NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300018572

3300018572: Metatranscriptome of marine microbial communities from Baltic Sea - GS678_0p1



Overview

Basic Information
IMG/M Taxon OID3300018572 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0129055 | Gp0214171 | Ga0188843
Sample NameMetatranscriptome of marine microbial communities from Baltic Sea - GS678_0p1
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size24880939
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptome Of Marine Microbial Communities From Baltic Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBaltic Sea
CoordinatesLat. (o)58.581234Long. (o)18.232801Alt. (m)N/ADepth (m)74
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006550Metagenome / Metatranscriptome370N
F061889Metagenome / Metatranscriptome131Y
F086311Metagenome / Metatranscriptome111N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0188843_101047All Organisms → Viruses → Predicted Viral2224Open in IMG/M
Ga0188843_102723All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1259Open in IMG/M
Ga0188843_108887Not Available561Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0188843_101047Ga0188843_1010473F006550MTTKVFNSKKADYKGMQLWLNPVDKTVYATEGKPLHSFSEAGGHAIYDFNKHFTNQKLAKDSFGNNQFSHDAFVDSEFKSLAEEYVADMKNGGRQRSAALRSSTNSAVDIVNVWETVLGKQDRTYAGKNLAKEIAVPNLLISIDTATKFGGMTQLDEGQLSQLKELTYSRSTFEAQKYGLKFVIHEEARLKNVHNVLQDSIQVASNKVEQRQSFDVIALADASLTAKAVTGVWDTFVSSADRSSNSPLIDLGIAKLLIEGSGIGGKMNRIGMHPLDFAKYMGNTFIRGVASTGASEVSFEAGTRELPGFPEAGLVLDNAIRQGDVYCVDTEKEPTIALFQGPQRIGSAHDEETGDDKYFIIDYHLASLIQSETG
Ga0188843_102723Ga0188843_1027232F061889NASGSGVFPGSTVTAEADGFKYLISGSTSGVNVATGTSATAITGSTAYTQLTGMISSIDANVADAPDLTFFCGISVFQRIINGLTVQNLFHFDPTTVKSRGGYYEVPLPGYPNVVIVGGWGLRSSERVVLGPASDMYVGTDLTSDTSNYQLWYDINSDTIKYRLRXXXXKLGTQIGHPEYYVSNDLA
Ga0188843_108887Ga0188843_1088872F086311MANGTEITIQSEDVGTIIKGTAKTRSDGVDTVIDINDLSTIVILLRDPDMTKTEHTATAVNVDGGTDGIWSFTTATAIFSLNPGPWEIQAKYTYSSGNIFYSNTKTLNVGEVLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.