRRRSPLKKGAVTEIPLEYGKTEVQIPFEPLQAAISSMELPKNFENKKLPNPLR |
Ga0242826_1012376 | Ga0242826_10123764 | F070093 | GVCRVSNFESLLLAEFYPFRIDPPMKPEQERLFKLYSGSGIHSLPELNPNLLQNIHRM |
Ga0242826_1023205 | Ga0242826_10232051 | F026592 | FCQNRLRTASTQGIVALAAQGGVATLTEQSDATFSVMQLFSADRE |
Ga0242826_1033198 | Ga0242826_10331982 | F076189 | VLSAGHCFFLSPFIKPLLYVEKLQIGTVLPVVPDLYREFAELLACFDLHAIQSAQKPLHMLCNFHENTLGLLIFYTNYAII |
Ga0242826_1045514 | Ga0242826_10455143 | F056682 | QNTMKMQSRAGKAANQPIRQGEIYSASFGAFPSKNRSTFPIQELRKNREDQEVL |
⦗Top⦘ |