NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017166

3300017166: Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)



Overview

Basic Information
IMG/M Taxon OID3300017166 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212235 | Ga0186523
Sample NameMetatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23519948
Sequencing Scaffolds14
Novel Protein Genes16
Associated Families16

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea9
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAtlantic Ocean
CoordinatesLat. (o)41.30051Long. (o)-71.71543Alt. (m)N/ADepth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011523Metagenome / Metatranscriptome290Y
F015657Metagenome / Metatranscriptome253Y
F018935Metagenome / Metatranscriptome232Y
F019022Metagenome / Metatranscriptome232Y
F019023Metagenome / Metatranscriptome232Y
F026284Metagenome / Metatranscriptome198Y
F034341Metagenome / Metatranscriptome175Y
F044532Metagenome / Metatranscriptome154Y
F045792Metagenome / Metatranscriptome152Y
F051179Metagenome / Metatranscriptome144Y
F062157Metagenome / Metatranscriptome131Y
F067781Metagenome / Metatranscriptome125Y
F071293Metagenome / Metatranscriptome122Y
F081745Metagenome / Metatranscriptome114Y
F083237Metagenome / Metatranscriptome113Y
F096063Metagenome / Metatranscriptome105Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186523_101750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2222Open in IMG/M
Ga0186523_102046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2117Open in IMG/M
Ga0186523_102072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2108Open in IMG/M
Ga0186523_103244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae1797Open in IMG/M
Ga0186523_106059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1342Open in IMG/M
Ga0186523_107984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1127Open in IMG/M
Ga0186523_108973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1023Open in IMG/M
Ga0186523_109618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea963Open in IMG/M
Ga0186523_110107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea920Open in IMG/M
Ga0186523_111263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida815Open in IMG/M
Ga0186523_112594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii713Open in IMG/M
Ga0186523_112901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea689Open in IMG/M
Ga0186523_113932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea609Open in IMG/M
Ga0186523_114169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea590Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186523_101750Ga0186523_1017503F015657MLQDGQEILEGRFQIVKKLGSGAFGEIYKVEKKKTKQFYAAKIVSFAFIA
Ga0186523_102046Ga0186523_1020463F034341MELYASENNFNIFYEKKRRELRNLQQLNEFVKPNPYFVYFMFKDTIHVDDYGSIKETLFKFPSMTRGSQN
Ga0186523_102072Ga0186523_1020721F062157MRHCIDNQIESMVLMDSYVKKNEIRLNTFEYLMRSHEHTLKDQFIKSNFIDRLFSDYIRDFREFNIQFSKIDIEFLAFRRSYPLRLESISLLNTTLMLKKNAPSVYTEVLMYARRHFLCRNEMNLLQTGSMSNKEATSLLLFAIILESNEEDLIYVMVQEGVHRVIKGHLKEYPSLNKRFPVLHQFISGATRSNF
Ga0186523_103244Ga0186523_1032445F083237MVEAFVSTKFFLSVASKMNYDDGIVFTENNIVAYLAELEEYIGSLITYMAFKRDDPNAATSAIPLAQLNEKKFGQRDLDIDLNSIPAKPQREDPVLE
Ga0186523_104399Ga0186523_1043992F067781MFVPLRNAKSQKADFDCVAKIMAIHEMDAYTNELKLRDASGTTFYTLALRLKFPHLKAGQAVRVRSATWDETSNQKSVLSLQHYSNIMTFIGSSKLAGAVARVQDDSAADRAELAKDVPSVAVTISEIDRKYANLPSTSLEELFGGKATADTYRTSFCVTRVEPADIRDAVKVYDRKAKKVSTAKGAKGGELVWNVQLSVKDASTLSNANQYRILNYSHEGLGAAFLGKPSNLWTDAAAAKRVEKSVANLTKFNVWVDAVVERKNGWYYIKDTKLRQ
Ga0186523_106059Ga0186523_1060593F019023MKEGYKHPYHSAEHPISFSYYYYMKTLFEAVGPEQVSPHYESLSRSRRGLIFMFLYIGSITSLSRMGSWSHNEWLRAMVFHHEYIIAFYVGMSELRHFTFLVGPKFTNFYNVYTRYETQQLVSQWADHTEEAQM
Ga0186523_107984Ga0186523_1079842F044532MSAINFYSSIFPEYYWQKPQHDLGNRVVHSSLYKTMNPIRSRYDYAPNEYSQMPFYLGSVPQLNWLYGSLDYSFQKYHK
Ga0186523_108973Ga0186523_1089732F011523MRPDVTNETYVVFRALAKDTDGDFGKFVNSTKKPRDEAQRWRAFKNIARFVKNPVGYLYWKMDPFFAQNRIRVMWGFVIFHLWSSFLLYVMIKNKKEKMIEHWRYRIGETDKTHGQLNRDRRMPVNRIKNYVRYSNFHQVRRNKRISMIHLNWWCRDQNFRKYFEMRKKKDIKPALSGFAHESIFKETAAKNLEISQMRNTHESR
Ga0186523_109618Ga0186523_1096181F026284VKMSEVASRIPVERATGKYKRDWHSTQAEQDAYDDRMRRAMNPQISDYVQNGELICFGVSEHTLEERQFEWTPKALHDLNVLKSWFPKRDLSMITRPAYQSDFNWTNYASRAQLRVALGLLFIRELPIKNFYVRCWLAYGWICWFIVRGVGRGLRHNRPIVLYNHAFNAKALVNYPDLFHWTISRVLPKNPPVPDAHREWRTRQTPVYHQYHKNVYRYRYRRPRYVQWDGSMNQPVMPFLHDQGTDVNNGTFKRNVNTSPQLK
Ga0186523_110107Ga0186523_1101071F071293MVYKIRNKGFGAVFSGTGNVRAYPARKTMVNPDLSTHVTLQVQITRFTGMRVLHNYRNISRATKQFMMGDRFFEQLMILTIREHYFRPMYYKAPIENTFFLGRTLADLTDRHYALFANNQHPLQLAAYNEYNTFLQDLHDQASAARDEEDGQRFTQAIGEA
Ga0186523_111263Ga0186523_1112631F045792MENAKIYAENVIRNRKEAINLRRFGVKMGALSAKLESAHRTQQIST
Ga0186523_111263Ga0186523_1112632F081745MLQKCMKQMDSLGVAGSIGNFEQVFEDLDVKTGDMNAALDNIYSTSIDNGEVMDLLTQMR
Ga0186523_112594Ga0186523_1125942F019022IKARMVFHITNYMRETNVWMIRKMRWILWGTFSFIPIYRNVYWDFLGRRVAWKDSLRGETEADKEAAAVADRADWGYTPRYEGKYDFSIKTKKQAEQTRE
Ga0186523_112901Ga0186523_1129012F051179MIFFYTNFDKCRREIINYEEKRATPSMNKRHPKESKPEALALLRCHAQNLQFEPVCNDPFNDARECLFKMDGQMRICEPELNLFEECVHDPKSFARFQAMATPVQREARDYFSTIHRKNYFF
Ga0186523_113932Ga0186523_1139321F096063MQGDLYSGRYSNDEIRRILEINARPTFLQKPEAAFYKKNALENGPTWAEKREFVHWLINDSNISASSKLYLRENQYWIEKYQLRGLKYGLFASSATFLFFPVIRRQPFVRRFAISMLPMAYFLNWGYVWGHENWWRRQKEVVVTYEIFTGNRHRTTMK
Ga0186523_114169Ga0186523_1141692F018935MSSPQGSGRSTYSYYDYTKSYDSRFLNKYQSHTHWWAGRASGFIELLRLKSVRLKSNRNWMWFDVRYGTKFLYIFYMPQLVYLTASYAITPVWRRLDERYHLRFADGEFDDIDEVEPFVTYQQRKKPYTRRKYADAVKLVYEGKEEYDYAQEQPQRYR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.