Basic Information | |
---|---|
IMG/M Taxon OID | 3300023171 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290983 | Ga0247813 |
Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409C-1 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 786445810 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034190 | Metagenome / Metatranscriptome | 175 | Y |
F034611 | Metagenome / Metatranscriptome | 174 | Y |
F092148 | Metagenome | 107 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0247813_10034686 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. | 2251 | Open in IMG/M |
Ga0247813_10111767 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1089 | Open in IMG/M |
Ga0247813_10170682 | Not Available | 842 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0247813_10034686 | Ga0247813_100346862 | F034611 | MLQSKTVLSLTIDLLANNAFNHLKDEEISALHYLILKLQEPLTSIQQNLLLTFWNHAYTGDLPAALLYRCNTVLQQLGRSPLEELVMDMDMY |
Ga0247813_10111767 | Ga0247813_101117672 | F092148 | MIIKKKREDLSGKIKTALDKGIQKLIAETKATNSYIVVSDKNGKVKKIPAKDL |
Ga0247813_10170682 | Ga0247813_101706821 | F034190 | SHNNFTGTSRYRTRADKHSLHPDQCPLLSILPERIVPTPLHLFLGIGNRIILDAFSELLGNERVQEALKPITTIHSAGCGGKSDLHDLNGPEISKLVRQLDPEKGKSPLKVAASSSLPAATQATHSILTRWLENLHDHLLHKGEWTTKQLVDWRAAVDDIQQHWQSEAHSKPFPKLHMLRHSVEFAERHRFLGRASEAQIESFHASFNALFHKQHRNQSGNTAERLRRSLADAALRAVQPFLQQ |
⦗Top⦘ |