3300018569: Metatranscriptome of marine microbial communities from Baltic Sea - GS678_0p8

Overview

Basic Information

• IMG/M Taxon OID: 3300018569
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0129055 | Gp0214172 | Ga0188844
• Sample Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS678_0p8
• Sequencing Status: Permanent Draft
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 22901701
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Metatranscriptome Of Marine Microbial Communities From Baltic Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Baltic Sea
• Coordinates
  • Lat. (^o): 58.581234
  • Long. (^o): 18.232801
  • Alt. (m): N/A
  • Depth (m): 74

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006002	Metagenome / Metatranscriptome	384	Y
F090050	Metagenome / Metatranscriptome	108	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0188844_100747	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	2445
Ga0188844_101270	All Organisms → Viruses → Predicted Viral	1862

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0188844_100747	Ga0188844_1007472	F006002	MSKAVYCYCLNTYSIECKDKECEAPEYWKQGIGNIGGKVLPEE
Ga0188844_101270	Ga0188844_1012702	F090050	MIRSSKESIETVVTNIENSIDYYINQHTADLNGASRIRNDASIVRGLVEYRSALLDLLEEETPRKKRGNPNFGKDNPYFTKKEGNE