NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300023039

3300023039: Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung A0



Overview

Basic Information
IMG/M Taxon OID3300023039 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0116274 | Gp0272163 | Ga0233360
Sample NameFecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung A0
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size77634973
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: California
CoordinatesLat. (o)38.04Long. (o)-122.5Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041521Metagenome159Y
F072921Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0233360_1008766Not Available1024Open in IMG/M
Ga0233360_1017420Not Available746Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0233360_1008766Ga0233360_10087661F072921VQMKSRLILTTDRKSASEGEYIEIRWACDACPDSLYLAIDSGCTQYSIAVSDSGVTRIPIPRSNGKMTVKLIGVISGKKVTESIDVRVKATKEAGTKAPLSSRMKMFGEKMQAKWYVFRANMKYWWLSQKKWQKALWIALLVLWLGLLFSSIGRKPEVKVSSDKIQTAYIFS
Ga0233360_1017420Ga0233360_10174202F041521YAKNSYNNTATIYMGGFLSFSNTGAKTTLENCLFAGKFERGANLTDEARLGAFGTLRSVNAIKNCYYLAHDGLEAVHSDSDLDTNSDNVEITPVTEEELRGDTIVTKLGECWTRGENYPVIKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.