NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026234

3300026234: Upper troposphere microbial communities from Oklahoma, USA - DC3-110 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026234 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110167 | Gp0085205 | Ga0209028
Sample NameUpper troposphere microbial communities from Oklahoma, USA - DC3-110 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size33527485
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUpper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei
TypeEnvironmental
TaxonomyEnvironmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Aerosol (non-saline)

Location Information
LocationUSA: Oklahoma
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051069Metagenome / Metatranscriptome144N
F051119Metagenome / Metatranscriptome144N
F098918Metagenome103Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0209028_1004704Not Available627Open in IMG/M
Ga0209028_1005917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus558Open in IMG/M
Ga0209028_1006308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli541Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0209028_1004704Ga0209028_10047043F051119MKISEAFEQLDALRVANALGLEYGVVCKWRDREQIPAYWRCKFVNLMNHHNVAIKLHDLAGWIK
Ga0209028_1005917Ga0209028_10059172F098918NKPNYSKRDFMNATIIFQTALMDKMYDNQDYDKMNIEDRMKMAESCGFALRNLIHTYTGLDTHKIEEFL
Ga0209028_1006308Ga0209028_10063081F051069VLAYAKIENTDENTIIDALITSSREELENLLKIPLITQVWAQTYDSFIEPVYAPMIPITSAALEIADSDGNFSANTYISVKKDTGRIAPTDAFSPSLQFDGFKITFTYTISAIDATLKTAIMELTSYRFYNRGNLEAAKIPASVLSMVGHLRVFSV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.