Basic Information | |
---|---|
IMG/M Taxon OID | 3300026234 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110167 | Gp0085205 | Ga0209028 |
Sample Name | Upper troposphere microbial communities from Oklahoma, USA - DC3-110 (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 33527485 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Type | Environmental |
Taxonomy | Environmental → Air → Outdoor Air → Unclassified → Unclassified → Upper Troposphere → Upper Troposphere Microbial Communities Above Oceans And Continental Usa That Affect Ice Or Cloud Condensation Nuclei |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Aerosol (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Oklahoma | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051069 | Metagenome / Metatranscriptome | 144 | N |
F051119 | Metagenome / Metatranscriptome | 144 | N |
F098918 | Metagenome | 103 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209028_1004704 | Not Available | 627 | Open in IMG/M |
Ga0209028_1005917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus | 558 | Open in IMG/M |
Ga0209028_1006308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | 541 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209028_1004704 | Ga0209028_10047043 | F051119 | MKISEAFEQLDALRVANALGLEYGVVCKWRDREQIPAYWRCKFVNLMNHHNVAIKLHDLAGWIK |
Ga0209028_1005917 | Ga0209028_10059172 | F098918 | NKPNYSKRDFMNATIIFQTALMDKMYDNQDYDKMNIEDRMKMAESCGFALRNLIHTYTGLDTHKIEEFL |
Ga0209028_1006308 | Ga0209028_10063081 | F051069 | VLAYAKIENTDENTIIDALITSSREELENLLKIPLITQVWAQTYDSFIEPVYAPMIPITSAALEIADSDGNFSANTYISVKKDTGRIAPTDAFSPSLQFDGFKITFTYTISAIDATLKTAIMELTSYRFYNRGNLEAAKIPASVLSMVGHLRVFSV |
⦗Top⦘ |