x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300016925
3300016925: Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium w/o nitrate, at 20 C, 30 psu salinity and 582 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0746)
Overview
Basic Information
IMG/M Taxon OID 3300016925 Open in IMG/M GOLD Reference Gs0128947 | Gp0211914 | Ga0186202 Sample Name Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium w/o nitrate, at 20 C, 30 psu salinity and 582 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0746) Sequencing Status Permanent Draft Sequencing Center National Center for Genome Resources Published? N Use Policy Open
Dataset Contents
Total Genome Size 24170798 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta 1 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Location Information
Location Coordinates Lat. (o ) N/A Long. (o ) N/A Alt. (m) N/A Depth (m) 0 Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F045520 Metagenome / Metatranscriptome 152 Y F082263 Metagenome / Metatranscriptome 113 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186202_100389 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta 3828 Open in IMG/M Ga0186202_109287 All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae 954 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186202_100389 Ga0186202_1003892 F082263 MFSLHMFINIIFLLLIDLLLFYFLPRLALSSIPDERRTEAVQEWAGAVSDMVQNEVELDAWCVERSIVSIRVAKQGGEGWLNMSELRDLYRWMSMDVSSLVTEASAEEKESLSKPAYIGQPVDVAESHAIVRVALGVDSLLSYFDNKVGTLEEDKATVQKLAAIAKHFNTLKKSGM Ga0186202_109287 Ga0186202_1092871 F045520 MAFNRLYKQIETLIRTDDEVADSIPCKSDILSLRECRKGGKTCDDLGLELLRCMAQYKVDTTEKIRQAIGVAKYNEYVKAMVEKHGKEKAEEIIAEPSEQLKDIEAYQVLHRVANNTHPKGAPKTAEGMKEWTYADQVRLEMGEQEWWDAVKIVGCEFGVEKADALFGLAKEKELIESAQDRLVPGLKEKRAQGLEAYKKVEASVKEAAPGAKSPADYAAAFKDLYPTKEDLESALK
