3300026667: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN613 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026667
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053063 | Gp0054293 | Ga0208347
• Sample Name: Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN613 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 6494152
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1
Not Available	1
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): grassland biome → land → fertilized soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Gorham, Kansas, USA
• Coordinates
  • Lat. (^o): 39.05
  • Long. (^o): -99.1
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045906	Metagenome / Metatranscriptome	152	Y
F053869	Metagenome / Metatranscriptome	140	N
F073208	Metagenome	120	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208347_100068	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	973
Ga0208347_100295	Not Available	640
Ga0208347_100389	All Organisms → cellular organisms → Bacteria	596

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208347_100068	Ga0208347_1000682	F045906	MNETVKPYRDPIPGRGSIELRRTAAGVYSWVITFWADAIVTDAHLMGMVDSVERVDQELKSRYPESGAKATSE
Ga0208347_100295	Ga0208347_1002951	F073208	AVVTIAAGVTSLASLIVGLSGADFDFEAVSEAATFIALGTDAVEPVRWGLWLSMFGSYLLLVPVALHLLRWLRQDDPVVADLSTVAAGFYILLGAAGASVLASTLPDLIQQYADADAAMRAGLLNDFDLARRIGEDGLQGVVQNVAGAAWFLGMGSLLRRHRPALGAAAIAVGAFLVVNAAGIMVDVEALRFIGLTGNVLLAPAWAIGMGTSL
Ga0208347_100389	Ga0208347_1003892	F053869	MILSILVTLAFVATLLFMLVRAFTGPVRHRHSRPVH