Basic Information | |
---|---|
IMG/M Taxon OID | 3300029008 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0127429 | Gp0193632 | Ga0169638 |
Sample Name | Human fecal microbial communities from infant at 12 months in Denmark - 326_12M |
Sequencing Status | Permanent Draft |
Sequencing Center | Beijing Genomics Institute (BGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 67282830 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Denmark | |||||||
Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026592 | Metagenome / Metatranscriptome | 197 | Y |
F062845 | Metagenome | 130 | N |
F078693 | Metagenome | 116 | N |
F097493 | Metagenome | 104 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0169638_100432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 30774 | Open in IMG/M |
Ga0169638_101629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 6215 | Open in IMG/M |
Ga0169638_102577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 3534 | Open in IMG/M |
Ga0169638_105034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1533 | Open in IMG/M |
Ga0169638_108023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium | 897 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0169638_100432 | Ga0169638_10043210 | F062845 | MKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLNALPSRSCA |
Ga0169638_101629 | Ga0169638_1016291 | F078693 | MVLAPVRGAERFFIKANCSLLMSKENQKTTSDFDALDPRERGYSPLSDPEGVVEAQKC |
Ga0169638_102577 | Ga0169638_1025771 | F026592 | ASPQGIAALAAQGGVATLTERSDATFSVMQFSSADGE |
Ga0169638_105034 | Ga0169638_1050344 | F097493 | MYKFYMKNGTAYFYEHGVEIDGTVYGIHTDRDILRIKRSVVNNKFAETDDNFDMDTEIAKIQHTDVTLEQPTSEQLSQIQSKTFDSMSDMKQYVQSVMNGELTQDEINAMLLLQIAELKAGVSNE |
Ga0169638_108023 | Ga0169638_1080232 | F026592 | SPQGIAALAAQGGVATLTERSDATFSVKQFSSADGE |
⦗Top⦘ |