NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025522

3300025522: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_1A (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025522 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053062 | Gp0055518 | Ga0208371
Sample NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_1A (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size141076510
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium3
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon HGW-Methanomicrobiales-41
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSerpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biomeplanetary subsurface zonerock
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025315Metagenome202Y
F076639Metagenome118Y
F098715Metagenome / Metatranscriptome103N
F102634Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208371_1000965All Organisms → cellular organisms → Bacteria5686Open in IMG/M
Ga0208371_1009960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica1826Open in IMG/M
Ga0208371_1021881All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium1157Open in IMG/M
Ga0208371_1022952All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon HGW-Methanomicrobiales-41124Open in IMG/M
Ga0208371_1044116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium731Open in IMG/M
Ga0208371_1055184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → unclassified Syntrophobacteraceae → Syntrophobacteraceae bacterium628Open in IMG/M
Ga0208371_1064185All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans564Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208371_1000965Ga0208371_10009655F076639MENTELKSDREKAPIYWMHEAITYLGLDRLGLARPDKAIYRLVEKGALHPKKIAGHFAFDKKELDLLAANGDQKRGRGRPRTFNSGN
Ga0208371_1009960Ga0208371_10099602F025315MQNYLLYTCEILLVVVTPLLILYIKGNWPLRKVIPPLMIIPVLWYFTYAPLHELSHAAGTYLVGGKVIEYRLIPRFWLGEFGGAWATPSGYTQSWQQLTSSAFPYMLDIVCLVVAIFVFRRRFSRNPFLVGLAFMLLCLRPAIDFVFESIGFLSGWRGDLWYMQQIVGPFAIWSFILISIGLAVYSISSTLSHFVSFSKH
Ga0208371_1021881Ga0208371_10218812F102634MDTTIKKRVEIEGYGKLDGEFIQNEQGWFCREVNGVRWNFREWGDQAAMETPEEAALYLLSLDVVDEPEP
Ga0208371_1022952Ga0208371_10229522F102634MEMTIKKKVEVEGFGTLDGEFVQNEDGWFCREVGGTRWNFREWGDPAAMKTPEEAADYLL
Ga0208371_1044116Ga0208371_10441162F102634METTIRKTIEIEGYGKLDGEFIQNEQGWFCREVKGIRWNFRDWGAPSAMESPEEAAFYLLSLDVDDLPDVD
Ga0208371_1055184Ga0208371_10551841F102634METIIKKRVEIEGYGMVDGAFIQNEEGWFCREVNGIRWNFRDWGAPAPVESPEEAALYLLSLNVVDDAES
Ga0208371_1064185Ga0208371_10641851F098715MADSIKVQVMQNLAEVLGAIPDLGSVHRWQGSPTDLDRVKLPALFFWDEEEARDKRNRLAMGTLKLYVAVFIRLSPSGAASFNDAADNLQGKLHNALIGTAGLKGLVENLQEERVWKEFPNDQYGVLFMSFTLTYGHAWGDAFSTTY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.