NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026676

3300026676: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A4-10 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026676 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0095510 | Gp0072041 | Ga0207589
Sample NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A4-10 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size8567334
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseimicrobium → Roseimicrobium gellanilyticum1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Archaea1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSoil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeagricultural fieldagricultural soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationWisconsin, United States
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)N/ADepth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000268Metagenome / Metatranscriptome1411Y
F001757Metagenome / Metatranscriptome641N
F005672Metagenome393Y
F023901Metagenome / Metatranscriptome208N
F025086Metagenome / Metatranscriptome203Y
F026346Metagenome / Metatranscriptome198Y
F048216Metagenome / Metatranscriptome148Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0207589_100903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Roseimicrobium → Roseimicrobium gellanilyticum631Open in IMG/M
Ga0207589_101046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium608Open in IMG/M
Ga0207589_101372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae572Open in IMG/M
Ga0207589_101710All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium538Open in IMG/M
Ga0207589_101863All Organisms → cellular organisms → Bacteria526Open in IMG/M
Ga0207589_101930All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium521Open in IMG/M
Ga0207589_102226All Organisms → cellular organisms → Archaea500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0207589_100903Ga0207589_1009031F025086GVAKLSRASCYKSNLMKKPIYAALDLHSRMSVLGSMDHHDGQTQPRMRFPTEASILRGEVERLRRKRRPLYLTMEAGALTRWASGIVRPLVERLIICEPRHNRLINSNPTKSDEADVEGMCLLLRLGKLKEVWMGTDRTREIYRALVYELLSWRDAQRELKALIKARYRGWGVLRLHGIRVFSAKGRQEYLAQLPAEEERRMMRRLYGQL
Ga0207589_101046Ga0207589_1010461F005672AADWGISQPKEHGEDERKRPLAAVATDLNGRLKQCCKSADSPSGAALEMRRHFTLFARYGLPNPKATQLVRDLTMKAFTSHKR
Ga0207589_101372Ga0207589_1013721F026346VASIVVETDKKGRCEERRFDNRTGKMVSANYVNCDARLEPERYSTPSENINRERIRAILGAFKK
Ga0207589_101710Ga0207589_1017101F001757MRILKPLQDKATTGAGKRLVLPEPRRVRFLIRGEGSVSAGAVTIECCPESTKAGKFWMELATIAVPADYGLAQYYTEEASGLFRARISRPVSNGTVTVTPLVSRGRPDRPDRTKVV
Ga0207589_101863Ga0207589_1018632F000268MLMRVVAVMLLLSAGVAAEAMSYSFSKASGRLGGPIRFEFYGDSTTLPKTDIKSFTVSLRTADDRWKAMWSILSGRGLTQPIEYGVTPPGFTTMIQPQKLIPGRVYAGFATDGHGGSSGVTFGFDKNGRMIFPDSFDSMSGE
Ga0207589_101930Ga0207589_1019301F048216MSPSALNPTTEVIKVVCLMSLEEMPRDVKALEERIIEKVQQSGREFYAAVFYAFERRWLQERGGDYTAVRWRTINQVTPFGLIRLPVRVVRERGAQKGGYLSLSKALFKPKATRLLSPWVEKGVLEATTCSNYRPAAAELWRWVRVKVS
Ga0207589_102226Ga0207589_1022262F023901VPLDPKKFGGYEFAINTKGWDAKREPTHNCHDQHKSRLIPTNLENDKAVRLRQTVKDESGKVHQIGEIDYMDGNGFHKVMDIFDSSPNPWMVDRNLYETKSYFWIRNNGSGYITVRDVSLEILS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.