NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300020816

3300020816: Food waste microbial community from Durham, Ontario, Canada - FW1 megahit



Overview

Basic Information
IMG/M Taxon OID3300020816 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0130338 | Gp0238881 | Ga0214090
Sample NameFood waste microbial community from Durham, Ontario, Canada - FW1 megahit
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Toronto
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1285684727
Sequencing Scaffolds375
Novel Protein Genes409
Associated Families88

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available108
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f55
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae81
All Organisms → cellular organisms → Eukaryota → Opisthokonta21
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. FS411
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum21
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays21
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae16
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae7
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-786
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus21
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Hirundinidae → Hirundo → Hirundo rustica → Hirundo rustica rustica1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo4
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea6
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica1
All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amphibia → Batrachia → Anura → Pipoidea → Pipidae → Xenopodinae → Xenopus → Silurana → Xenopus tropicalis1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Psittaciformes → Psittacidae → Amazona → Amazona collaria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Passeroidea → Fringillidae → Carduelinae → Serinus → Serinus canaria1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Coraciiformes → Coraciidae → Eurystomus → Eurystomus gularis1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes From Anaerobic Digester Of Solid Waste
TypeEngineered
TaxonomyEngineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationDurham, Ontario, Canada
CoordinatesLat. (o)44.1763Long. (o)-80.8185Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F001813Metagenome630Y
F002002Metagenome / Metatranscriptome605Y
F002471Metagenome / Metatranscriptome556Y
F002994Metagenome / Metatranscriptome514Y
F003406Metagenome / Metatranscriptome488Y
F004001Metagenome457Y
F004815Metagenome422Y
F005658Metagenome393Y
F006329Metagenome / Metatranscriptome376Y
F007409Metagenome / Metatranscriptome351Y
F007510Metagenome / Metatranscriptome349Y
F009131Metagenome / Metatranscriptome322Y
F010678Metagenome / Metatranscriptome300Y
F011632Metagenome288Y
F011735Metagenome / Metatranscriptome287Y
F012765Metagenome / Metatranscriptome277Y
F013401Metagenome / Metatranscriptome271Y
F014346Metagenome / Metatranscriptome263Y
F014592Metagenome / Metatranscriptome261Y
F015450Metagenome / Metatranscriptome254N
F018877Metagenome / Metatranscriptome232Y
F020289Metagenome224Y
F020492Metagenome223Y
F020828Metagenome / Metatranscriptome221Y
F020862Metagenome / Metatranscriptome221Y
F021064Metagenome / Metatranscriptome220Y
F023843Metagenome / Metatranscriptome208Y
F027342Metagenome195Y
F027437Metagenome / Metatranscriptome194Y
F028669Metagenome190Y
F028713Metagenome / Metatranscriptome190Y
F028765Metagenome / Metatranscriptome190Y
F032187Metagenome / Metatranscriptome180Y
F032472Metagenome / Metatranscriptome180Y
F033854Metagenome176Y
F034384Metagenome175Y
F034461Metagenome / Metatranscriptome174Y
F035108Metagenome173Y
F035626Metagenome / Metatranscriptome171Y
F037171Metagenome / Metatranscriptome168N
F038012Metagenome166Y
F038084Metagenome / Metatranscriptome166Y
F038489Metagenome165Y
F038985Metagenome / Metatranscriptome164Y
F039980Metagenome / Metatranscriptome162Y
F046965Metagenome / Metatranscriptome150Y
F051243Metagenome144Y
F051600Metagenome143Y
F052316Metagenome142Y
F053764Metagenome / Metatranscriptome140Y
F055526Metagenome138Y
F057039Metagenome / Metatranscriptome136Y
F057793Metagenome135Y
F062313Metagenome130Y
F062643Metagenome / Metatranscriptome130Y
F063479Metagenome / Metatranscriptome129Y
F065281Metagenome127Y
F065416Metagenome / Metatranscriptome127Y
F065766Metagenome / Metatranscriptome127Y
F067310Metagenome / Metatranscriptome125Y
F068298Metagenome124Y
F068986Metagenome124Y
F069772Metagenome / Metatranscriptome123Y
F072954Metagenome / Metatranscriptome120Y
F073390Metagenome / Metatranscriptome120Y
F075851Metagenome / Metatranscriptome118Y
F076748Metagenome117Y
F076912Metagenome117Y
F079404Metagenome115Y
F081962Metagenome113Y
F083289Metagenome113Y
F086390Metagenome110Y
F092835Metagenome / Metatranscriptome107Y
F093003Metagenome106Y
F093243Metagenome / Metatranscriptome106Y
F094706Metagenome105Y
F095123Metagenome / Metatranscriptome105N
F096316Metagenome104Y
F096729Metagenome104N
F096761Metagenome / Metatranscriptome104Y
F096850Metagenome / Metatranscriptome104N
F097597Metagenome104Y
F098130Metagenome / Metatranscriptome104Y
F099086Metagenome / Metatranscriptome103N
F103019Metagenome / Metatranscriptome101Y
F104139Metagenome100Y
F105149Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0214090_10009106Not Available1180Open in IMG/M
Ga0214090_10009773Not Available986Open in IMG/M
Ga0214090_10010630Not Available596Open in IMG/M
Ga0214090_10019650All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5506Open in IMG/M
Ga0214090_10026229All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae567Open in IMG/M
Ga0214090_10034733Not Available644Open in IMG/M
Ga0214090_10045818Not Available522Open in IMG/M
Ga0214090_10054277All Organisms → cellular organisms → Eukaryota → Opisthokonta1314Open in IMG/M
Ga0214090_10055969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1257Open in IMG/M
Ga0214090_10061115Not Available578Open in IMG/M
Ga0214090_10063686All Organisms → cellular organisms → Eukaryota → Opisthokonta525Open in IMG/M
Ga0214090_10065204Not Available1420Open in IMG/M
Ga0214090_10079442All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1609Open in IMG/M
Ga0214090_10081155Not Available1842Open in IMG/M
Ga0214090_10090942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2966Open in IMG/M
Ga0214090_10094825Not Available721Open in IMG/M
Ga0214090_10109977Not Available1383Open in IMG/M
Ga0214090_10123450Not Available664Open in IMG/M
Ga0214090_10132855All Organisms → cellular organisms → Bacteria777Open in IMG/M
Ga0214090_10137492Not Available770Open in IMG/M
Ga0214090_10139777All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora1460Open in IMG/M
Ga0214090_10140034All Organisms → cellular organisms → Eukaryota → Opisthokonta1394Open in IMG/M
Ga0214090_10142842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu926Open in IMG/M
Ga0214090_10151819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca592Open in IMG/M
Ga0214090_10153318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2093Open in IMG/M
Ga0214090_10154325Not Available719Open in IMG/M
Ga0214090_10156402Not Available884Open in IMG/M
Ga0214090_10156892All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis552Open in IMG/M
Ga0214090_10164502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. FS412907Open in IMG/M
Ga0214090_10168281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum910Open in IMG/M
Ga0214090_10176018All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos550Open in IMG/M
Ga0214090_10177837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays775Open in IMG/M
Ga0214090_10180727Not Available558Open in IMG/M
Ga0214090_10196621All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5532Open in IMG/M
Ga0214090_10224482Not Available574Open in IMG/M
Ga0214090_10224567All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1463Open in IMG/M
Ga0214090_10228477All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes741Open in IMG/M
Ga0214090_10234889All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays723Open in IMG/M
Ga0214090_10235835All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae4342Open in IMG/M
Ga0214090_10242598All Organisms → cellular organisms → Eukaryota → Opisthokonta2391Open in IMG/M
Ga0214090_10247086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum954Open in IMG/M
Ga0214090_10258022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata546Open in IMG/M
Ga0214090_10259675All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae661Open in IMG/M
Ga0214090_10260348All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae562Open in IMG/M
Ga0214090_10264957Not Available589Open in IMG/M
Ga0214090_10268265Not Available883Open in IMG/M
Ga0214090_10276714All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1320Open in IMG/M
Ga0214090_10288640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1226Open in IMG/M
Ga0214090_10290892Not Available770Open in IMG/M
Ga0214090_10293518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae526Open in IMG/M
Ga0214090_10293866Not Available536Open in IMG/M
Ga0214090_10295006Not Available547Open in IMG/M
Ga0214090_10295576Not Available544Open in IMG/M
Ga0214090_10301028All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2868Open in IMG/M
Ga0214090_10319320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays531Open in IMG/M
Ga0214090_10319508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae589Open in IMG/M
Ga0214090_10325810All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae685Open in IMG/M
Ga0214090_10326103All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus884Open in IMG/M
Ga0214090_10326110All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus742Open in IMG/M
Ga0214090_10326986All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae990Open in IMG/M
Ga0214090_10328926All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae901Open in IMG/M
Ga0214090_10330525All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays860Open in IMG/M
Ga0214090_10332362Not Available823Open in IMG/M
Ga0214090_10332888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum530Open in IMG/M
Ga0214090_10343945Not Available692Open in IMG/M
Ga0214090_10347620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae587Open in IMG/M
Ga0214090_10351084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1189Open in IMG/M
Ga0214090_10354047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays530Open in IMG/M
Ga0214090_10358582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae727Open in IMG/M
Ga0214090_10359852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays668Open in IMG/M
Ga0214090_10363312All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae783Open in IMG/M
Ga0214090_10364807All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Pavo → Pavo cristatus1129Open in IMG/M
Ga0214090_10366917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum727Open in IMG/M
Ga0214090_10370684All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae811Open in IMG/M
Ga0214090_10374592All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1726Open in IMG/M
Ga0214090_10379807Not Available987Open in IMG/M
Ga0214090_10382728All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae831Open in IMG/M
Ga0214090_10386033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae516Open in IMG/M
Ga0214090_10389786Not Available570Open in IMG/M
Ga0214090_10391651All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae512Open in IMG/M
Ga0214090_10398267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78535Open in IMG/M
Ga0214090_10398771Not Available506Open in IMG/M
Ga0214090_10400958Not Available526Open in IMG/M
Ga0214090_10402628All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2639Open in IMG/M
Ga0214090_10403437All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78545Open in IMG/M
Ga0214090_10412608All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae638Open in IMG/M
Ga0214090_10413188All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus589Open in IMG/M
Ga0214090_10413930All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1834Open in IMG/M
Ga0214090_10414790All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus922Open in IMG/M
Ga0214090_10415849All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries535Open in IMG/M
Ga0214090_10421453All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae805Open in IMG/M
Ga0214090_10422102Not Available537Open in IMG/M
Ga0214090_10423823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae649Open in IMG/M
Ga0214090_10426864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus873Open in IMG/M
Ga0214090_10431765All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus770Open in IMG/M
Ga0214090_10432703Not Available619Open in IMG/M
Ga0214090_10445569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae3508Open in IMG/M
Ga0214090_10451728Not Available1102Open in IMG/M
Ga0214090_10456724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae546Open in IMG/M
Ga0214090_10468936All Organisms → cellular organisms → Eukaryota → Opisthokonta2114Open in IMG/M
Ga0214090_10469866Not Available559Open in IMG/M
Ga0214090_10469955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare588Open in IMG/M
Ga0214090_10470341Not Available548Open in IMG/M
Ga0214090_10471855Not Available686Open in IMG/M
Ga0214090_10477286Not Available544Open in IMG/M
Ga0214090_10478376All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2225Open in IMG/M
Ga0214090_10485174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum616Open in IMG/M
Ga0214090_10487103Not Available1099Open in IMG/M
Ga0214090_10487674All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae847Open in IMG/M
Ga0214090_10493678All Organisms → cellular organisms → Eukaryota → Opisthokonta620Open in IMG/M
Ga0214090_10498956Not Available621Open in IMG/M
Ga0214090_10510252All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae528Open in IMG/M
Ga0214090_10513909All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1290Open in IMG/M
Ga0214090_10514876All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae683Open in IMG/M
Ga0214090_10525686All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae1498Open in IMG/M
Ga0214090_10532975All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78633Open in IMG/M
Ga0214090_10534069All Organisms → cellular organisms → Eukaryota → Opisthokonta906Open in IMG/M
Ga0214090_10534636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum700Open in IMG/M
Ga0214090_10536930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays734Open in IMG/M
Ga0214090_10546559All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus646Open in IMG/M
Ga0214090_10552077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta619Open in IMG/M
Ga0214090_10553652Not Available711Open in IMG/M
Ga0214090_10553925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays599Open in IMG/M
Ga0214090_10555079All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae4010Open in IMG/M
Ga0214090_10570194All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria580Open in IMG/M
Ga0214090_10575527All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae625Open in IMG/M
Ga0214090_10577472All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae714Open in IMG/M
Ga0214090_10586918Not Available1278Open in IMG/M
Ga0214090_10594110Not Available614Open in IMG/M
Ga0214090_10596290Not Available1778Open in IMG/M
Ga0214090_10610873All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Sylvioidea → Hirundinidae → Hirundo → Hirundo rustica → Hirundo rustica rustica3588Open in IMG/M
Ga0214090_10614941All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae713Open in IMG/M
Ga0214090_10619777All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae739Open in IMG/M
Ga0214090_10620952All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae609Open in IMG/M
Ga0214090_10624263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei512Open in IMG/M
Ga0214090_10625195Not Available580Open in IMG/M
Ga0214090_10627020All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae610Open in IMG/M
Ga0214090_10628292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → Bacteroides uniformis596Open in IMG/M
Ga0214090_10633186All Organisms → cellular organisms → Eukaryota → Opisthokonta664Open in IMG/M
Ga0214090_10639553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1088Open in IMG/M
Ga0214090_10641955Not Available2090Open in IMG/M
Ga0214090_10645176All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78739Open in IMG/M
Ga0214090_10649254All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis708Open in IMG/M
Ga0214090_10653161Not Available1096Open in IMG/M
Ga0214090_10653426Not Available537Open in IMG/M
Ga0214090_10664103All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus963Open in IMG/M
Ga0214090_10674943All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo588Open in IMG/M
Ga0214090_10676622Not Available978Open in IMG/M
Ga0214090_10691518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae696Open in IMG/M
Ga0214090_10695882All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1720Open in IMG/M
Ga0214090_10696159Not Available512Open in IMG/M
Ga0214090_10704738All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1079Open in IMG/M
Ga0214090_10705487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea594Open in IMG/M
Ga0214090_10711242All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1669Open in IMG/M
Ga0214090_10716405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis638Open in IMG/M
Ga0214090_10718017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → lamiids → Lamiales → Oleaceae → Oleeae → Olea → Olea europaea → Olea europaea subsp. europaea1194Open in IMG/M
Ga0214090_10720257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata517Open in IMG/M
Ga0214090_10721903Not Available582Open in IMG/M
Ga0214090_10731306All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1453Open in IMG/M
Ga0214090_10742323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus939Open in IMG/M
Ga0214090_10752168Not Available2354Open in IMG/M
Ga0214090_10757734All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2971Open in IMG/M
Ga0214090_10758594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum588Open in IMG/M
Ga0214090_10764757Not Available521Open in IMG/M
Ga0214090_10768365Not Available844Open in IMG/M
Ga0214090_10772002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae694Open in IMG/M
Ga0214090_10774076All Organisms → cellular organisms → Eukaryota → Opisthokonta1113Open in IMG/M
Ga0214090_10774877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea901Open in IMG/M
Ga0214090_10778794All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1356Open in IMG/M
Ga0214090_10792633Not Available642Open in IMG/M
Ga0214090_10793602Not Available527Open in IMG/M
Ga0214090_10794136All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta759Open in IMG/M
Ga0214090_10795050Not Available759Open in IMG/M
Ga0214090_10798445All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus507Open in IMG/M
Ga0214090_10803852Not Available515Open in IMG/M
Ga0214090_10810325All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae725Open in IMG/M
Ga0214090_10821493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays501Open in IMG/M
Ga0214090_10821836All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1117Open in IMG/M
Ga0214090_10823455Not Available531Open in IMG/M
Ga0214090_10835592All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1743Open in IMG/M
Ga0214090_10837980All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2779Open in IMG/M
Ga0214090_10845895Not Available603Open in IMG/M
Ga0214090_10848368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae949Open in IMG/M
Ga0214090_10855134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare1226Open in IMG/M
Ga0214090_10858014All Organisms → cellular organisms → Eukaryota → Opisthokonta795Open in IMG/M
Ga0214090_10858060Not Available523Open in IMG/M
Ga0214090_10859748All Organisms → cellular organisms → Eukaryota → Opisthokonta886Open in IMG/M
Ga0214090_10859794All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays610Open in IMG/M
Ga0214090_10864520Not Available714Open in IMG/M
Ga0214090_10864549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae501Open in IMG/M
Ga0214090_10875204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea abies1403Open in IMG/M
Ga0214090_10877415Not Available1037Open in IMG/M
Ga0214090_10885569All Organisms → cellular organisms → Eukaryota → Opisthokonta1027Open in IMG/M
Ga0214090_10910679Not Available781Open in IMG/M
Ga0214090_10927338Not Available1613Open in IMG/M
Ga0214090_10934956All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae826Open in IMG/M
Ga0214090_10937350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum624Open in IMG/M
Ga0214090_10948343Not Available1328Open in IMG/M
Ga0214090_10950367Not Available574Open in IMG/M
Ga0214090_10951709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Lactobacillus1355Open in IMG/M
Ga0214090_10956886All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum543Open in IMG/M
Ga0214090_10958217Not Available701Open in IMG/M
Ga0214090_10959067All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78680Open in IMG/M
Ga0214090_10976911All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria1136Open in IMG/M
Ga0214090_10979799Not Available516Open in IMG/M
Ga0214090_10997682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum669Open in IMG/M
Ga0214090_10999154All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica531Open in IMG/M
Ga0214090_10999433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes528Open in IMG/M
Ga0214090_11004292Not Available644Open in IMG/M
Ga0214090_11004806Not Available790Open in IMG/M
Ga0214090_11004864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum597Open in IMG/M
Ga0214090_11015245Not Available500Open in IMG/M
Ga0214090_11016152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum519Open in IMG/M
Ga0214090_11021230All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis546Open in IMG/M
Ga0214090_11021638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata553Open in IMG/M
Ga0214090_11036978Not Available567Open in IMG/M
Ga0214090_11039550All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1252Open in IMG/M
Ga0214090_11039748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays716Open in IMG/M
Ga0214090_11059902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae839Open in IMG/M
Ga0214090_11065089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1024Open in IMG/M
Ga0214090_11074914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1158Open in IMG/M
Ga0214090_11090557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo1181Open in IMG/M
Ga0214090_11106868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays575Open in IMG/M
Ga0214090_11115235All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1310Open in IMG/M
Ga0214090_11118270Not Available652Open in IMG/M
Ga0214090_11118774All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2840Open in IMG/M
Ga0214090_11122866All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Chlamydiales → Chlamydiaceae → Chlamydia/Chlamydophila group → Chlamydia1246Open in IMG/M
Ga0214090_11124705Not Available802Open in IMG/M
Ga0214090_11131241All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea690Open in IMG/M
Ga0214090_11135092All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae664Open in IMG/M
Ga0214090_11135839Not Available1176Open in IMG/M
Ga0214090_11140618All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae680Open in IMG/M
Ga0214090_11146456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae861Open in IMG/M
Ga0214090_11158701Not Available526Open in IMG/M
Ga0214090_11159736Not Available522Open in IMG/M
Ga0214090_11162243All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae668Open in IMG/M
Ga0214090_11170613Not Available1157Open in IMG/M
Ga0214090_11178376Not Available592Open in IMG/M
Ga0214090_11180438All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae792Open in IMG/M
Ga0214090_11196057All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae824Open in IMG/M
Ga0214090_11198773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1163Open in IMG/M
Ga0214090_11205830Not Available2267Open in IMG/M
Ga0214090_11207008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora529Open in IMG/M
Ga0214090_11210674All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei606Open in IMG/M
Ga0214090_11213089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum945Open in IMG/M
Ga0214090_11220602Not Available628Open in IMG/M
Ga0214090_11222225All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae768Open in IMG/M
Ga0214090_11226709All Organisms → cellular organisms → Eukaryota → Opisthokonta559Open in IMG/M
Ga0214090_11228107All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1099Open in IMG/M
Ga0214090_11231484All Organisms → cellular organisms → Eukaryota → Opisthokonta555Open in IMG/M
Ga0214090_11233291All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae840Open in IMG/M
Ga0214090_11245208All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1523Open in IMG/M
Ga0214090_11245575All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1042Open in IMG/M
Ga0214090_11249157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays547Open in IMG/M
Ga0214090_11249346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays747Open in IMG/M
Ga0214090_11253632All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae816Open in IMG/M
Ga0214090_11269586All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae763Open in IMG/M
Ga0214090_11276351All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1657Open in IMG/M
Ga0214090_11278082All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae516Open in IMG/M
Ga0214090_11290452All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1950Open in IMG/M
Ga0214090_11292509Not Available597Open in IMG/M
Ga0214090_11297583Not Available771Open in IMG/M
Ga0214090_11309457All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae661Open in IMG/M
Ga0214090_11309776All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus968Open in IMG/M
Ga0214090_11318452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays622Open in IMG/M
Ga0214090_11318609All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1372Open in IMG/M
Ga0214090_11322516All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus626Open in IMG/M
Ga0214090_11328866Not Available1152Open in IMG/M
Ga0214090_11330794All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amphibia → Batrachia → Anura → Pipoidea → Pipidae → Xenopodinae → Xenopus → Silurana → Xenopus tropicalis1532Open in IMG/M
Ga0214090_11332742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae516Open in IMG/M
Ga0214090_11338345All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1046Open in IMG/M
Ga0214090_11339307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum595Open in IMG/M
Ga0214090_11352927All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1192Open in IMG/M
Ga0214090_11353962All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum536Open in IMG/M
Ga0214090_11355769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1179Open in IMG/M
Ga0214090_11356780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5558Open in IMG/M
Ga0214090_11362671All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Psittaciformes → Psittacidae → Amazona → Amazona collaria1259Open in IMG/M
Ga0214090_11368347Not Available789Open in IMG/M
Ga0214090_11377047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1046Open in IMG/M
Ga0214090_11385377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria770Open in IMG/M
Ga0214090_11386480All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Passeriformes → Passeroidea → Fringillidae → Carduelinae → Serinus → Serinus canaria539Open in IMG/M
Ga0214090_11391508All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus843Open in IMG/M
Ga0214090_11392658All Organisms → cellular organisms → Eukaryota → Opisthokonta1431Open in IMG/M
Ga0214090_11400455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae1339Open in IMG/M
Ga0214090_11410133All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1940Open in IMG/M
Ga0214090_11412093All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus2197Open in IMG/M
Ga0214090_11417069All Organisms → cellular organisms → Eukaryota → Opisthokonta554Open in IMG/M
Ga0214090_11418410All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus789Open in IMG/M
Ga0214090_11419185All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1147Open in IMG/M
Ga0214090_11419218All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78510Open in IMG/M
Ga0214090_11419455All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2222Open in IMG/M
Ga0214090_11423898All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae594Open in IMG/M
Ga0214090_11432853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum594Open in IMG/M
Ga0214090_11433116Not Available1007Open in IMG/M
Ga0214090_11437623Not Available1010Open in IMG/M
Ga0214090_11438258All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Coraciiformes → Coraciidae → Eurystomus → Eurystomus gularis1184Open in IMG/M
Ga0214090_11444577All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae819Open in IMG/M
Ga0214090_11448754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea634Open in IMG/M
Ga0214090_11450593Not Available628Open in IMG/M
Ga0214090_11451928All Organisms → cellular organisms → Eukaryota → Opisthokonta588Open in IMG/M
Ga0214090_11459080All Organisms → cellular organisms → Eukaryota → Opisthokonta2404Open in IMG/M
Ga0214090_11469041All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus663Open in IMG/M
Ga0214090_11478809Not Available923Open in IMG/M
Ga0214090_11486824All Organisms → cellular organisms → Eukaryota → Opisthokonta832Open in IMG/M
Ga0214090_11488486Not Available3901Open in IMG/M
Ga0214090_11492371All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1164Open in IMG/M
Ga0214090_11494088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1948Open in IMG/M
Ga0214090_11495507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea715Open in IMG/M
Ga0214090_11495697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum510Open in IMG/M
Ga0214090_11500077All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae843Open in IMG/M
Ga0214090_11500794Not Available514Open in IMG/M
Ga0214090_11503488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5530Open in IMG/M
Ga0214090_11506795All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5613Open in IMG/M
Ga0214090_11510421Not Available616Open in IMG/M
Ga0214090_11512007All Organisms → cellular organisms → Eukaryota → Opisthokonta1066Open in IMG/M
Ga0214090_11528266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii714Open in IMG/M
Ga0214090_11529596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1684Open in IMG/M
Ga0214090_11537759Not Available657Open in IMG/M
Ga0214090_11551876All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea946Open in IMG/M
Ga0214090_11552854Not Available603Open in IMG/M
Ga0214090_11559443All Organisms → cellular organisms → Eukaryota → Opisthokonta941Open in IMG/M
Ga0214090_11568830All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2558Open in IMG/M
Ga0214090_11572996Not Available952Open in IMG/M
Ga0214090_11580530All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae689Open in IMG/M
Ga0214090_11585739All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris704Open in IMG/M
Ga0214090_11587557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1047Open in IMG/M
Ga0214090_11601814All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1562Open in IMG/M
Ga0214090_11603023All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae784Open in IMG/M
Ga0214090_11604209All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2120Open in IMG/M
Ga0214090_11605824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu698Open in IMG/M
Ga0214090_11612431All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1280Open in IMG/M
Ga0214090_11622948All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus615Open in IMG/M
Ga0214090_11623589Not Available972Open in IMG/M
Ga0214090_11628309Not Available653Open in IMG/M
Ga0214090_11638103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum587Open in IMG/M
Ga0214090_11644910Not Available634Open in IMG/M
Ga0214090_11645164All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays699Open in IMG/M
Ga0214090_11645784All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae766Open in IMG/M
Ga0214090_11651023All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1459Open in IMG/M
Ga0214090_11651845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1641Open in IMG/M
Ga0214090_11653914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae2536Open in IMG/M
Ga0214090_11654952Not Available698Open in IMG/M
Ga0214090_11656734Not Available1714Open in IMG/M
Ga0214090_11658117Not Available721Open in IMG/M
Ga0214090_11661166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae828Open in IMG/M
Ga0214090_11663731All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus501Open in IMG/M
Ga0214090_11669060Not Available659Open in IMG/M
Ga0214090_11675467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae787Open in IMG/M
Ga0214090_11676539All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus625Open in IMG/M
Ga0214090_11680445Not Available627Open in IMG/M
Ga0214090_11688170Not Available559Open in IMG/M
Ga0214090_11695062All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus641Open in IMG/M
Ga0214090_11695140All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1691Open in IMG/M
Ga0214090_11705860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo707Open in IMG/M
Ga0214090_11706923All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae511Open in IMG/M
Ga0214090_11713485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays640Open in IMG/M
Ga0214090_11718464All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo648Open in IMG/M
Ga0214090_11730327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1190Open in IMG/M
Ga0214090_11740357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae574Open in IMG/M
Ga0214090_11753199All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1784Open in IMG/M
Ga0214090_11760947Not Available620Open in IMG/M
Ga0214090_11761614Not Available521Open in IMG/M
Ga0214090_11765082All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae502Open in IMG/M
Ga0214090_11773348Not Available1203Open in IMG/M
Ga0214090_11773510Not Available627Open in IMG/M
Ga0214090_11775511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1289Open in IMG/M
Ga0214090_11779804All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1419Open in IMG/M
Ga0214090_11783864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries730Open in IMG/M
Ga0214090_11788462Not Available514Open in IMG/M
Ga0214090_11789487All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae743Open in IMG/M
Ga0214090_11792981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae617Open in IMG/M
Ga0214090_11802708Not Available639Open in IMG/M
Ga0214090_11803828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum717Open in IMG/M
Ga0214090_11813009All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus743Open in IMG/M
Ga0214090_11816103All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1291Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0214090_10009106Ga0214090_100091063F068298LCKVVLKGGQALEWAVQRGGGVTDPGGVQGMFGCGVEGHGLVRTIGDG
Ga0214090_10009773Ga0214090_100097731F001813GVTEPGGVQRAFGCCVEGHGLARTIGEGRIVGLHDPVGLFQP
Ga0214090_10010630Ga0214090_100106301F014592EDPIEWINHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEATLSYEDAKDPSAEASMVGGKFFTDVWDNGGREMAREIIQKSEKGIHDARKVAEAAEKSVEPEGQIGI
Ga0214090_10019650Ga0214090_100196501F002994LRTENAKLLAKVEKLNVCDDSLVNLKNDNASLIAKIDKLNESISSLKIENDKLIAKAKDLNVCNISISNLRDKNAILHAKIDELNACKPSTSTISHVSICTRCRDVNIDAIHDHIAMIKQQNDHIAKLDAKIAEHELENGKFKFSRSMLYNGTRPRIKDGIGFQQGSQ
Ga0214090_10026229Ga0214090_100262291F004815ARLDVALGSLVWWLATLHIGGGWNWMAIVVLFNPGHTMIL
Ga0214090_10034733Ga0214090_100347332F011632MSLNLNLCNYGGGVTEPDGAQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLF
Ga0214090_10045818Ga0214090_100458182F011735GVGKFKSMWYGPFIVKKVLKKGAYTLVDFEGNELPEPRNGLYLKKYYA
Ga0214090_10054277Ga0214090_100542771F068298KGGQALEWAAQRDGGVTEPGGVQRAFGCCVEGHGLARTIGDG
Ga0214090_10055969Ga0214090_100559692F005658MAWVEKDHSAHPVPTPCYVQGHQPQGQAAQSHVQSGLE
Ga0214090_10061115Ga0214090_100611152F001813GDVQGTSGHFVEGHGLVRSIGDGWMVGLCDPVGLFQPW
Ga0214090_10063686Ga0214090_100636861F033854MAVEGPDKMASDMEMCAKQRCVIEFLHAENMASVDVYRHLLNGYGDQTVDVSTEWWCGWCSL
Ga0214090_10065204Ga0214090_100652042F001813GVTDPGDVQRAFGCCVEGHGLVRTIGEGRMVGLDDPVGLFQP
Ga0214090_10079442Ga0214090_100794423F005658MAWVEKDHNAHPVPTPCYVQGRQPADQAAQSHIQPGL
Ga0214090_10081155Ga0214090_100811552F076912LENSTALSNGKGSNADKVQDSETSLLVSKKADKNYLDDSEGTQKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVLRQEAEGPRKSLQNSDAYFLVQQQVLEDLSAKQ
Ga0214090_10090942Ga0214090_100909423F004815VLKVLEAFKARLDVALGSLGCWLATLHIAGGWNWVSTVLLCNPDSSMSL
Ga0214090_10094825Ga0214090_100948251F057039MGLEMVVQVVEWERIYEMDVVEVVVVVEVDGRDSMELGMEDMEGNIEDIVDFPNNDRANHVAKIGFWVEMAKVSKEIVCSNYFEMDVHRLEIVN
Ga0214090_10109977Ga0214090_101099771F033854MAAEGQSDKLASDMEVHMKQRCVIEFLHEKVIVPTDIRGCLLNICGDQTLDASRMRQWVV
Ga0214090_10123450Ga0214090_101234502F011632VARHWNGLPFQRGGGVIKPGGVQRAFGCCVEGHGLGGTIGEGRTVGLDDPVGLFQP
Ga0214090_10132855Ga0214090_101328551F028713MVEAKRVLLVKVDTLKNVADALTKFVSTQKFSWCRETMDVAKLG
Ga0214090_10137492Ga0214090_101374921F018877SAEASMVGGKFFTDIWDNGGREMAREIIRKSEKGIHDAREVAEAGEKSAEPEGQIGIN
Ga0214090_10139777Ga0214090_101397772F051600MCSYSEKAMAPHSSTLAWKIPWTEEPGRLQTMGSHRVRQD
Ga0214090_10140034Ga0214090_101400341F097597MWQHFPSNNAIMGAMKQWVISAGANFYEHRLQALIHCWQKCIANGGDHAEKWRFVAENLL
Ga0214090_10142842Ga0214090_101428422F020492MGMRAALLTSAALTAEVHALKQSLERSKNKLGRAKKQLEDKEGE
Ga0214090_10151819Ga0214090_101518192F028713MVEAKRVLLVKVDTLNNVADALPKSVITEKFFSCRETMGVAELG
Ga0214090_10153318Ga0214090_101533181F004815LDVALGSLVCWLATLHIAGGWNEMSIVVLFNPGNSVILGFSSCDDSS
Ga0214090_10154325Ga0214090_101543251F001813GGGGVTDPGGVQRMFGHCVEGHGLVRAIGDGWMVGLDDPVGLFQP
Ga0214090_10156402Ga0214090_101564021F032187LVCNSNIAVSSLPSKPAEASPSPHPKGDDEIRKMAEAIMDKVVNQLLNEAAEIVLKED
Ga0214090_10156402Ga0214090_101564022F014592DICAFSGARGIATILERKGCEHVNSLAQSEATLSTADIKDPSPEASMVGGKFFTDIWDNGGRELAQEIIQRSEKGIHDARKVTEAAEKSTEPEGQIGIN
Ga0214090_10156892Ga0214090_101568922F065766MAEENKDKGARDPIKILLDEALEKQRNAMMDNFAQSLQRL
Ga0214090_10164502Ga0214090_101645025F014346MDAFERMVVLEKTPEGPLDRKEIQPVHSEGDQPRDFFGRTDAKAETPVLWPPHAKS
Ga0214090_10168281Ga0214090_101682811F020828VSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPPSDQLKQLVELHKVAEQAMKGLIVRLWPGEAMPGSYFGLVRRLVDACPWVEVIKRSACIEGARRALARAKVHWGKLDAEKLITDAPPVGKEYRTPEMYYKTVLKGARKIADECPRDVIIE
Ga0214090_10176018Ga0214090_101760181F014346VVLEKTLESPLDCKEIQPVHPKGDQSWMFTGGTDAEAETPVLWPSH
Ga0214090_10177837Ga0214090_101778372F003406MKEWFYVKNDLKVREDIKDVIMCPIWQRFGLRKPKVEMDEVAEECQRAFGVVCSFIGTRDLIQEHIAFRVWPLADNWEMPKETVKETDEGGLVRLKYTFKYGDKFVEPDDDWLKSIETVSDELLGVYSKAEDTALSAAFGGRKKKRLNRVFDAVGFVYPDYHYPVRGQKRKGTTSAKETASAAPSEPAPKRKRVKVLAHRPRYIEPATVPEFAGETSSVIENKEPTSVL
Ga0214090_10180727Ga0214090_101807272F092835TIFRYVRLLAGRQHSQFWPILTRFVDYYSPFWGPGVISTINEPQGAFTCRSSTLTYSADSSPFCALLLSVLGTQSDFHD
Ga0214090_10188173Ga0214090_101881731F093003MPPSGDEASLDDDEFVVPGDPVEQERFKCRLMAMANSLKKKQQQLRADLDLQADRWTEVLAAEEHELERPSKSYPKCKLLPQLEVEAYDPASPGDNTADRPPRGRDREASRPFTRPVPRHRSKSTRPQGNTPDLRDILEDKARQSRSIYGSRGRPTIRDDHRHPGHSKSGRAEHNRQSSFELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLRHIHMARGDDLHAIKYLPLKLKGPARHWLN
Ga0214090_10196621Ga0214090_101966211F002994VEKCEKLTSELSACHDIVSNLRNENAKLIAKVEKSNVCDDSIVNLRNDNANLIAKIDKLNASLSSLKIENEKLIAKAKDLNVCNASISNLRDENAILHAKIYDLKSCKTSTSTVDHVSICMRCRDINVDAIHDHIAIIKQQNDHIAKLDTKIAEHELENEKINLLIACFIMGDALAL
Ga0214090_10210880Ga0214090_102108802F104139LNEVWEGVDLDSTPSSRSGALHAPDLPWVGFPPGALSLLQAMT
Ga0214090_10221540Ga0214090_102215405F004001MARKVEESPSLKVSKNCVDVALWDVVSGHGRGGLLVGLDGLSCLFQP
Ga0214090_10224482Ga0214090_102244821F062313MTMCVGMTEDEMVGWHHQLNGHGFGWTPEFGDGQGGLECCGSWTHKESDTTERLN
Ga0214090_10224567Ga0214090_102245671F004815VGATSLQAFKASLDVALGSLGCWLATLHIAGGWNEMVIVILFNPGHSVIL
Ga0214090_10228477Ga0214090_102284772F033854MAAEGQSDKMVSDMEMHIKQRRVTEFLHVEKTAPIVIHRRLLNVYGDQPGDVSTMREWKSWSG
Ga0214090_10234689Ga0214090_102346891F033854QRCVAEFLHVEKFAPIDIHQLLLNVYGDQTVDVSTVSGRWCISAVESVI
Ga0214090_10234889Ga0214090_102348892F095123MNALSREGCRHFEVFDQADEDFERDIYKVEDPIVKESAGAIYDRMWGPHGREVVRERSETARGQVMFDFCLVLLNVGYMWVC
Ga0214090_10235835Ga0214090_102358352F004815VDAPSLQAFKARLDVALGSLGCCLATLHIAGGWNWVSIVALGNPGHTMIL
Ga0214090_10242598Ga0214090_102425982F038012MIIEFQPPCYVQGHQPPDQAAQSHIQPGLEYLQGWGIH
Ga0214090_10245405Ga0214090_102454051F093003RMLLPQLEEEETKPTSPAYDAPDRPPRGRDREAFRPSNQAAPRHRSKNTIARGNATDLRDILEDKARQTRLIYGSRGRPTIRDDDLHAGYGNSGRAEHSRQSSFELRRDIAQYRGAAQPLCFTDEVMDHQIPEGFKPVNIKSYDGTTDPAVWIEDYLHIHMACGDDFHAIKYHPLKLKGPARQRLNSLPTGSISCWEDLE
Ga0214090_10247086Ga0214090_102470861F020828LKQLVELHKAAEQDMKGFIVRMWPGASLPNSYFGPVRRLVDACPWLEVIKRSVCIKAARRAFARAKVHWAKMDAEKLVKEGPPQGKEHRHPEMYYEGVLKGARLVADECAKDVIFE
Ga0214090_10258022Ga0214090_102580222F083289MPGYKGTITVHGSCKIALECEEGDAAYAESVCAAEELKFYKDNVDPTDMTSLKKPTTEQEPAMKFKSADETKLVDFVPGDSSQQFSISANLDP
Ga0214090_10259675Ga0214090_102596751F005658MAWVEKDHNAHPVPTPCYVQGRQPPDQAAQSHIQPGLECLQG
Ga0214090_10260348Ga0214090_102603481F004815SLQAFKARLDVALGSLGCWLATLHIAGGWNWVSTVGLCNPGLSTIL
Ga0214090_10264957Ga0214090_102649572F053764MAKTKIRLIIFFAAKDGALYSQQKQDKELTVAQIMNSLLPTSDLN
Ga0214090_10265427Ga0214090_102654273F096316MAWVEKDHNAHPVPTPCYVQGRQPADQAAQSQIQPGLECLQGWGIHSLLGQQFQMAPQV
Ga0214090_10268265Ga0214090_102682652F001813GVPGTFGCCIDGHGLVRTIGDGWMVGLGDLVGLFQPW
Ga0214090_10276714Ga0214090_102767142F001813LKGYITKALEWAAQGGGGVTNPGGVQGTFGHCVEGHGLMRTIGDGWMVGLGDPVGLFQPW
Ga0214090_10278781Ga0214090_102787811F004001VESSLEVLKKCAVVALRDMVSGHSGDRSAVGLDDLSGPFLP
Ga0214090_10288640Ga0214090_102886402F020828MPLSDQLKQLVELHKPAEQAMKGLIVRLWPGGALPGSYFGLVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPENYYKDVLKGACLMADECSRDVIFE
Ga0214090_10290892Ga0214090_102908921F001813QGRGGVTDPGGVQRAFGCCVEGHGLLSTIGDGWMVGLDDPVGLLQPW
Ga0214090_10293518Ga0214090_102935181F068298QALEWAAQRGGGVTEPGGVQRAFGCCAEGHGLARTTGEG
Ga0214090_10293866Ga0214090_102938661F007510MDGGAWKAAIHGVAEGRTQLSDFTFTFHFDALEKEMAINSSVLAWRIPGTGEPGELPSMGSHRVRHD
Ga0214090_10295006Ga0214090_102950062F020492MHVQATLLASAALTAEVDTLKQDLERSEQELERAKKQLEDNEGKKYLVFKYI
Ga0214090_10295576Ga0214090_102955761F004001VESLPLEVFKNHMDVALRDLHNGHAAGGLMVGLGDLSGL
Ga0214090_10301028Ga0214090_103010281F038489MAXVKKDHNAHPVSTPCYVQGRQPAAQAAQSHIQPGLKC
Ga0214090_10319320Ga0214090_103193201F002471LGFKREAKNLTSHKAPIPAKEKGNAPMASSAKKNHAFMYHDRRQTRNACRNYNAYDDFNSHAMVASSSSYMHGRNMSRRNAIHHVPRKNITHAPRKVVNEPSTIYCALNASFEICRKDKKIVARKLGAKCKGDKTCIWVPKTIVTNLVGPNKSWVPKTQA
Ga0214090_10319508Ga0214090_103195081F034384FLCLKVNLYAQQSFSTVIFPFDRCLDSVIALAEFCQDFEEETSRLEPNLDPVNSPVNDEVAMNVFRLESRVAAVVDYLARLKVATSRIDSTLWPGETLQNDLESLMARLNAVPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPSARATSP
Ga0214090_10325810Ga0214090_103258102F004815FKARLDVALGSLVWWLATLHIAGGWNEMSIVVLFNPGHSMI
Ga0214090_10326103Ga0214090_103261031F038489MVWVEKDHNDHLVSTPCYVQGHQPPDQAAQSHIQPGLQR
Ga0214090_10326110Ga0214090_103261103F038489MAWVEKDLKDHHVSTPCYVQGRQPPDQAAQSHIQPGLE
Ga0214090_10326986Ga0214090_103269861F004815FKARLDVALGSLVWRLATLHTAGGWNWMSVVVLCNPGHCRTLIL
Ga0214090_10328926Ga0214090_103289263F038489MAWVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQPGLE
Ga0214090_10330525Ga0214090_103305251F015450MLLSKALKMQQDLEDKKHEAIIENLESKIKEQSAIIEKKDFELQSTEGLLAETEAKILELNSKLINQSKQFDQEKLELNSKLKAEVQTSSELKKALTSLQDKCLNFGNNCIGRLKKIFYSVGASSVKFNPSAENLPQAFDHIEAEIEELDEVIAGHGDFCAWVASRGTAAAFLKAGCEHGKVVNRPNFTLSSSILDDMPDLARSISNRFIKMVWTKGGREKAGDEARSQLEPVRNNP
Ga0214090_10332362Ga0214090_103323622F096850ETVKNQKVPAVTPKRKRMANVLDVLETIISSSTPPKKAAVTFETTAEISGSAAPEQEIEAEAGPSEPAKAKTSENEAEKITKPTFVEETGVVTPEASPKIRDYIFRHASGKKLSEKEEQEAQHYAQKLKYPKGALIFNGSGEEDFLYCLPDSKEISVCREMSRSFGFPTLEDGLSVLSKNDLADSLAYNSLKVRQMEFLYFC
Ga0214090_10332888Ga0214090_103328881F079404KSSEDWPSEWFYIEDVPLPDPVRIGLPEFNSAPLKKRLSWRPRSPQRESDRDIIYLMGRIRLLAHSGLTMIGVMAECIMRGVQPLQYRSHPMWDFNGEDDATRYGRRGPDSAAALLKILSTLYKGEEEEFLRVSPQGGFSMHNPPSWVSGRIYLSIRFVFPLLNIQSDDFNAGTAP
Ga0214090_10343945Ga0214090_103439451F004001EVFKNHGDVALRDVVSGDGGTGVGVGLGDLRGLFKPY
Ga0214090_10347620Ga0214090_103476201F005658MAWVAKEHNAHPVPTPCYVQGCEPAAQAAQSHIQPGLECLQGWGIHSL
Ga0214090_10351084Ga0214090_103510842F096316VAWVEKDHNDHLVSTPCYVQGRQPADQAAHSHILPGLECLQGWGIHSLLGQPVQCVTTLWVKNFLLK
Ga0214090_10354047Ga0214090_103540471F002471RKSEFDKLKFARDAYTIGRHPSIKDGLGFKRETKNLTSHKAPISAKEKGKAPMTNSSQKNHAFIYGDKRYFRNVHRSCNDSNAMFASSSSYMHGRDMPRRNVHVPRKINEPSTIYHACNASFAICRKDKKVVARKLGAKCKGDKTCIWVPKAIVTNLVGPNKSWVPKTQA
Ga0214090_10358582Ga0214090_103585822F096316MAWVEEDHNAHPDPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLP
Ga0214090_10359852Ga0214090_103598522F027437LFGCLLLGMTRQISTLEEKHSRDQAELVQRCSDFEEKYSQSQTELAQVFAALDDANALSSSVHTQLNSEKVTYETVPCLVVLLLLV
Ga0214090_10363312Ga0214090_103633121F004815APSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVLLFNPGHSMVL
Ga0214090_10364807Ga0214090_103648071F038489MAWVEKDHSDHLISTPCYVQGHQPPDQAAQSHIQPGLE
Ga0214090_10366917Ga0214090_103669171F067310SARCGADVALSLVRIHCKEAREEKLAAIQVANTRKHNFQDLMETFIAAATRIADGIDLDEFVASSSPLPEE
Ga0214090_10370684Ga0214090_103706841F011632MKAGENMQVLVKEKMILSIXKGGQALEWAAQRGGGVTEPGGVQRAFGCCVKGHGLAGTIDEGXMVGLDDPVGLFQP
Ga0214090_10374592Ga0214090_103745921F038489MAWVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQP
Ga0214090_10379807Ga0214090_103798071F001813TDPGGVQGTFGCCVEGRGLARTTGDGRMVGLDDPVGLFQP
Ga0214090_10382728Ga0214090_103827281F001813SQALEWAAQGGGGVTDPGGVQGTFGHCVEGHGLVRTISDGWMVGLGDPVGLFQPW
Ga0214090_10386033Ga0214090_103860331F067310LQNDLQSVMTRLNEVPSRVQEWKKSSARCGADVALSLARVHCKEAREDKLAALKVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0214090_10389786Ga0214090_103897861F001813VQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_10391651Ga0214090_103916511F038489MAWVEKDHSDHLVSTPCYVQGRQPPDQAAQSHIQPG
Ga0214090_10398267Ga0214090_103982671F032472PRSAGFDTDIGAFIESSTLPSPKGLMAPSIINDDAVQRETFLPGQIFMFGGFALWANSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLIFDGSEPQPSVPRCHDGHDLTLPPDSTLEAAHESAPTHSPEPIAQIEDGWLDTASGAATSTAMEPNTYLVPHKAHDSEVPDSLPDSEPP
Ga0214090_10398771Ga0214090_103987711F011735MWHGPYIVKCVLKNGAYELIDYEGVPLAQPRNGLYLKKYYA
Ga0214090_10400958Ga0214090_104009581F001813AQRGGGVTEPVGVQRVFGCCVEGHGLVRTLGEGRMVGLDDLVGLFQP
Ga0214090_10402628Ga0214090_104026283F004815LDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGHSMIL
Ga0214090_10403437Ga0214090_104034371F035626MAPSIINNDAGQGETFLPGQIFVFGGFALQANSLGHLEQIESYAPGRQVRFGSLNYTADIHGDLILDGFEPLPSAPHCHDEHDLALPPNSALEA
Ga0214090_10412608Ga0214090_104126081F005658MAWVEKDHNAHPVPIPCYVQGRQPPDQAAQSHIQPGLECLQGWGLHHLLGQPV
Ga0214090_10413188Ga0214090_104131881F038489MAWVEKDHNDHVVSTPCYVQGRQPPDQAAQSHIQPGLEC
Ga0214090_10413930Ga0214090_104139301F096316MAWVAKVHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0214090_10414790Ga0214090_104147901F004815ARLDVALGSLGCWLATLHIAGGWNWMSTVLLCNPGHSRIL
Ga0214090_10415849Ga0214090_104158491F038084VVWYSHLFKNFPWFVVIHTVKGFSIVNKAEIDVFLELSRFFNDPEDVGNLISGSSAFSKTNLNIWKFMVCLLLKPDLKNFEHYFTSV
Ga0214090_10421453Ga0214090_104214531F096316MAWVEKEYNDHRFPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLLGQP
Ga0214090_10422102Ga0214090_104221022F004001VVFKKHVDVALRDVVIGQGGNWMGVQLGDLGGLFQP
Ga0214090_10423637Ga0214090_104236371F093003SYPKRRPLPRSEEEAPTSPAHDMADRPPRGRDREASRPSTQAMPRRRSTKARENVPDLRDILEDKARQTRSIYGSRRRPTARDDDLHSGYNKSGRAEHNRHSSSELRRDIAQYRGAAHPLCFTNEVMDHKIPEGFKPVNIESYDGTTDPAVWIEDFILHIHMARGDDLHAIKYLPLKLKGPAPDSWVDTGPIVCSYFGL
Ga0214090_10423823Ga0214090_104238231F094706VTIPRQLAPTVGPAHGGFEFLKGSFEGLKGYAVGRMTKSRRGKLYIDDANWGPDAGSIEYGYRVPFGGIHVFIGKIGEPGPEPGLCADLVETAQRARPARARPALRHAFVGCIHGGLSDRSGSGDETAAGSDGESSTDESNSLYQLQDGRLMGCSDGDSIPDPFEPPSQVGVFMAGAQSVQNPAAGAGNPVPSP
Ga0214090_10426864Ga0214090_104268642F028669MYTPHEIKKQRSRCRSNQFITNVNKGDEERRGQTLLRIGVMGKRRQATEKIERSKQCVKR
Ga0214090_10431765Ga0214090_104317651F028669MYTWREIKKQQSRCWSDQFITNVNKGDEERGGWTLLWIGVMGKGRRSIEKIGNRSKESL
Ga0214090_10432703Ga0214090_104327032F007409MSEEKKVAAGVKLSLSEEKNLGFIESIAKTNTEKITREILEGLSEDTGESDSYDADSGGEDSEDRPWRPSHSVFGKSTIGQSHLENMRGRYFRDMSIVRADDGERTVPTPEDNEVVIFRS
Ga0214090_10445569Ga0214090_104455693F005658MAWVEKDHSAHPVPTPCYVQGHQPAAQAAQSHIQPGLEC
Ga0214090_10451728Ga0214090_104517281F011735YGPFIVRKVLKKGAYTLVDFEGNELLEPRNGLYLKKYYA
Ga0214090_10454696Ga0214090_104546961F093003HELERPSKRYPKHKLLPRLKEEAYEPASRADNTADRPPRGREREASRPSTRTVPRHRSKSTRPQGNALDLRDILEDKARQSRSIYGSRGRPTVRDDNHRAGHSKSGRAEHSRQSSLELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDDLHAIKYLPLKLKGPSRHWL
Ga0214090_10456724Ga0214090_104567241F038489MGWVEKDHNDYLVSTPCYVQGRQPADQAAQSHIQPG
Ga0214090_10468936Ga0214090_104689362F038012MIIEFQPPCYVQGLQPPDQAAQIQPGLECLQGWGIYNLLGQPVPVRR
Ga0214090_10469866Ga0214090_104698661F073390IATILERKSCEHVKFLAQSEAALSSEDIKDPSAEASLVGGKIFTNIWDNGGREMAQEIIRKSEKGIHDARKVAEAAEKSAELEGQIGTN
Ga0214090_10469955Ga0214090_104699551F067310RVQAWKKSAGRCGADVALLLVRVHCKEAHEEELKALQVANTKKLRFEDFMEPFLDTATRIADGIDLDTFVEPASPGDA
Ga0214090_10470097Ga0214090_104700971F104139LPTLKEGWEGVDPLSTPSSHSGTLHAPAIPWVGPAFPPGAQSLLQAVT
Ga0214090_10470341Ga0214090_104703411F053764MVNTKIRLIIFFAAKDEEALYSQQKQAWELTVAQIMNCLLPNSDLN
Ga0214090_10471855Ga0214090_104718552F093243MLLQYIPTEDQDADILTKALTKRKFEYHRDRIRVKDNPFLVEREC
Ga0214090_10477286Ga0214090_104772862F007510MEGGAWWAAVHGIAKSRTRLSKFTFTFHSHALEKETVTHSSILAWRIPWTEEPTVLQSTESQRVGKDGVTSLSLSL
Ga0214090_10478376Ga0214090_104783761F038489MARVEKDHNDHLLSTPCYVQGHQPAAQAAQSHIQPGLEC
Ga0214090_10479529Ga0214090_104795291F033854MAAEGQSDKTACDMEGYMKQNSVTEFLHEENIVPTDIHXCLLNISGDQTADM
Ga0214090_10485174Ga0214090_104851741F027342HEARVVEVQQELHALVTKHEALKLDLKTRESELAVALKSAKNAKAKAQKALQEIDAMKKIVAGKAFYMQSKHVKVNYRLLTRIRSSPGAFADLPRSVSDATQFYQAEEGSSTEKLFWSQYTGTEHPMPLSDQLKQLVELHKAAEQAMKGFIVRMWPGDALPNSYFGLVRQLVDACPRLEVIKWSVYIEGAHRAFARAKVHWAKL
Ga0214090_10487103Ga0214090_104871031F076912LEKSTPLCNGRESNADKVQDSETTLLVSKKGYKNDLVDSEKTPQSCVDVVFELLASTAGTSSSNSLPESLRLLQSQLQAERHQSAVLRQEAEGLRKSLQNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0214090_10487674Ga0214090_104876741F038489MAWVEKDHNAHLVSTSCDMPGHHPAAQAAQSHIQPGLECLQG
Ga0214090_10493678Ga0214090_104936781F038084VVWDSHLFQNFPQFIVIHRVKDFGIVNKAEIDVFLELACFFHDAGDVGNLICGSSAFSKTSLNIWKFMVHVLMKPGLENFEHYFTRT
Ga0214090_10498956Ga0214090_104989561F034461MVGYDCEIIYKKGKLNVVADALSRKNEEVVALLCAISIIQPDWITEARDEWKMDEEVWTLIQKL
Ga0214090_10510252Ga0214090_105102521F005658MAWVEKDHNDHPVPTPCYVQGHQPAAQAAQSHIQPGLEC
Ga0214090_10513909Ga0214090_105139091F004815AFKARLDVALGSLDCWLATLHIAGGWNWMSIVVPFNPGHPMML
Ga0214090_10514876Ga0214090_105148761F005658MAWVEKDHNAHPVPTPCYVQGRQPPAQAAQSHVQPGLEC
Ga0214090_10518502Ga0214090_105185022F083289AYAESVCATEELKFYKDNVDPADMTSLKKPTTEHEPAMKFKSADETKLVDFVPGDSSQQFSISANLDPK
Ga0214090_10522062Ga0214090_105220621F103019MLFFHHAGKMSLIPPPAGGLSAAIVVVARRWKEYHVVAAVEGHELKTPETEHRPGLERLLETAHLELDGKLFVSTQQAPTWRANCRRFETGGSLSRRVNVAACPSPDGSMRGRAR
Ga0214090_10525686Ga0214090_105256862F096316MAWVEKAHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVP
Ga0214090_10532975Ga0214090_105329751F035626MAPSIIDSDAVQGETFLPGEIFVFGGFALRANSLGHLEQIESYTPDHQVRFRNLNYTADNDGDLIFDGFEPLPSVPHGHNEHDLALPSDSCQETAPATAPTLNSEPIAPSMDGWIDPATEAV
Ga0214090_10534069Ga0214090_105340691F038012MIIEFQPLCYVQGCQPLDQAAQSHIQPGLECLQGWGIHNLL
Ga0214090_10534636Ga0214090_105346361F081962VLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRWASARAGAIAALSRAKAFLPKLDPADIALGYPSLKEDGTPFDQKDFAVSVKIVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVMGTTGGAERDEPEASTPQAP
Ga0214090_10536930Ga0214090_105369301F012765MEELDNQRCRLQESTDEVTRLTQLISAKDATIKGLRTSKKSIAQELETAQQAVKVAEEAAVTFKAQRDKALDKAIRAGRILMRRPGVVVPEDIRADVVAAPDSSNRPSSSVVPEKDIGK
Ga0214090_10538246Ga0214090_105382461F032472IKRARTWVKHRVPCLLFPSGLDAQYGTPYLRSAGFDTDIGAFIESSSVSSLLGLMAPTIIDSDAVQGETFLPGQIFVFGGFALRANLLGHLEQIESYAPGRQVRFGSLNYMADIRGDLIFDRFEPQPGAPHCHDGYDLALPPKSTLEAAPASAPTLSSEPTAPIEDGWLDTASGAAVSTAIEPNTSLILREARDSKVPDSFPDSEPPAPLPIESDWAPIMEFTAADIFQHSSF
Ga0214090_10546559Ga0214090_105465591F028669MYARREIKKQRFKCWSDQFITNVNKGDGERGGGTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0214090_10552077Ga0214090_105520771F034461MLGYDFEIVYKKGKQNVFAEALSRKDEEVEALFCAIYIIQLDWITEARDEWKKEEEVWTLIQKLQ
Ga0214090_10553652Ga0214090_105536521F001813MHGTFGCCVEGHGLAGTSGEGRMVGLDDPVGLFQP
Ga0214090_10553925Ga0214090_105539251F003406CQRAFDVVCSFIRTRDLVQEHVAYRIWPLVDNWEMPKETISNPNEGGLVRLKYTFRFGEQFIELDDDWLKCVENTSDELLGAYSKSEDNALSAAFGSRKKKRLNRVFDAIGFMYPDYRYPPRGQKRKRGTSGKDVASAASSEPAPKRKKVKVLTHRPRYIEPAIVPEFGGETSLATEAKEPAVTQKTEEPAAMSKASPA
Ga0214090_10555079Ga0214090_105550795F038012MIVEFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHSLL
Ga0214090_10570194Ga0214090_105701942F020289MVGWHHQLYVHEFEQAPGVGDGQGSLVCSPWGLKESNATERLN
Ga0214090_10575527Ga0214090_105755272F004815RLDVALGSLVCWLATLHIAGGWNSMTIVVLFNPGHSMIL
Ga0214090_10577472Ga0214090_105774721F004815RLDVALGSLGCWLATLHIAGGWNWMSIVGLFNPGQSVSL
Ga0214090_10586918Ga0214090_105869181F011632QRGGGVTEPGGVQRAFGRCVEGHGLARTIGEGQMVGLDDPVNLFQL
Ga0214090_10594110Ga0214090_105941101F011632VVCNWAAQRGGRVTDTGGVQGTFGCWDEGHGLMRTIGGVWMVGLGDPVGLFQPC
Ga0214090_10596290Ga0214090_105962901F001813GVQRAFGCCVEGHSLVGTIGEGQMVGLDDPVGLFQP
Ga0214090_10605305Ga0214090_106053051F004001VAQLPREVVQSPSLEAFRNRVDVVLRDVVSGHGGGGLLVGLGDLGGLFQP
Ga0214090_10610873Ga0214090_106108732F001813MGCPERWFTDPGGVQGTFGRCVEEYGLVRTVGDGWNVGLDDLVGLFQPC
Ga0214090_10614941Ga0214090_106149411F004815EGFKVRLDVALGSLVWWLATLHVAGGWNSMIIVVLFNPGHSVIL
Ga0214090_10619777Ga0214090_106197772F038012VIIEFQAPCYVQGCQPLDQAAQSHIQTGLKCLQGWGIHNLLGQPVPVCHH
Ga0214090_10620952Ga0214090_106209521F038084VVWYSHLFQNFPQFLVIHTVKGFGIVNRAEIDVFLEFSCFLHDTADVGNLISGSSAFSKTSLNIWKFMVHVLLKSGSEHFEHYFVVCEMSAIVW
Ga0214090_10624263Ga0214090_106242631F076748MPTPMRFIQLPGDSPPLYVSKSSFSQSDSSWFDWDDEEAVLFPNWDTGFTRFEIGITS
Ga0214090_10624263Ga0214090_106242632F076748RFIKLPGDSPPVYVSKSSFSPSDSSCFDWNDEEAVLFLNWETGVT
Ga0214090_10625195Ga0214090_106251952F023843MASGGKIEIEKFNAQSFELWKLKMEDLLVDKDQWIAVDPGTKPTAMLDEDWKKLDRKVKRTI
Ga0214090_10627020Ga0214090_106270201F004815AFKARLDVALGSLGCWLATLHIAGGWNWMCTVGLCNPGRAVVL
Ga0214090_10628292Ga0214090_106282922F065416MSPTRLGYKELGLDLVEPLQDQPRKPXWTPMGDEKKDEGAGDPIKILLKEALEKQRNVMMDNFS
Ga0214090_10633186Ga0214090_106331861F038084ISQETGQVVWYSHTFKNYPQFVVIHTIKGFGIVNQAEIDIFVELSCFFDIPTDVDNLISGSSAFSKSSLNIRKFTVHILLKPGLENFEHYFSSM
Ga0214090_10639553Ga0214090_106395532F069772MTEWFYVKNDLSVREDIKGIIMRPIWQSFGLRRPKVEMNEAAEECQRAFGVVCSFIGTRDLVQEHIAFRVWPLAEKWEMPQETIKEADEGGLIRLKYTFKFEDKFVEPDDDWLKSIENLSDELLGVYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYRYPIRGQKRKGTTSAKEEAAAAPSEPAPKRKTIKVLTHRPRYIEPASVPEFAGETSLATEAEKPIKPTLLPEVAEMAEAPTTKELEEPKILLPETKEMAEAPSTEKMEEAKGSIKGAKISEILSPSVEIEVARIKKGPTVTPKRKRMV
Ga0214090_10641955Ga0214090_106419552F096729VEDSRNVGVFASSPGSFFRRRWLRGGRRRSDGDFASESALVVDLIRSGSATRGFVNVWWFVVAAWFRETSAGSGFVAAEVARNTDLVVFA
Ga0214090_10645176Ga0214090_106451761F035626MASSIIINDAVQGETFLPGQIFVFGGFALRANSLGQLEQIESYAPGHQVRFGSLNFTADIRGDLIFDGFEPQPSAPHYHVGHDLALPPDSTLEAALEPAPILNSEPTTPIEDGWLDTTSGAAIPMAIEPNTSPALRETRDPKEPDSSPDSGPFA
Ga0214090_10649254Ga0214090_106492541F086390VNEPRKSEYKDFLASITVGESRETAQATIRSIHFPAIHYFALFIGRCFNGKDEACHMCVPDLCVLKSAALGDKQYNLGTIIARRLHNNGLDGDLFGGIYATHVANYLDLPIHENDTELPPAYLDYNAMVSHHFLERNEQFLQYRLIFDRRLAVHITLPAPTLFDYQGKRRYVVTREEATEYERRTETTRLQAAPHQAIAAASQYDPSYNFGYP
Ga0214090_10653161Ga0214090_106531611F068298MLEWAAQGGGGVTDPGGVQGTFGCCVEGHGLVRSIGNG
Ga0214090_10653426Ga0214090_106534262F020492MGLQAALLTSATLTAEVNTFKESLKRSENELDRAKKQLEDKEGE
Ga0214090_10664103Ga0214090_106641032F028669MYARGDIKKQWFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0214090_10665008Ga0214090_106650081F004001ESPFLEVFKKRVDVALRDMVSGHGGDGLMIGLDGLSGLFQAY
Ga0214090_10670464Ga0214090_106704642F000459VHSGRIKRAENVKRGRGRPNLTWEESVKRDLKDWNITKELAMDSGAWKLAIHVPEP
Ga0214090_10674943Ga0214090_106749431F004001HSLVVFKKCRGVAPRNTVSGHGGDGLMVGLDDLSGLFQP
Ga0214090_10676622Ga0214090_106766223F001813DPGGVQRAFGCCVERHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_10691518Ga0214090_106915181F005658MAWVEKEHSAHPVPTPCYVRGRQPAAQAAQSHIQPGLECLQGWGIHSL
Ga0214090_10695882Ga0214090_106958821F068298GQALEWAAQRGGGVPVPGGVQRAFGCCVEGHGLVRTIGDG
Ga0214090_10696159Ga0214090_106961591F011632GQALEWAAHKGGGVTEPGGGQRAFGCCVDGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_10704738Ga0214090_107047381F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVGLFNPDHSVIL
Ga0214090_10705487Ga0214090_107054871F002994EKCEKLTSELSTCHDIIANLRNENAKIIVKVDSNVCDVSIPNLRDDNVSLLAKIEELNVSLASLRNDNEKLIAKAKELDVCNVTISDLRDNNDILRAKIVELNSCKPSTSTIEHVTICTRCRDINIDAIHDHMALIKQQNDHIAKLDAKIAEHDLENEKFKFARSMLYNGIHPSIRDGIGFQQGDNVKLNAPKKLSNF
Ga0214090_10711242Ga0214090_107112421F004815LQAFKARLDVALGSLGCWLATLHIAEGWNWMSTVVLFNPGHSVIL
Ga0214090_10716405Ga0214090_107164051F037171MDGCMYVCNRIENDSVEEPEELAGEAPEQQSVGGGKCPLTYLSPIHSIIHFPHLHNYT
Ga0214090_10718017Ga0214090_107180173F011735IVKHVLKNGAYELIDYEGVPLVQPRNGLYLKKYYA
Ga0214090_10720257Ga0214090_107202572F083289MARPCYVYLQLKMPGHKGTITVHGSCKIALECEEGDAAYAESVCATEELKYYKDNVDPADMTPLKKPTKEHDPALKFKSAAETKLVDFVPGDSSKQF
Ga0214090_10721903Ga0214090_107219031F001813GGVTKPGGVQRAFGCCVEGHGLVRTIGDGRMVGLDDPVGLFQS
Ga0214090_10731306Ga0214090_107313061F038489MAWVEKEHSDHLISTPCYVQGRQPAAQAAQSHIQPGLEC
Ga0214090_10742323Ga0214090_107423232F065281LAKKSIVTSIRLNEDDFLKIKEVKEKYGVSWTKLIAYASELLEKDMKDTEENNNENRNLV
Ga0214090_10752168Ga0214090_107521681F068298MRRNGLQKSGQVLEWAAQGGGGVTNPGGVQGRFRHVEGCGLVTVGDG
Ga0214090_10757734Ga0214090_107577341F068298MGGQALEWAAQGGGGGTDPGGVQGKFGCCVEGHGLVRTVGDGWMAGLA
Ga0214090_10758594Ga0214090_107585941F027342LKKIAAGKEFFIQSKHVSVNYLLLTRIRSSPGAFADLPCSVSDAAAFYRAEEGSSTEKVFWSQCAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIARLWPGEVMPGSYFGLVRRLVDACPWVEVINHSACIEGARQAVARAKVHWGKMDAEKLVTDAPPPGK
Ga0214090_10764757Ga0214090_107647571F001813VTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0214090_10768365Ga0214090_107683652F065281MEKKSIITSIRLNEDDYLKLKELKDEYGISWTKLIAYINKILEQEIKDAKEK
Ga0214090_10772002Ga0214090_107720021F004815PSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNAGHSVILLVGN
Ga0214090_10774076Ga0214090_107740761F038012MIIEFQPPCCVQGRQPPDQAAQSHMQPGLECLQGWG
Ga0214090_10774877Ga0214090_107748772F002471VDINACSEHLVSISKLNDELASLNAQLKTSKSEFKKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKTPIPTKEKGKAPMATKKNHAFLYHDRRYSRNAFKGHDVFGSHAYDSYAMTASSSHVMPGRNVLRRNVVHQMPRRNVVRKVVNEPSTIYCALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKDICANLVGPNMSWVPKSQA
Ga0214090_10778794Ga0214090_107787941F004815MHVLDVALCSLVWCLLTLHTAGGWNSMIIVVLFNPGHSMIL
Ga0214090_10792633Ga0214090_107926332F053764MVNTDIRMIIFIAAKDAEALSSQQKQDWELTVAQIMNSLFPNSDKLKKVGKTT
Ga0214090_10793602Ga0214090_107936021F051243AGSCMLLFIASELQYSCLENPIVGGAWWAAVNGVAKSQTRLNDFTFTFHFHALEKEMATHSSVLAWRIPGMGEPGGLPSLGLHRVRHD
Ga0214090_10794136Ga0214090_107941361F011632KGGQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIGEGRMVGLGDPVGLFQP
Ga0214090_10795050Ga0214090_107950501F099086VSCPSSDPTEVSPGARPNGDDEIKKMAEAIMDEVVDRLLNEAAEVVLRED
Ga0214090_10795050Ga0214090_107950502F009131NKSIDCVKKLKASFAKVGAFSSEENFMRGNPEGPIEWIAHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDARDPSVEASMIGGKFFTDIWDNGGREMAREIIQRSEKGIHDAREVAEAAEKSAEPEGQLGIN
Ga0214090_10798445Ga0214090_107984451F038489MAWVEKDHNDHLISTPCYVQGCRQSDQAAQNHIQPGLECLQ
Ga0214090_10803852Ga0214090_108038521F020289MVGWHHLLNEHEFEQALGDGEGQGSLACCSPRGLKESDMTERQNNKVGASMATAD
Ga0214090_10808734Ga0214090_108087341F072954QENMKRQFDKRTKAANFKVGDKVLRWDSRREDKGKHGKFDSLWQGPFIIQATVGPNAFFLQELDGTELFGGPVNGRMLKDYLC
Ga0214090_10810325Ga0214090_108103251F005658MAWVGKAHSAHLVSTPCYVQGHQPAAQAAQSHIQPGTECLQGWASTASL
Ga0214090_10821493Ga0214090_108214931F020862EAEVEKSSNLQKSLKELQDRCLEFSNRCVQRLKQVFNSVGASSEKFSPSVEDLPGTFEHIEGEVDALDEVIARHSDFYALLASRGTAVAFMKTVCTHGKIVNRPNFSLSPADLIDIPSLARSIGNRFITQIWTKGGRSLAGDEARSHLKPVINSYMLLTFSLGLEF
Ga0214090_10821836Ga0214090_108218362F011632ALEWAAQRGGGVTEPGGVQRAFACCVEGHELAGTIGEGQMVGLDDPVGLFQP
Ga0214090_10823455Ga0214090_108234552F001813AQEGGEVTDPGGVQGTFGHCVEGCDLVRTTGDGWMVGLGDPVGLFQPW
Ga0214090_10835592Ga0214090_108355923F011632GQALEWAAQRGGGVTEPGGVQRAFGRCVEGHGLARTIDVGQMVGQDDPVGLFQP
Ga0214090_10837980Ga0214090_108379803F096316MAWVAKDHNAPPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGTHSLLG
Ga0214090_10845895Ga0214090_108458952F001813RGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_10848368Ga0214090_108483681F065281MAKKSIVTSIRLNEDDYLKLKALKEEYGISWTKLVAYINEILEQDMKEKKEK
Ga0214090_10855134Ga0214090_108551341F006329MELELHVADVIDDRKMKIDAMLLKMDAMRLKMDEMRLKIRNIRKYAIDKEAWYHYAVGSIVTLIAILIAFVVAFKCFT
Ga0214090_10858014Ga0214090_108580142F001813GGVQGTFGHCVEGHGLVRTIDDGRMVGLDDPVGLFQPLWFYDSISC
Ga0214090_10858060Ga0214090_108580601F093243MLLSYIPMEDQDADILTKALTRSKFEYHRGRIGVVDNPYLVEREC
Ga0214090_10859748Ga0214090_108597482F014346VVLEKTLESPLDCKEIQPVHPEGNQSSIFIGRTDAEAETPILWPPDVKN
Ga0214090_10859794Ga0214090_108597941F007409MSEDKKTAAEMKLSLDEEKNLGFLIAMSKTNTEKITKEILEGLSEDTGDSDSYDVDSGGEDSEDRPWRPSHSVYGKSTIKENHLVNMRGRYFRDLSIVRADEGE
Ga0214090_10864010Ga0214090_108640101F104139LYCLPLNELWEGVDPGFTPSSHSDALQAPELLWIGPAFPPNVHSLFQALT
Ga0214090_10864520Ga0214090_108645201F001813AQGGGGVTAPGGVQGTFGHYVEGHGVERTIGDGWMVELGHPVALFQPW
Ga0214090_10864549Ga0214090_108645491F096316MAWVEKDHSDHXFPTPCYVQGRQPADQAAQSHIQPGLECLQGWGIHS
Ga0214090_10875204Ga0214090_108752041F093243MLSYVPTEDQDADILTKALTRSKFEFHRGRIGVADNPYLAEREC
Ga0214090_10877415Ga0214090_108774152F068298GGQALEWAVQRGGGVTDPGGVQGALGCHVERHVLMRTIGDG
Ga0214090_10885569Ga0214090_108855692F001813GVTEPGGVQRAFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0214090_10889862Ga0214090_108898621F104139HSQPLNEVWEGVEPGSTSCGHSGALHAAELLRVGPAFPPGAQSLLQAMT
Ga0214090_10910679Ga0214090_109106791F093243MEDQDENILMKVLTRRKLEYHRGRIRVADNPFIVEREC
Ga0214090_10927338Ga0214090_109273382F001813GGGVTDPGGVQRAFGCCVEGRGLVRSIGEGRMVGVDAPVGLFQP
Ga0214090_10934956Ga0214090_109349561F096316MAWVEKDHSAHPVSTPCYVQGCQPADQAAQSHIKPGLECLQGWGIHSLLGQPVQCVTTLWVKNFLLI
Ga0214090_10937350Ga0214090_109373502F052316MVKTRYPKADPNHMAEVGPVGPDRKEIPVSLMYGQVELATKYSQQDCKLDSLLDGIEE
Ga0214090_10948343Ga0214090_109483431F063479MSERNWAETHWIARSTRGGGRPKSGEVDLGPPVKSGRVRGLGELHGLLAELAEALACPEDGWRGLATVVEALAAMAGGNELAGAKGKWLAGEGECGAKWGAPGRAL
Ga0214090_10950367Ga0214090_109503672F001813GGVQGTFGHCVEGHGLVRTVGDGWMAGLDDPVGLFQPW
Ga0214090_10951709Ga0214090_109517093F057793MAKKSVTPSIRMDEEVYQKLKALKEERRISWNELIKHTNELLSEEMEKSGK
Ga0214090_10956886Ga0214090_109568861F035108LKKSSVRKSANRGLSLGMLTGRPIEEMPGSTGDLLPELLQLHERVRQVMKGVAQALWPSVSLPEGLGELAERLQGAWWRFRLWKILACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQ
Ga0214090_10958217Ga0214090_109582171F001813GGVTEPGGVQRAFGCCVEGHGLARTIGDGQKVGLDDPVGLFQP
Ga0214090_10959067Ga0214090_109590671F035626MASSIINNDAVQGETFLPGKIFVFGGFALRANSLGHLEQIESYAPGLQVRFGSLNFTADIPGDLILDGFEPQPSVPHCHDKHDLALRPDSALEAALEPAPIFNS
Ga0214090_10976911Ga0214090_109769111F002002MDFPVAQMVKNLPAMQETWVRSLGQEDPLEKKIATPSSILAWKIPWMEEPGGLQSMASQRVGHN
Ga0214090_10979799Ga0214090_109797991F002994TAIHEKDDLLDSQEDFLIKENKNHVKVKNAYALEVEKCKKLSSELSTCHETIDNLRNENASLSAKVDSNMCDVSIPNLRNVNDHLLAKIEELNISLASLRIENEKLLAKAKDFDDCNAAISDLRTKNDILHAKVVELKSCKPSTSTVEHTSICTRCRDINVDAIHDHLALIK
Ga0214090_10997682Ga0214090_109976821F052316MVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYDQVELAAKYSQQDCRLDSLLDGIEEEFSQSK
Ga0214090_10999154Ga0214090_109991541F033854MAAEGQSDRMVYDMEVRMKQRCVTEFLHARRTVPTDIHXCLLHAYGDQTVDESTVR
Ga0214090_10999433Ga0214090_109994331F028669MYTWNEIKKQRFKCWSGQFITNVSKGDEERGGRTLLRVRVKREGRKVIAKNRKEARIV
Ga0214090_11004292Ga0214090_110042921F004001VQSPSLEVFKKHVALRDVVSGHGGDGLVVGPVDFSGLFQHSDST
Ga0214090_11004806Ga0214090_110048062F001813QRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGQMVGLDDPVGLFQP
Ga0214090_11004864Ga0214090_110048641F035108LTGRLEEEMPGSVGDLLPELSQLHEQVRQVMRGVSQALWPSVSLPESLGELVEKLKGARRCFRLWKISACRQGAREAWAMVKTWYTKAGPNHIAEIGPVGPDGKEIPVSLVYGQVELAAKYSQQDCRLDRLLDGIEEEFSQSA
Ga0214090_11015245Ga0214090_110152451F034461MYKKSNQIVVADALSRKDEDVEAFLCAISIIQLDWISKAWEEWKNDKELWTLIQKLQQDPSTSDTFS
Ga0214090_11016152Ga0214090_110161521F020828YAEAGHPVPLSDQLKQLVKLHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVIKHSACIEGARRALAHAKVQWGKMDAEKLVTDAPPPGKEYRTLEMYYKSVLKGARKIADECPKDVIF
Ga0214090_11021230Ga0214090_110212301F105149MLRRMYQGGSSVKKGPRIAIREQDVELPRDADVRACEWPSDDFTVEAGFKEEFDVYVHNAELEHFLQDKCPQYYQLTDSFVWRFKYNCTRNSPSVLFDIYDTSYTMDLEDFTPACKLLQWGNINDPHKSEFRDFLASI
Ga0214090_11021638Ga0214090_110216381F094706SHGGFEFLKGNFEGLKGYVTGRMTKSRRGKIYIDDAGWGPEAGSVEYGYRVPFGGIHVFIGKIGEPGPEMDICIDLVETAQSARSARVKPAMKRAFVGVIHGGSYEDGSESHGDTVVCSDDESSTGETESLYQLQDGRIGGCSDGDSIPDPSDLPNRVGIFMDGTQAAIHSSTAAAMFSGSAA
Ga0214090_11036978Ga0214090_110369781F046965LLAKIDELNASLASLRIENENLIAKAKVFDVTISNLRSENDILHAKVVELKSCKPSTSTVEHTSICTRCRDIDINAIHDHMALIKQQNDHIAKLDAKIAEHEHENEKFKFARSMLYSGRRPGIKDGIGFQQGDNVKLNAPPKKLSNFVKGKAPMVQNNEGYILYRANYPEYKIRKIHARKPHTVSHHA
Ga0214090_11039550Ga0214090_110395502F004815APSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSIVVLFNPGRSMIL
Ga0214090_11039748Ga0214090_110397481F027437MTRQITVLEEKHSQDQAKMARRCADFEEKYSQSQIELSQVSAALDDANALSSSLHVQLNSEKVAYEPALRLIMLL
Ga0214090_11039748Ga0214090_110397482F096761MFIRSSYQALVDGMVGQLKSQGASIPEVASSLECWNPVLLRGRVSELEAANAG
Ga0214090_11039748Ga0214090_110397483F062643VAQTLDQGVALEGSIPTGLALGSVECTELVPAGLLQAASSGGLAPGRQLISPDLGIPSLFSNLQVLCCALV
Ga0214090_11052566Ga0214090_110525663F068986MPPILCWPMTPEVDEGGMAVEVETSRQYSVTFCCCKTDGSRG
Ga0214090_11059902Ga0214090_110599021F096316MAWVEMDHDDHSVPTPCYEQGLQPPDLAAQSHMQPGLECLQGWGIHSLLGQPVQCVTTL
Ga0214090_11065089Ga0214090_110650893F015450LEKKNFELQATEGLLAEAEAKITELNTKLLRQSEQFEREKQDLNAKLEAEAQQNSDLRKLLTSLQEKCLEFSNKCIQRLRKIFHSVGASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDKARSHLEPVRNHTLCIPLPASSILTYNNLIHVG
Ga0214090_11074914Ga0214090_110749141F005658MEDSIESQHHRMAWVEKAHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGI
Ga0214090_11090557Ga0214090_110905571F004001VVGSPSLEVFKNHGDVALRDMVSGHGGGGLMIGLEDLSGLFQP
Ga0214090_11106868Ga0214090_111068681F002471SSAKKNHAFMYHDRRQTRKAYRSYNDDFDSHAMFASSSSYVHDRNVGRKNVVHNMPRKNIHHVSRKNVVHVPRKVMNGPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKTIVTNLVGPNKSWVPKTQA
Ga0214090_11114065Ga0214090_111140651F038012MIIEFQPPCYVQGCQPPDQATQSHIQPGLECLQGWGIH
Ga0214090_11115235Ga0214090_111152352F005658MAWVEKDHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGI
Ga0214090_11118270Ga0214090_111182701F038084VVWYSHLFKNFLQFVVIHTVKGFGVVNKAEVDAFLELSCFFNDPVDVGNLVSGSSAFSKTILNIRKFMVHVVLKPGLENFEHYFTRV
Ga0214090_11118774Ga0214090_111187742F004815MEAVDAPSLQAFKAWLDVALGSLGCWLATLHIAAGWNWMSTVVLFNPGHSMIL
Ga0214090_11122866Ga0214090_111228663F028669MYARPEIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0214090_11124705Ga0214090_111247052F001813GVTDPGGVQGTFGCCVKGHGSVRTDGDGWMVGLGDPVGLFQPW
Ga0214090_11131241Ga0214090_111312411F002471LVSISKLNEELASLNAQLKTSKNEFDKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKASISAKEKGKAPMANSVQKNHAFMYHDRIQSRNAYRRCNAYDTFDSHDMFASSSSYVHDRNVSRRNGVNVPRKVMNEPSTIYHALNASFAICRKDRKIVARKLGARCKGDKTCIWVPKDICANLVGPNMSWVPKTQA
Ga0214090_11131906Ga0214090_111319061F001813AQGGGGVTDPGSVQGTFGCCAKGYGLVTTIGDGWMVGPGDLVGLFQPW
Ga0214090_11135092Ga0214090_111350922F005658MAWVDMDYNDYLVATPCYVQGHQPPDQAAQSHIQPGLECLQGWGIH
Ga0214090_11135839Ga0214090_111358392F001813VLEWAAQGGGGVTTPGGVQGMFGRCVAGRGLMRTIGDGWMVGLADLVAHFQPW
Ga0214090_11140618Ga0214090_111406181F005658MAWVEKDHNDRQVPTPCCVQGRQPADQAAQSHIQPGPECLQGWG
Ga0214090_11146456Ga0214090_111464562F004815VDAPSLQAFKARLDVTLGSLGCWLVTLNTAGGWKEMITVRFNPGHSMVL
Ga0214090_11158701Ga0214090_111587011F006329MILELHVADVVNDRKIKMDAMRLKIRKIRKYVIHTKAWYNYVVGSIGTLVAVMIAFVFALKCFT
Ga0214090_11159736Ga0214090_111597361F001813MRPNQHSTFVQGTFGRCVEGHGLMRTVGDGWMVGLGDLVGLFQPW
Ga0214090_11162243Ga0214090_111622431F011632LEWAAQRGGGVTEPGGVQRAFGSCVEGHDLVRTIGEGRMVGLDDPVGLFQP
Ga0214090_11170613Ga0214090_111706132F001813GVQRAFGCCVEGRGLVRTVGEGRMVGLDGPVGLCQP
Ga0214090_11178376Ga0214090_111783761F001813NPGGVQRTFGCCVEEHGLVRTIGDGRMVGLDDPVGLFQS
Ga0214090_11180438Ga0214090_111804382F005658MAWEKDHNAHPVPTPCYVQGRQLPDQAAQSHIQPGLECLQGWS
Ga0214090_11196057Ga0214090_111960571F038489MAWVEKDHNAHLVSTPCYVQGRQPADQAAQSHIQPGLECLQGWG
Ga0214090_11198773Ga0214090_111987732F075851MQRSGLLTTEEMPAAEAGPTTVEGEEDIEGTDSEDDYHLATPSKPSHLDFGKSTVSKADLSKMVKAGYFKEDQKKLLRFGEEETTPKPRKDEIVIFKSFLKAGLRF
Ga0214090_11205830Ga0214090_112058301F011632MAAQRGGGVTESGGVQRVFGCCVEGHGLAGTIGEGQMVGLDDPVGLFQP
Ga0214090_11207008Ga0214090_112070081F014346VVLEKTLEGPLDSKEIQPVHSKGNQPWVFFGRTDVEAETPILWPPDVKS
Ga0214090_11210674Ga0214090_112106741F076748MRFNKLPGDSPLLYVSKSSFSQSDSSWFDWNDEEAVLFPNWETGIT
Ga0214090_11213089Ga0214090_112130891F035108EMSQLYERARQAMRSVAKALWPSASPPGILEELVKLFQGAWRRFRLWKISACRQGAREAWAMVKTRYPKADPNHMAEVGPAGPDGKEIPVSLMYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSV
Ga0214090_11220602Ga0214090_112206021F001813RGGGVTEPGGVQRAFGCCVEGHGLAGTIGEGRMVGLDDAVGLFQP
Ga0214090_11222225Ga0214090_112222251F004815FKARLDVALGSLVWWLVTLHIAGGWNWMSIVVLCNPGHSVIP
Ga0214090_11226709Ga0214090_112267091F002002MVKNPPAMQEIQIRSLGWLQSLDCEDPLEKGVATHSSILAWRIPWTEEPGRLQSKGSQRVGHN
Ga0214090_11228107Ga0214090_112281071F004815SLEAFKARLDVALGSLVCWLATLHIAEGWNWMIIVVLFNPDHPMIS
Ga0214090_11231484Ga0214090_112314841F062313MTEDKMVGWHHRLNGHEFGWTPGVGDGQRGLVYCGTWGHKKSNTIEQLN
Ga0214090_11233291Ga0214090_112332911F005658MAWVEKDHNDHPVSTPCYVQGHQPADQAAQSHIQPGLECLQGWGI
Ga0214090_11245208Ga0214090_112452081F004815MQAFKARLDVAVGSLVCWLVTLHTAGGWNWMSNVVLFNPGHSRIL
Ga0214090_11245575Ga0214090_112455751F004815VDAPSLQAFQARLDVALGSLGCWLATLHRVGGWNWMSIVVLFNPGH
Ga0214090_11249157Ga0214090_112491572F039980MMFEGVDSCLQEEKRALVASRDNLDRLYRDSSNSLTILERSHRFTMEELDNHRCKLQESTDEVIRLRQLISAKYASIKELRASKKSIAQELETAQLAAKVAEETSITLRAQRDRAMDKAIRAGRILMRRPGVVVPEDIRADV
Ga0214090_11249346Ga0214090_112493462F013401MAKDGKKKVKSRASTKYATSSDEENSSDDEDNLFALFANLNMQQKEKLNELIGAIHEKDELLDSQEDFLIKENKKHVKVKNVYGQEVKKCEKVTSELSTCHDTISNLRNENAKLIAKVDSNVSDVSIPNLRDANVSLLAKIEKLNASLSSLKFENDKLIAKAKELDVCNASISNLINENAILHAKIV
Ga0214090_11253632Ga0214090_112536321F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSRIL
Ga0214090_11269586Ga0214090_112695862F001813KSGEALEWAAKGAGGVTYPGGVQGTFGHCVEGHGLLRTIDDGWMVGLGDPVGLFQP
Ga0214090_11276351Ga0214090_112763511F096316MAWVAKDHSAHPVPTPCYVQVAQPAAQAAQSHIQPGLECLQGWGTHSLLGQ
Ga0214090_11278082Ga0214090_112780821F005658MAWVAKDHNSHPVPTPCYVQGHQPADQAAQSHIQPGLECLQG
Ga0214090_11290452Ga0214090_112904521F005658MAWVEKDHNDHPVPTPCYVQGRQPPAQAAQSHIQPGLE
Ga0214090_11290583Ga0214090_112905831F104139NEVWEGVDPGSSPSGHSAALHTPELPWVGPAFPPGASSLLQAIT
Ga0214090_11292509Ga0214090_112925091F001813GVVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_11297583Ga0214090_112975831F076912LEKSTPLCNGKGSNADQVQDSETSLLFSKKADKNYIEDTETTPKSCLDVVFELLATTAGTSSSNSLPESVRLLESQHQVERHRSDDIRQGAEGLRKSLQNSDAYFLVQQQVLEDLSAKQHKVNKLAKHLASIMGSQDI
Ga0214090_11309457Ga0214090_113094571F005658MAWVEKDHNAHPVPTPCYVQGHQPADQAAQSHIQPGL
Ga0214090_11309776Ga0214090_113097761F004815LEAFKARLDVALGSLVCWLVTLHIAGGWNQMITVVLFDPGHSMIL
Ga0214090_11314817Ga0214090_113148171F004001QSPSLEVFQSRVDVALRTWAVGSIGGSRMVGLDDFRGLFQP
Ga0214090_11318452Ga0214090_113184521F012765DDVICLKQSISAKDAVTKELRASKKSLTQELQTAQLAVKVAEETSATLRAQRDRAMDKAICVGRILMRRPGVIVPDDIRADVNAAPDSSSRPSSSVAPEKDIAK
Ga0214090_11318609Ga0214090_113186091F005658MAGVEKDHDDHLTIEIQPPCYVQGRQPQDQAAQSHIQPGLECLQ
Ga0214090_11322516Ga0214090_113225162F028669MYARSEIKKQRFKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRRAIEKIERGK
Ga0214090_11328866Ga0214090_113288662F079404VPRSREGSIYQVGGAEVCRIAGTGYLSGTPKKASEDWPSEWFYIDDVPLPDPIRVGLPEFNSAPLKKRLSWRPRSSQRESDRDVLYLMGRIRLLAHSGLTMIGVMAACIMRGAQSLQYRGHPMWDFNGEDDATRYGRKGPASAAALVKILSSLYKGEEEEFLRVNPQGGFSMYNPLSWVSGQLCLRIRFIFP
Ga0214090_11330794Ga0214090_113307943F028669MYARREIKKQRFKCWSDQFIINVNKGDGERGGRTLLRIGVMGKGRRAIEMIERGKNCVKR
Ga0214090_11332742Ga0214090_113327421F034384EFCQNFEEETGRLEVNMYPINSPVKDEVAMNVLRLESRIAAVVDYLARLKVATSRINTTLWPRETLQNNLESLMTRLNEVPSRVQEWKKSSARCGADVAPSLVRVHCKEAREDKLVALRVANTKKHNFRSFMETFIAAATRIADRIDLDQFVAPSSPPPEE
Ga0214090_11338345Ga0214090_113383451F005658MAWVEKDNNAHPVPTPCYVQGRQPADQAAQSHIQPGLE
Ga0214090_11339307Ga0214090_113393071F027342QEIQVAKKIAAGKTFFMQSKHVEDTFLLLTRIRSSPGAFVDLPHRVSDAVEFYRAEEGSSTEKLFWSQYAGAEHPVPLSDQLKQLVELHRAAEVAMKDFIVRMWPGEPLPASYFGLIKRMVNACLRLEVIKRSFCIEGAHRAFARAKVHWGKLDAEKRVKDGPPEGKEHHYPEKYYDGVMKGARLVADECTKDTIFE
Ga0214090_11352927Ga0214090_113529271F096316MMWVAKEHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGFHSLLGQPVQCVTTLWGKTSSSSPT
Ga0214090_11353962Ga0214090_113539621F052316MVKTRNTKADPNHMAEGGPMGPDGKEIPVSLVYGQVELATKYSQQGCRLDSLLDGIEEEFSQSK
Ga0214090_11355769Ga0214090_113557691F015450EREKQDLNAKLEAEAQQNSDLRKLLTNLQEKCLEFSNKCIQRLRKIFHSVGASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLNPVRNHTLCLPFL
Ga0214090_11356780Ga0214090_113567801F027437LFDCLLLDMTRQISTLEEKHSRDQAELVQRCTDFEEKYSQSQTELGQVSAALDDANALSSSVHTQLNSEKVTYETVLCLVVLLLLA
Ga0214090_11362671Ga0214090_113626711F038012MLIPFQPLLCDGRQPAAQAAQSHIQPGLECLQGWGIHSL
Ga0214090_11368347Ga0214090_113683471F001813GGVTEPGGVQRAFGCCVEGHGLARTIVEGRMVGLDDPVGLFQP
Ga0214090_11377047Ga0214090_113770471F034384MFGKYFQLWLLPFDYSLDLVITLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDVLRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0214090_11385377Ga0214090_113853773F010678GKKLSEEEVFEANHYAKELKYSKGALVFNGTNEEDFLYCLPDNKELSVCREMARSMGIPKLEAGLCAMTKDDLADSLAYNSLKVWELDVCKFYNL
Ga0214090_11386480Ga0214090_113864802F004001VVESPSLEVFKNHEDVVLRDVASGHGGSGLVVGLADLGGLFQPE
Ga0214090_11391508Ga0214090_113915081F038489MAWAEKDHNDHPVSTPCYVQGRQPPDQAAQSHIQPGL
Ga0214090_11392658Ga0214090_113926581F038012MIIQFQPPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHS
Ga0214090_11400455Ga0214090_114004552F065281MAKKSITTTFRFDEDDFLKFKELKEKSGMSWTKLVAHINVILEKEIKGTKEK
Ga0214090_11410133Ga0214090_114101333F005658MAGVEKDHNAHPVPTPCYVQGHQPPDQAAQSHIQPGLE
Ga0214090_11412093Ga0214090_114120931F004815LPKEAVDAPSLEVFKARLDVALGSLVWWFVILHIAEGWNWMSIVVLFNPGHS
Ga0214090_11417069Ga0214090_114170691F038012MITEFQSPYVQGCQPLDQAAQSHIQPGPECLQGWGIYN
Ga0214090_11418410Ga0214090_114184101F005658MAWVEKDNNFHLIPTPCYVQGRQPAAQAAQSHIQPGLECLQ
Ga0214090_11419185Ga0214090_114191851F005658MAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQ
Ga0214090_11419218Ga0214090_114192181F035626MAPSIIGNDAIQGEVFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFERFEPLPCASRGHDEYDLALPSDNVQEIAPAAAPTLNSVPVVPSMDGWMDPVAEALPSSVIEP
Ga0214090_11419455Ga0214090_114194553F004815KARLDVALGSLVCWLVTLHIAGGWNSMSIVVLFNPGHSMVL
Ga0214090_11423898Ga0214090_114238982F004815QAFKARLDVALGSLVCWLVTLHTAGGWNEMNIVVFCNPGHSMI
Ga0214090_11432853Ga0214090_114328531F081962LNQSMLTKLKVVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAWLPELDPADIALGYPTLKEDGTPFDQKDFAACVKDVRPVATLIGNDTDLSKYQPGYDADNHRIPTPHYEAISLIPPPRKHSFAPEVDPAGLIDDEAEFEALSGIDWKSSTFQDRETDGGAER
Ga0214090_11433116Ga0214090_114331161F020492MGMQAVLLTSAALTVEVNALKESLERSESELGRAKKQLEDKEGK
Ga0214090_11437623Ga0214090_114376231F018877EASVVGGKFFTDIWNDGGRGMAREIIERSEKGIHDARRVADAAERSREPEGQLGTN
Ga0214090_11438258Ga0214090_114382581F033854MAAQGQSDKMPSNMEVQMKQRCVLKFLHVEKKSDIHXLLLNIAGNQTVDVST
Ga0214090_11444577Ga0214090_114445771F011632DVRKHYFSERGGQALEWAAQRGGGVTEPGGVQGMFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_11448754Ga0214090_114487541F002994LSTCHEMIDNLRNENASLNAKVDSHVCDISIPNLRNNNDDLLAKIDKLNESISCLKIENDKLISKAKDLNVCNVSISNLRNENEMLHAKIDELNVCKPSTSTVNHVTICTRCRDVNIDVINDHLALIKQQNDHIAKLDAKIAEHDLENEKFKFARSMLYSGRHPGIKDGIGFQQGGNFKLNAPKKLSNFVKGKAPMAQDNEGYILYPAGYP
Ga0214090_11450593Ga0214090_114505931F001813QRGGAVTDPGVVQRTFGRSVEGHVLVRTIGGGWMVGLGDPVSLFCATIC
Ga0214090_11451928Ga0214090_114519281F002002MVKNLPAVQETQVQSLGWEDPPEKGMATHSSVLAWRIPGTGEPGRLPSMGSQRVGHD
Ga0214090_11459080Ga0214090_114590804F028669MYARRKIKKLRFKCWSDQFFTNVIKADEERGGRTLLWIGVMGKGRQVIGNRSKESL
Ga0214090_11469041Ga0214090_114690411F028669MYARREIKKQRFKRLSDQSITNVNKGNEERGGRTLLRIGVMGKGRRAIEKIERGKN
Ga0214090_11478809Ga0214090_114788091F038985MIKIATNFIPKKHRLGPQNGSGSSGPEKLLKIVSYAKTEKLKETMVGAQVE
Ga0214090_11486824Ga0214090_114868241F038012MITQFQPPCYAQGRQPADQAAQSHIQPGPECLQGWGIHNLL
Ga0214090_11488486Ga0214090_114884862F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVRFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANQLAKLIASMVDTQDNVS
Ga0214090_11492371Ga0214090_114923712F005658MAXVEKDHSEHPVPTPCYVQGHQPADQAAQSHIQPGLECLQG
Ga0214090_11494088Ga0214090_114940881F004815SLQAFKARLDVALGSLVCWLATLHIAGGWNWMSTVLLSNPGHSLIL
Ga0214090_11495507Ga0214090_114955071F002471MATSAKRNHAFLYHDRRQTRNVSHDAFDSYVYDSHAMFAPSSSYVYDRNVTRRNVVPKRNAIHHVPRRNVIHAPRKVVNEPSTIYYALNASFAICRKDKKIVARKLGAKCKGDKTCIWVPKDICTNLVGPNMSWVPKTQA
Ga0214090_11495697Ga0214090_114956971F052316HMAEVRLVGSNGKEIPISLVYDQVKLAAKYSQQDCRLDNLLDGIEEEFSQSK
Ga0214090_11500077Ga0214090_115000772F004815SLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSRIL
Ga0214090_11500794Ga0214090_115007941F001813GGGVTDPGGVQGMFGCCDEGHDLVRAIGGWWLFVMGDPVGLFQPW
Ga0214090_11503488Ga0214090_115034881F013401SSSDEDTATIAVTKGLLFPNVGHKCLMAKDGKRKKVKSKSSTRYESSSDDNASDEEDNLRILFANLNMEQKEKLNELISAIHEKDDLLDSQEDFLIKENKKHVKVKNAYALEVEKCQKLSSELSTCREMIDNLRNENAILNAKVDSHVCSVSIPNLRDDNVDLLAKIDELNASLAS
Ga0214090_11506795Ga0214090_115067951F002994VKNAYALEVEKYEKLSSELSTCHDVISILRNENAKLIAKVEKSNVCYGSIDNLRNDNASSIAKIEKLNASLASLKNENEKLIAKAKELNICNVSMSNLRDENAILHAKIVELNSCKPSTSTVEHVTICTRCRDINIDAIHDHMALIKQQNDHIAQLNAKINEHDLENEKFKFARNMLYSGRHPGIKDGIGFQQGDNVKLNAPKK
Ga0214090_11510421Ga0214090_115104211F001813LTDPGGVQRAFGCCVEGHGLMRTIGEGRMVGLGDPVGLFQP
Ga0214090_11512007Ga0214090_115120071F033854EGHSDTMASDMEVWMKQRGVTEFCPVEKVAPMDIHQRLLNVYGDQAVDAAQ
Ga0214090_11528266Ga0214090_115282661F006329ENDLLKEKIKKIEEEKMILELHVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYAVGSVVTLVTIMIAFVVALKCFT
Ga0214090_11529596Ga0214090_115295961F004815DVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSRIP
Ga0214090_11537759Ga0214090_115377591F001813GGVTDPGGFQGTFGHCVERHGLVRSIGDGWMVGLSDPVGFFQPW
Ga0214090_11542755Ga0214090_115427552F004001VTQLPREVAESPSLEVFKNHVDVALRDAGSGHGGGELMVGLGDLRGLLQP
Ga0214090_11551876Ga0214090_115518761F028765GLAATAFNKSSLFPNEHHTCLMAREKKVSARNTSTYASSSEDESSDDDEIDYSCLFKGLDRTKVDKINELIDALNDKNRLLEKQEDLLYDEHDKFVEAQKSLALEIKRNEMLSCELSTCHDSISSFKSINDDLYAKLEIANKSTSCVEHVVVCTRCKDFDIDACSDHLVSISKLNDDLASLNAHLKTSKSNFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMATSAKKNHAFLYHDRKNSRNAFRSYDAFDSHAYDSYAMTASSSHVVHDRKVGRRNVIHNMPRRNVVNALKKAHGP
Ga0214090_11552854Ga0214090_115528542F011632AQRGGGVTDPGGVQGLFGCCAEGHGLARTIGDEWMVGVGAPVGLFQPC
Ga0214090_11559443Ga0214090_115594431F002002VAQTVKNLAAMQETWVPSLGREDPLEKGMATHSSILAWRSTWTEETGGVQSIGSQR
Ga0214090_11568830Ga0214090_115688304F004815KARLDVALGSLVWWLATLHIAGGVEQMIIVVLFNPGHSMIRFSPA
Ga0214090_11570720Ga0214090_115707202F093003MADRPPRGRDREASRPSTQAMPRHRSTKERENALDLRDILEDKARQTRSIYGSRRRPTACDNDLHSGYNKSGRAECNRHSSSELRRDIAQYRGAAHPLCFMNEVMDHKIPEGFKPVNIESYDGTTDPVVWIEDFLLHIHMARGDDLHAIKYLPLKLIGPARHWLNSLPENSIGSWEDLEE
Ga0214090_11572996Ga0214090_115729961F004001VVESLSLEVFKNHGDVALRNMVSGDELTVRLDDLSGLFQ
Ga0214090_11580530Ga0214090_115805301F005658MAWVENNHDDHLVSTPCYVQGHQPADQAAQSHIQPGLECLQGWGIHNLLG
Ga0214090_11585739Ga0214090_115857392F004001MKSPSLEVFKKCVDVSLKDTVSGHGGDGLMIGTDDLRGLFQP
Ga0214090_11587557Ga0214090_115875571F096316MAWVEKDHRAHPVPTPCYVQDGQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWGKNFLISNL
Ga0214090_11601814Ga0214090_116018142F020492LQAALLTSAALTAEVGALKQELEQSEQELGRAKKQLQDKEGE
Ga0214090_11602452Ga0214090_116024521F072954EAIFPSYLGVPVMKLLQEARVEPNDIQRRINHTINLQQTREEVYQRSQVLQEKLKKIFDKRTKAEEFQLGNKVLRWDSRREDKGKHGKFDFLWKGPYIIHALQGNNTYFLKNLDGTKTEEGPVNGQMLKHYFDPIY
Ga0214090_11603023Ga0214090_116030231F004815AFKARLDGALGSLGCWLVTLHIAGGWNWMGIVVLFNPGHSVIL
Ga0214090_11604209Ga0214090_116042093F096316MAWVEKDLNAHPVPTPCCVQGHQPAAQAAQSHIQPGLECLQGWGIHSLLG
Ga0214090_11605416Ga0214090_116054161F104139ARGPHLHCQPLNGVGEGVDSGSTPSGHLAAWHAPELPWVGPAFLPGVQSPFQAVT
Ga0214090_11605824Ga0214090_116058242F020492MRMQASLLASAALTAEVDTLKQNLERSEQELGRAKKQLEDNEGKKYLV
Ga0214090_11612431Ga0214090_116124311F005658MAWVEKDHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLKGWGIHSLL
Ga0214090_11622948Ga0214090_116229481F028669MYARREIKKRLKCWSDQFITNVNKGDEERGGRTLLRIGVMGKGRQAIEKIERSKNCIKQGESPPGSGSS
Ga0214090_11623589Ga0214090_116235891F021064GLNCKPLDLPKSTIGKAKIIKIALNIAITPNSLLGIDLSIA
Ga0214090_11628309Ga0214090_116283091F046965VSNSNPKDDNVDLLARIDELNVSLAILRIENEKLLAKAKDFDVCKVTIADLRDKNDILRAKIVELNPCKPSTSTIEHVTICTRCRDIDVNAIHDHMSLIKQQNDHIAKLDAKIAEHNLENEKFKFARSMLYNGRRPGIKDGIGFQRGDNVKLNAPPKNLSNFVKGKAPMPQDNEGYILYPAGYPESKIRRIHSRKSHSAPNHASMYKGETSSSRQPT
Ga0214090_11638103Ga0214090_116381031F052316MVKTRYTGLDLNHMARVGPRGPDGKEIPVNLVCYPVRIAAKYSQEDCRLDGLIDEIDKG
Ga0214090_11644910Ga0214090_116449101F038084VVNTVKGFGIVNKAEVDVFLEHFCFFDDPTIGILISGSSAFSKISLNIRKLTVHVLLKPGVENFEHYFTG
Ga0214090_11645164Ga0214090_116451641F055526VPVTEFTDVDPNGCTQSAADPNVVAPSVVDPNGCATCVANVDDEEEEDEAPLTRKNSRQFIASGGSSGVPSPALSASIGLQELSLANFDQTLEDMVPEDLLSEPVDDGAMEVCADVPYAGLRSSRASSTLERDLEGRETDLDRPGPIEVTEGPSALEVATAENLDPKDGVDTCPAPKDVAGDDLVRVGSVSHCPAPEGARAGSPSCTSMDVHAGSPPHSGCMVVAQTLDQGV
Ga0214090_11645784Ga0214090_116457841F004815RLDVSLGSLGCWLATLHIAGDWNEMSTVGLFNPGLSVMLW
Ga0214090_11651023Ga0214090_116510231F004815MHILHARLDVALGSLVWWVVTMHIAGGWNWVSTVGLCNPGHSVIV
Ga0214090_11651845Ga0214090_116518451F005658MAWVEKKHNAHPVPTPCCVQGRQPAAQAAQSHIQP
Ga0214090_11653914Ga0214090_116539141F004815RLDVALGSLGCWLATLHIAGGWNWMSIVGLFNPGQSIIL
Ga0214090_11654952Ga0214090_116549521F001813QRGGGVTNTGGVQGMFGRCFEGHGLVRTVGDGWMVGLHDPVGLFQPR
Ga0214090_11656734Ga0214090_116567342F001813VQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0214090_11658117Ga0214090_116581171F011632MGGQALEWAAQRGGGVTDPGGFQRTFGCCVEGHGLARTIGDGWMVGLGDPVGLFQP
Ga0214090_11661166Ga0214090_116611662F034384MNAEFCQNFEEETGRIEPGLDPINSPVKDETAMNLLRLESRIDSVVDYLARLKVAMSRIDPALWPEATHQNDLESLMTRLNGIPERVQEWKKSSAWCGGDVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0214090_11663731Ga0214090_116637311F038489MAWVEKDHRDHVVSTPCYVQGRQPPDQAAQSHIQP
Ga0214090_11669060Ga0214090_116690602F020492MRMQASLLATAALTAEVDALKQGLERSEQELGLAKQQLEEKEGKKFLIRRCL
Ga0214090_11675467Ga0214090_116754671F011632VLEWAAQRGGEVTEPGGVQRAFECCVEGHGLARTIDEGRMVGLDDPVGLFQP
Ga0214090_11676539Ga0214090_116765391F028669MHTRREIKKQWSRCWSNQFITNLNKGDEERGGQTLLQIGVMWKGRWAIEKKEARIV
Ga0214090_11680445Ga0214090_116804451F092835ITHRFAVTKRFPQLLNPKVHLRVGPHHSWFWPIMTCFADYYSPFWGPVTISIVVEPQDVLTCWSTTLAVLADSGPFHGILLTVLGSQSDFHD
Ga0214090_11688170Ga0214090_116881701F068298MLYIYTSQALEWAAHRGGGVTESVGVQRGFGCCVEGHGLAGTIG
Ga0214090_11695062Ga0214090_116950622F028669MYTRREIKKQRSRCWSDQFITNVSKGDGKKGGQTLLWIGVMGKGRKMIEKIENRSKESL
Ga0214090_11695140Ga0214090_116951403F004815ARLDVALGSLGCWLATLHIAGGLNWMSIVLLFNSGHSVTL
Ga0214090_11705860Ga0214090_117058601F033854MAAQGQSDKMASDMEVHMKQRCVIEFLHAEKMSPTDIHQCLLNFYGGQTVAVCTVTQW
Ga0214090_11706923Ga0214090_117069231F004815LQAFKARLDVALGSLGCWLATLHIAGGWNGMSTVLLFNSGHSMVL
Ga0214090_11713485Ga0214090_117134851F002471MANNVQKNHAFLYYDRRYSRNVHHDRSCNDIVSHAYDSNAMFASSSSMMYDRSLARKNVIHHVPRRNAHVPRKTSNEPSTIYHALNASFAICRKDKKVVARKLGAKCKGDKTCIWVPKAICTNLVGPNM
Ga0214090_11718464Ga0214090_117184641F004001MESLFLEVLERHVDVALMDMLSGHGGDGLMVGLDDLSGLFQP
Ga0214090_11730327Ga0214090_117303271F027342ELATALETAKSSKAEAQKALQEFEEMRKIAAGKAFFMQSRNIKVNYLLLTRIRSSSGAFADIPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAEHPVPLSDQLKQLVELHKAAEQALKGFIVRLWPREALPGSYFGLARRLVEACPRLEVIKRSVCIEGAHRALARAKVHWGKLDGEKLVRDGPPPGKEHRKPENYYKDVLAGARLMADECTKDVIFE
Ga0214090_11740357Ga0214090_117403571F005658MAWVEKAHNAHPVPTPCYVQGHQPAAQAAQSHIQPGLECLQ
Ga0214090_11753199Ga0214090_117531993F004815VVVDAPSLEGLKARLDVALGSLVWWLVTLHLGGGWNEMSIVVLFNPGHSTVL
Ga0214090_11760947Ga0214090_117609471F011632LSLGLKCWAAQRGGGVTESGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0214090_11761614Ga0214090_117616141F003406LFRSVWPLVEKWEMPKETVREPDEGGLVRLKYTFKYGDKFVEPDDDWLKSIEAVSDELLGPYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYRYPIRGQKRKGTVSVKEVASAAPSEPTPKRKKVKVLTHRPCYIDPAMVPEFGGEASSDAESRETAPPMQRAEEPATM
Ga0214090_11765082Ga0214090_117650821F005658MAWVEKDHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHS
Ga0214090_11773348Ga0214090_117733481F001813RGGGVTDPGGVQRVFGCCVEGHGLARTIGEGXMVGLDDPVGLFQP
Ga0214090_11773510Ga0214090_117735101F053764KSAKDEEVLYSQQKQDWGLTVAQIMNSLSPNSDLN
Ga0214090_11775511Ga0214090_117755111F098130MPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQYLRGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0214090_11779804Ga0214090_117798042F004815PSLQAFEARLDVALGSLGCWLATLHIAGGWSWVSTVGVCNPGRSVIL
Ga0214090_11783864Ga0214090_117838642F038084VAGKVVLYTYLLKNFPQFVVIHTVKGFSIVSEAKVDVFLELPCFSYDPADVGHLISGSSAFSKTNINNWKFTVHVLFDTWLGEF
Ga0214090_11788462Ga0214090_117884621F011735YIFKRVLAKGAYVLVDYDGIMLAQPINGLYLKRYYA
Ga0214090_11789487Ga0214090_117894871F005658MSWIEKDHSAHPVPTPCYVQGRQPADQAAQSHIQPGLECL
Ga0214090_11792981Ga0214090_117929811F094706VTNPRQLALTVGPAHDGFEFLKGNFEGLKGYAVGQMTKSRHGKLCIEDPGWGPEAGSIEYGYGVPFGGIHVFIGKIGEPGPKLDICTDLVETAQRASPARIQPAMKRAFVGCVHGIGSEPVSEGETVAYSDGESSAGETESMYQVQDGVFEGYSDGTSIPDPCEPPRWAGVFMARTQPGSNSIAAAAITSGIGAAGAG
Ga0214090_11802708Ga0214090_118027083F004001EVFQNHADVALRDVVSGHGGGRLVVGLDDLRGLYQP
Ga0214090_11803828Ga0214090_118038281F027342LLLTQVRSSPGAFADLPRSASNAVAYYRSEEGSSTEKVFWSQYAEAGHLVPLSDQLKQMVELHKVAEQAIKGLIVRLWPGEALPRSYFGLVRRLVDACPWFEVVKRSVCIEGARRALARAKVHWGKMDAEKLVKDGPPPGKEHRVPEAYYEGVLKGARLIADECSKDVIFE
Ga0214090_11813009Ga0214090_118130091F033854MAAEGQSDKMASDMEVRMKQRCGIEFLHAEKIASIDICXHLLNIYGNQTGCEHSHCVCF
Ga0214090_11816103Ga0214090_118161031F038489MALVEKDHNDHLVSTPCYVQGRQPADQAAQSHIQP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.