NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300026024

3300026024: Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D1 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300026024 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111376 | Gp0101405 | Ga0210130
Sample NameWetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D1 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size121982309
Sequencing Scaffolds10
Novel Protein Genes11
Associated Families11

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1
Not Available3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium1
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameNatural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA: San Francisco Bay, California
CoordinatesLat. (o)38.131752Long. (o)-122.266335Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021303Metagenome / Metatranscriptome219Y
F025141Metagenome / Metatranscriptome203Y
F045713Metagenome / Metatranscriptome152Y
F076140Metagenome118Y
F090405Metagenome / Metatranscriptome108Y
F099324Metagenome / Metatranscriptome103Y
F102142Metagenome / Metatranscriptome102Y
F103291Metagenome101Y
F105200Metagenome / Metatranscriptome100Y
F105216Metagenome / Metatranscriptome100Y
F105217Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0210130_1000412All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis5607Open in IMG/M
Ga0210130_1003138All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1669Open in IMG/M
Ga0210130_1006011Not Available1279Open in IMG/M
Ga0210130_1014514Not Available922Open in IMG/M
Ga0210130_1014718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria917Open in IMG/M
Ga0210130_1016686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium876Open in IMG/M
Ga0210130_1018144All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.850Open in IMG/M
Ga0210130_1044719Not Available611Open in IMG/M
Ga0210130_1050517All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium585Open in IMG/M
Ga0210130_1067685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0210130_1000412Ga0210130_10004125F105217MASNVNSNNERNSLIDSIQYRLFYAEINLDKIPTFIPLDIFPKDKIASEVAIDGFLFYANSALDLVFVEINKKLELGLPPNQINPENIMLNFNSKKSNDSKMMLEEFQKYFQKPTHEEKIISDKEFNDGLNRYGFDVIGFHAEYEARGQEKYQHFWNRASSRLWEIRNQQDLESYDSLLKNAGKRGKDEPRNYLRIKLADYNRPSVYWDSAHYENPKRYFTNVLSLVKQFIDRILEILKPLYPSDSSLAV
Ga0210130_1003138Ga0210130_10031382F103291MEMFGLSPVVATLTIVSSGVILQNILGWLKSKEGYNVRSALASTIIAFVVGITIIGPQIEAIQNQMLSDLSELTIAASLIASIAGFDVLTKNAFRIANQKINLQNKPV
Ga0210130_1006011Ga0210130_10060112F102142MTNKVTESNETVRDLLKASLVGILAVVITVIPFEQFVAQLAGLSYDEFRGGMPTLYLLPLFLIYAAIGLVLARMKQNLNIGKRGAFLILFAFYYLIVSILPDIEGLIYLPDFTFLSAMTSGLILAGAVVGLIFYLWKQDENPGAKPGEQIKSHFSSRSVLSWIWRFFLVWISFYIVTMILGIVATPFNGSYYEDPMNTLGMVVPSMGTFFAITQFRSLIYILVILPFIIFWNSSKRALFLYLALILIILYPLLGDGLAYFWPA
Ga0210130_1014514Ga0210130_10145142F045713SQAQVMNGRIWEGSCSYLKCADGMIEGRFLFPTPNSPELLGALVGRLAQGVEVIICTEDDDDDD
Ga0210130_1014718Ga0210130_10147182F090405MKAALAFVFAIGLLVPGIAASDPSDCGRLMYQITHYEDMVGRAEALGRDDWAAKTQRHVDLLETRLADRCPAFSARDEQQEAARQMALLLKMAATAAAI
Ga0210130_1016686Ga0210130_10166861F099324VFRKVIFVIMLGWVLVLSGCAATDKGGNIEGEDYRSGSPPRGGYTRTNSHKVLVTEACNIEANNLAGASDFMADDRARRVYFSQCMLRNGYNAAGNYVGIPSK
Ga0210130_1018144Ga0210130_10181441F025141IPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK
Ga0210130_1044719Ga0210130_10447191F105216MPTSRSAALFCGLAIAAAACSDEAPKPWKAAEMRKLSEQFGHIAEAYAVVDICLPMIDADQDAKRSVIAKIEIRRYSQLSRINTEAEFANFLAYHRQTGGTDEQAAALDQIYRESYETAARHLTSVDNCAETVSDYANTILQTRVEPVP
Ga0210130_1050517Ga0210130_10505171F021303MTERPISTDVSGLRATVLNHSSEFVELVYRDAPSEYRRLMTQQRFRRELALQNRFNHGKLFAYAEYVVFRKEFQDRFPDASPAACINAFSSLFLKNDISITNLVEFVEGPDHRGQLLLNQPPGPG
Ga0210130_1057791Ga0210130_10577912F105200QPKAFTMDVMRGVRRGQRTRKIILWAFGLVGALFGLSGASMLAGPVSELFSFSLAMPAMQTMQATLFIVGAAAFYLWFMNDDFSLGD
Ga0210130_1067685Ga0210130_10676852F076140MASTAKPVNLFLMTAERMLRCRWDGVSESVEILNAAMDGETVREVERDPANPQKLYAATLTEIHTSEDGGATWQWLPSGGIDHRDIWALAASC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.