Basic Information | |
---|---|
IMG/M Taxon OID | 3300024988 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118793 | Gp0095076 | Ga0209958 |
Sample Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_inoc_plan (SPAdes) |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | Y |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 341047186 |
Sequencing Scaffolds | 5 |
Novel Protein Genes | 5 |
Associated Families | 5 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 1 |
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. | 1 |
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Type | Engineered |
Taxonomy | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | South Africa: Cape Town | |||||||
Coordinates | Lat. (o) | -33.936637 | Long. (o) | 18.478905 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006009 | Metagenome / Metatranscriptome | 384 | Y |
F009854 | Metagenome / Metatranscriptome | 312 | Y |
F025775 | Metagenome | 200 | Y |
F050494 | Metagenome / Metatranscriptome | 145 | Y |
F065495 | Metagenome / Metatranscriptome | 127 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0209958_1002413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans | 10545 | Open in IMG/M |
Ga0209958_1015168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 2465 | Open in IMG/M |
Ga0209958_1044278 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. | 1169 | Open in IMG/M |
Ga0209958_1064409 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 876 | Open in IMG/M |
Ga0209958_1088043 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 683 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0209958_1002413 | Ga0209958_100241312 | F025775 | MKQFLTFQSFPMVVVVALIVWSWISILSVVIGSLF |
Ga0209958_1015168 | Ga0209958_10151682 | F006009 | MDTEPKMIWRGVAAGTVMGLGLGGILALFIALRPEMFAGLAG |
Ga0209958_1044278 | Ga0209958_10442782 | F009854 | MNDRGARADVFTALQDLAEVIPEMRAGQLMAAVGELCADLHGRGLWDADDDEVLEAVWQFRRNYEAAAITN |
Ga0209958_1064409 | Ga0209958_10644092 | F065495 | MLHRLTVGHLDVAAVERRQTVPVKALEMDVVHRLLGELGEKDDDGDVTLGGCKVKFENGAVSCLWMGGRANRVAEEFALRMHRETGCVIADVGGYRVIEPDELTGLTGQASGSKPGAVRT |
Ga0209958_1088043 | Ga0209958_10880431 | F050494 | MSQRLTVHGRYVGRTFIPDGPLPDAEGAAELVITPTVPLSVGSIADAFGKATVLRSGDEILAQVRADRDEWDDR |
⦗Top⦘ |