3300026043: Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300026043
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111376 | Gp0116084 | Ga0208145
• Sample Name: Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 50455269
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Varidnaviria → Bamfordvirae → Preplasmiviricota → Tectiliviricetes → Kalamavirales → Tectiviridae → Deltatectivirus	1
Not Available	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → wetland area → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: USA: Antioch, San Francisco Bay, California
• Coordinates
  • Lat. (^o): 38.052509
  • Long. (^o): -121.76873
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024195	Metagenome / Metatranscriptome	207	Y
F036673	Metagenome	169	Y
F092001	Metagenome / Metatranscriptome	107	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208145_1000030	All Organisms → Viruses → Varidnaviria → Bamfordvirae → Preplasmiviricota → Tectiliviricetes → Kalamavirales → Tectiviridae → Deltatectivirus	6109
Ga0208145_1000719	Not Available	2226
Ga0208145_1012752	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	590

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208145_1000030	Ga0208145_10000305	F024195	MNGDKLFNVLGAIVTVALVTTIVSRPTSAQVIKSMGDAFAGSIRAALGK
Ga0208145_1000719	Ga0208145_10007192	F036673	LTPAPPAPLEVSDPQRAQTLKRKVLDRITDVRRHLNALQAAMAAFGEDFDLDVFQREFESEDPDELNRVKAVERGVDQLYNYMVELAAFGLELAGERRRFDETNARRDLDALARLGVISRERAARLQRLREYRRLFVHEYASATAAQVHEAARILADELPPFYRAYGEWVRTGFRVRR
Ga0208145_1012752	Ga0208145_10127522	F092001	MIDTKSIPRPGERWLSCPPYLLIAHVLRVDERADPPVVSYELQDDEGLLLESVELALLDEGWWRTFQPMVRRSG