3300029370: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_27_stool_1

Overview

Basic Information

• IMG/M Taxon OID: 3300029370
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0133117 | Gp0283118 | Ga0243957
• Sample Name: Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 081_4_27_stool_1
• Sequencing Status: Permanent Draft
• Sequencing Center: Institute for Genome Sciences, University of Maryland School of Medicine
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 141757611
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella tanakaei	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: USA: Baltimore
• Coordinates
  • Lat. (^o): 39.28846264
  • Long. (^o): -76.62594594
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059106	Metagenome	134	N
F070093	Metagenome	123	N
F099269	Metagenome	103	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0243957_101447	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae	14757
Ga0243957_103471	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → Collinsella tanakaei	4732
Ga0243957_127194	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	559

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0243957_101447	Ga0243957_1014471	F059106	SVWKIRVILLQKFVWIVDLKVREHLTEYLKKDIKYHRVIIGVFV
Ga0243957_103471	Ga0243957_1034712	F099269	MLLVDDLGDRASGASVLAGAAGNAGILVSDGSDVVELQNTSGASVNANATSDALVGINYGMSHGSFLSIVRCA
Ga0243957_127194	Ga0243957_1271941	F070093	ESLFLAEFCPFRIDPPMEPEQERLSKLYSGSGIHSLPELNPNLI