NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300019090

3300019090: Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-8



Overview

Basic Information
IMG/M Taxon OID3300019090 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129122 | Gp0217198 | Ga0193578
Sample NameMetatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-8
Sequencing StatusPermanent Draft
Sequencing CenterWoods Hole Oceanographic Institution
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size31161026
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta1
All Organisms → cellular organisms → Archaea3
All Organisms → cellular organisms → Eukaryota → Sar1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)mediterranean sea biomemarine benthic featuresea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEastern Mediterranean Sea
CoordinatesLat. (o)36.29Long. (o)15.39Alt. (m)N/ADepth (m)2200
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013050Metagenome / Metatranscriptome275Y
F013096Metagenome / Metatranscriptome274Y
F028684Metagenome / Metatranscriptome190Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0193578_100305All Organisms → cellular organisms → Eukaryota → Opisthokonta3571Open in IMG/M
Ga0193578_112352All Organisms → cellular organisms → Archaea655Open in IMG/M
Ga0193578_117120All Organisms → cellular organisms → Archaea543Open in IMG/M
Ga0193578_118345All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
Ga0193578_118404All Organisms → cellular organisms → Archaea518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0193578_100305Ga0193578_1003052F013050MSKGKQPRTRVNKVPKLLLSEIKAVFILNSQAIGLESANF
Ga0193578_112352Ga0193578_1123522F013096MSTDVVGDSAVGLSTLSQTNTVAVYDPEALGVHDNAGLIDCPPVKEPVIHANDTVTPSPSRKLVVTLEYSRPS
Ga0193578_117120Ga0193578_1171202F013096VVGDSAVGLSTLSQTNTVAVYDPESLGVHDNAGLIDCPAVKDPVIHANDTVTPSPSCTCTKYANA
Ga0193578_118345Ga0193578_1183451F028684TTEKMISDIETFVKEATEIRNTGKKENALAIKDAKDAQNSLTNAIAVLEAFYKESGEIPKEPWEFIQKPVNLPKNPATWDSPYTGVADPDKQPGGIVSVLEGVLSDFAKMEAETKSQEAQDQAEYDESMQSNDIEKAGRTQEVTMKTAEKARRADKIATLSGTKKDTEGDTSN
Ga0193578_118404Ga0193578_1184042F013096MSTDVVGDSAVGLSTLSQTNTVAVYDPEALGVHDNAGLIDCPPVKEPVIHANRHIHSRYI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.